BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C17

Length=554
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010095035.1|  Mannose-1-phosphate guanylyltransferase 1          232   1e-71   Morus notabilis
ref|XP_009594230.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    232   1e-71   Nicotiana tomentosiformis
ref|NP_001275205.1|  GDP-mannose pyrophosphorylase                      232   2e-71   Solanum tuberosum [potatoes]
ref|NP_001234025.1|  GDP-mannose pyrophosphorylase                      232   2e-71   Solanum lycopersicum
ref|XP_004240924.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    232   2e-71   Solanum lycopersicum
ref|NP_001276259.1|  mannose-1-phosphate guanylyltransferase 1-like     231   2e-71   
ref|NP_001234084.1|  GDP-mannose pyrophosphorylase                      231   2e-71   
gb|KHN13115.1|  Mannose-1-phosphate guanylyltransferase 1               231   3e-71   Glycine soja [wild soybean]
emb|CBI31615.3|  unnamed protein product                                228   3e-71   Vitis vinifera
gb|KDO69185.1|  hypothetical protein CISIN_1g018060mg                   231   3e-71   Citrus sinensis [apfelsine]
ref|XP_007163469.1|  hypothetical protein PHAVU_001G236800g             224   3e-71   Phaseolus vulgaris [French bean]
ref|XP_006486418.1|  PREDICTED: probable mannose-1-phosphate guan...    231   3e-71   Citrus sinensis [apfelsine]
ref|XP_006435610.1|  hypothetical protein CICLE_v10033733mg             231   3e-71   Citrus clementina [clementine]
gb|KDO69184.1|  hypothetical protein CISIN_1g018060mg                   231   3e-71   Citrus sinensis [apfelsine]
gb|ADV59923.1|  putative GDP-mannose pyrophosphorylase                  231   3e-71   Citrus unshiu [satsuma mandarin]
ref|XP_006338820.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    231   6e-71   Solanum tuberosum [potatoes]
ref|NP_001276240.1|  mannose-1-phosphate guanylyltransferase 1-like     231   6e-71   Glycine max [soybeans]
ref|XP_007141846.1|  hypothetical protein PHAVU_008G230600g             230   6e-71   Phaseolus vulgaris [French bean]
gb|EYU19947.1|  hypothetical protein MIMGU_mgv1a008833mg                230   6e-71   Erythranthe guttata [common monkey flower]
ref|XP_003544186.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    231   6e-71   
gb|ACN38266.1|  GDP-D-mannose pyrophosphorylase                         230   7e-71   Actinidia latifolia
ref|XP_009388596.1|  PREDICTED: probable mannose-1-phosphate guan...    230   8e-71   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011076786.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    230   8e-71   Sesamum indicum [beniseed]
gb|AGI78460.1|  GDP-D-mannose pyrophosphorylase                         230   1e-70   Camellia sinensis [black tea]
ref|XP_009759296.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    230   1e-70   Nicotiana sylvestris
ref|XP_004490906.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    230   1e-70   Cicer arietinum [garbanzo]
ref|XP_009797660.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   1e-70   Nicotiana sylvestris
gb|AIN40499.1|  GDP-D-mannose pyrophosphorylase                         229   1e-70   Ziziphus jujuba [Chinese jujube]
gb|KJB74050.1|  hypothetical protein B456_011G269100                    229   2e-70   Gossypium raimondii
ref|XP_010262630.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   2e-70   Nelumbo nucifera [Indian lotus]
dbj|BAB62108.1|  GDP-D-mannose pyrophosphorylase                        229   2e-70   Nicotiana tabacum [American tobacco]
ref|XP_010256792.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   2e-70   Nelumbo nucifera [Indian lotus]
gb|KDO35843.1|  hypothetical protein CISIN_1g046608mg                   226   2e-70   Citrus sinensis [apfelsine]
ref|XP_002282422.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   2e-70   Vitis vinifera
ref|XP_009592609.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    229   3e-70   Nicotiana tomentosiformis
ref|XP_008803133.1|  PREDICTED: probable mannose-1-phosphate guan...    229   3e-70   Phoenix dactylifera
ref|XP_009387284.1|  PREDICTED: probable mannose-1-phosphate guan...    228   4e-70   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010691388.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    228   4e-70   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011085013.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    228   4e-70   Sesamum indicum [beniseed]
ref|XP_007218178.1|  hypothetical protein PRUPE_ppa007618mg             228   5e-70   Prunus persica
ref|XP_003616475.1|  Mannose-1-phosphate guanyltransferase              228   6e-70   Medicago truncatula
gb|KDO48143.1|  hypothetical protein CISIN_1g0201131mg                  225   6e-70   Citrus sinensis [apfelsine]
ref|XP_008371997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    228   8e-70   Malus domestica [apple tree]
ref|XP_006601845.1|  PREDICTED: uncharacterized protein LOC100818...    228   8e-70   
ref|XP_002311190.1|  cytokinesis defective 1 family protein             228   9e-70   Populus trichocarpa [western balsam poplar]
ref|XP_009343927.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    227   9e-70   Pyrus x bretschneideri [bai li]
ref|NP_001242262.1|  uncharacterized protein LOC100818016               227   9e-70   
ref|XP_010937548.1|  PREDICTED: probable mannose-1-phosphate guan...    227   1e-69   Elaeis guineensis
ref|XP_004984923.1|  PREDICTED: probable mannose-1-phosphate guan...    227   1e-69   Setaria italica
ref|XP_008441398.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    227   1e-69   Cucumis melo [Oriental melon]
ref|XP_008785513.1|  PREDICTED: probable mannose-1-phosphate guan...    227   1e-69   
ref|XP_007009211.1|  Glucose-1-phosphate adenylyltransferase fami...    227   1e-69   Theobroma cacao [chocolate]
emb|CDP16056.1|  unnamed protein product                                227   1e-69   Coffea canephora [robusta coffee]
ref|XP_010923222.1|  PREDICTED: probable mannose-1-phosphate guan...    227   2e-69   Elaeis guineensis
gb|ABB53473.1|  GDP-mannose pyrophosphorylase                           227   2e-69   Malpighia glabra [acerola]
ref|XP_002316262.1|  cytokinesis defective 1 family protein             226   2e-69   Populus trichocarpa [western balsam poplar]
ref|XP_011036070.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    226   2e-69   Populus euphratica
ref|XP_010931208.1|  PREDICTED: probable mannose-1-phosphate guan...    226   2e-69   Elaeis guineensis
ref|XP_004307574.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    226   2e-69   Fragaria vesca subsp. vesca
ref|XP_003558261.1|  PREDICTED: probable mannose-1-phosphate guan...    226   2e-69   Brachypodium distachyon [annual false brome]
ref|XP_006429173.1|  hypothetical protein CICLE_v10012040mg             226   3e-69   
ref|XP_006493574.1|  PREDICTED: probable mannose-1-phosphate guan...    226   3e-69   Citrus sinensis [apfelsine]
emb|CDP00140.1|  unnamed protein product                                226   3e-69   Coffea canephora [robusta coffee]
ref|XP_011035050.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    226   3e-69   Populus euphratica
ref|XP_008801635.1|  PREDICTED: probable mannose-1-phosphate guan...    226   3e-69   Phoenix dactylifera
ref|XP_008777609.1|  PREDICTED: probable mannose-1-phosphate guan...    226   3e-69   Phoenix dactylifera
gb|KHG16049.1|  Mannose-1-phosphate guanyltransferase                   226   4e-69   Gossypium arboreum [tree cotton]
ref|XP_002524227.1|  mannose-1-phosphate guanyltransferase, putative    226   5e-69   Ricinus communis
ref|XP_008801637.1|  PREDICTED: probable mannose-1-phosphate guan...    225   5e-69   Phoenix dactylifera
ref|XP_010067451.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    226   5e-69   Eucalyptus grandis [rose gum]
gb|KJB76777.1|  hypothetical protein B456_012G106900                    225   5e-69   Gossypium raimondii
gb|ABI48955.1|  GDP-D-mannose pyrophosphorylase                         225   5e-69   Viola baoshanensis
ref|NP_001142215.1|  hypothetical protein                               225   6e-69   Zea mays [maize]
gb|ACW84415.1|  GDP-D-mannose pyrophosphorylase                         225   6e-69   Glycine max [soybeans]
gb|EAY89395.1|  hypothetical protein OsI_10901                          225   6e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001049673.1|  Os03g0268400                                       225   6e-69   
gb|KDP44883.1|  hypothetical protein JCGZ_01383                         225   7e-69   Jatropha curcas
gb|KHN17882.1|  Mannose-1-phosphate guanylyltransferase 1               225   7e-69   Glycine soja [wild soybean]
ref|NP_001240188.1|  mannose-1-phosphate guanylyltransferase 1-like     225   8e-69   Glycine max [soybeans]
ref|XP_010088589.1|  Mannose-1-phosphate guanylyltransferase 1          224   1e-68   Morus notabilis
ref|XP_009412560.1|  PREDICTED: probable mannose-1-phosphate guan...    224   2e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009407514.1|  PREDICTED: probable mannose-1-phosphate guan...    224   3e-68   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006649823.1|  PREDICTED: probable mannose-1-phosphate guan...    223   3e-68   Oryza brachyantha
ref|NP_001044795.1|  Os01g0847200                                       223   3e-68   
sp|Q6Z9A3.1|GMPP3_ORYSJ  RecName: Full=Probable mannose-1-phospha...    223   4e-68   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006645004.1|  PREDICTED: probable mannose-1-phosphate guan...    223   4e-68   Oryza brachyantha
ref|XP_003600761.1|  Mannose-1-phosphate guanyltransferase              223   5e-68   
ref|XP_006846369.1|  hypothetical protein AMTR_s00012p00262290          223   6e-68   Amborella trichopoda
ref|XP_007026922.1|  Glucose-1-phosphate adenylyltransferase fami...    223   6e-68   
ref|XP_007009213.1|  Glucose-1-phosphate adenylyltransferase fami...    222   8e-68   
ref|XP_007009215.1|  Glucose-1-phosphate adenylyltransferase fami...    222   8e-68   
ref|XP_010554624.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    222   9e-68   Tarenaya hassleriana [spider flower]
emb|CDY07636.1|  BnaA03g18750D                                          223   9e-68   Brassica napus [oilseed rape]
gb|EPS66224.1|  hypothetical protein M569_08552                         222   1e-67   Genlisea aurea
ref|XP_002879816.1|  hypothetical protein ARALYDRAFT_483004             222   1e-67   
emb|CDM85018.1|  unnamed protein product                                222   1e-67   Triticum aestivum [Canadian hard winter wheat]
emb|CDY07033.1|  BnaA04g22820D                                          222   1e-67   
gb|EMT31032.1|  Mannose-1-phosphate guanyltransferase beta              222   1e-67   
ref|XP_010505663.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    222   1e-67   Camelina sativa [gold-of-pleasure]
ref|XP_006294448.1|  hypothetical protein CARUB_v10023461mg             222   1e-67   
dbj|BAJ95730.1|  predicted protein                                      222   1e-67   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFL69833.1|  mannose-1-phosphate guanyltransferase 4                 222   1e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_006846372.1|  hypothetical protein AMTR_s00012p00262630          222   1e-67   Amborella trichopoda
ref|XP_009141836.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    222   1e-67   Brassica rapa
ref|XP_006411211.1|  hypothetical protein EUTSA_v10016850mg             222   2e-67   Eutrema salsugineum [saltwater cress]
gb|AFL69830.1|  mannose-1-phosphate guanyltransferase 1                 221   2e-67   Oryza sativa Indica Group [Indian rice]
gb|AFL69832.1|  mannose-1-phosphate guanyltransferase 3                 221   2e-67   Oryza sativa Indica Group [Indian rice]
ref|XP_002308180.1|  hypothetical protein POPTR_0006s09130g             221   2e-67   Populus trichocarpa [western balsam poplar]
gb|ACN66754.1|  GMP                                                     221   2e-67   Carica papaya [mamon]
emb|CAC35355.1|  GDP-mannose pyrophosphorylase                          221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004138454.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    221   2e-67   Cucumis sativus [cucumbers]
ref|NP_181507.1|  GDP-mannose pyrophosphorylase/ mannose-1-pyroph...    221   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009133383.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    221   2e-67   Brassica rapa
ref|XP_011016812.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    221   2e-67   Populus euphratica
ref|XP_003564604.1|  PREDICTED: probable mannose-1-phosphate guan...    221   3e-67   Brachypodium distachyon [annual false brome]
ref|NP_001142302.1|  uncharacterized protein LOC100274471               221   3e-67   Zea mays [maize]
emb|CDX93234.1|  BnaC04g46620D                                          221   3e-67   
ref|XP_004970565.1|  PREDICTED: probable mannose-1-phosphate guan...    221   3e-67   Setaria italica
ref|XP_010534527.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    221   3e-67   Tarenaya hassleriana [spider flower]
ref|XP_002456631.1|  hypothetical protein SORBIDRAFT_03g039740          221   3e-67   Sorghum bicolor [broomcorn]
gb|AHB17740.1|  GDP-mannose pyrophosphorylase                           221   3e-67   Pogonatherum paniceum
gb|ABR15468.1|  GDP-mannose pyrophosphorylase                           221   4e-67   Pinus taeda
gb|ACK87007.1|  GDP-mannose pyrophosphorylase                           221   4e-67   Carica papaya [mamon]
ref|XP_008674826.1|  PREDICTED: probable mannose-1-phosphate guan...    220   7e-67   
ref|XP_004977599.1|  PREDICTED: probable mannose-1-phosphate guan...    220   8e-67   Setaria italica
gb|ABR17757.1|  unknown                                                 220   9e-67   Picea sitchensis
ref|XP_002310933.1|  cytokinesis defective 1 family protein             220   1e-66   Populus trichocarpa [western balsam poplar]
gb|AHX59161.1|  GDP-mannose pyrophosphorylase                           214   2e-66   
ref|XP_010529799.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    218   3e-66   Tarenaya hassleriana [spider flower]
ref|XP_007026924.1|  Glucose-1-phosphate adenylyltransferase fami...    218   4e-66   
gb|ABK24420.1|  unknown                                                 217   1e-65   Picea sitchensis
ref|XP_002966693.1|  hypothetical protein SELMODRAFT_168373             216   2e-65   Selaginella moellendorffii
ref|XP_011033044.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    217   2e-65   Populus euphratica
ref|XP_001782193.1|  predicted protein                                  216   2e-65   
gb|AHX74219.1|  GDP-mannose pyrophosphorylase                           216   2e-65   
ref|XP_002974469.1|  hypothetical protein SELMODRAFT_267755             216   2e-65   Selaginella moellendorffii
ref|XP_002990832.1|  hypothetical protein SELMODRAFT_185648             216   2e-65   Selaginella moellendorffii
gb|ABK24789.1|  unknown                                                 215   4e-65   Picea sitchensis
ref|XP_009143286.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    214   8e-65   Brassica rapa
ref|XP_001769404.1|  predicted protein                                  214   1e-64   
emb|CDX74832.1|  BnaA05g05780D                                          214   2e-64   
gb|ABR15469.1|  GDP-mannose pyrophosphorylase                           213   3e-64   Pinus taeda
ref|XP_004246437.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    213   4e-64   Solanum lycopersicum
ref|XP_006340997.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    213   4e-64   Solanum tuberosum [potatoes]
ref|XP_009601713.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    212   8e-64   Nicotiana tomentosiformis
gb|AFK47417.1|  unknown                                                 206   2e-61   Lotus japonicus
emb|CDY05114.1|  BnaC03g29120D                                          201   7e-61   
ref|XP_009134205.1|  PREDICTED: probable mannose-1-phosphate guan...    202   5e-60   Brassica rapa
ref|XP_010432971.1|  PREDICTED: probable mannose-1-phosphate guan...    202   5e-60   Camelina sativa [gold-of-pleasure]
ref|XP_009137936.1|  PREDICTED: probable mannose-1-phosphate guan...    202   5e-60   Brassica rapa
emb|CDX90771.1|  BnaA03g24510D                                          202   5e-60   
ref|XP_010438164.1|  PREDICTED: probable mannose-1-phosphate guan...    201   6e-60   Camelina sativa [gold-of-pleasure]
gb|KFK29636.1|  hypothetical protein AALP_AA7G159400                    204   8e-60   Arabis alpina [alpine rockcress]
emb|CDX90770.1|  BnaA03g24500D                                          202   8e-60   
ref|NP_191118.1|  probable mannose-1-phosphate guanylyltransferase 2    201   1e-59   Arabidopsis thaliana [mouse-ear cress]
emb|CDY39219.1|  BnaA03g50310D                                          201   1e-59   Brassica napus [oilseed rape]
ref|XP_010941227.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    201   1e-59   Elaeis guineensis
emb|CAB79775.1|  GDP-mannose pyrophosphorylase like protein             201   1e-59   Arabidopsis thaliana [mouse-ear cress]
gb|EMT15706.1|  Mannose-1-phosphate guanyltransferase beta              199   2e-59   
ref|XP_010438160.1|  PREDICTED: probable mannose-1-phosphate guan...    200   3e-59   Camelina sativa [gold-of-pleasure]
ref|XP_009791580.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    199   1e-58   Nicotiana sylvestris
emb|CDX72252.1|  BnaC07g42740D                                          198   2e-58   
ref|XP_010412788.1|  PREDICTED: probable mannose-1-phosphate guan...    197   3e-58   Camelina sativa [gold-of-pleasure]
gb|EMS68890.1|  Mannose-1-phosphate guanyltransferase beta              199   3e-58   Triticum urartu
ref|XP_008799379.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    197   4e-58   Phoenix dactylifera
ref|XP_006412681.1|  hypothetical protein EUTSA_v10025578mg             197   5e-58   Eutrema salsugineum [saltwater cress]
emb|CDY39215.1|  BnaA03g50270D                                          195   1e-57   Brassica napus [oilseed rape]
emb|CDY20480.1|  BnaC04g05640D                                          196   2e-57   Brassica napus [oilseed rape]
ref|XP_002952855.1|  hypothetical protein VOLCADRAFT_81984              195   4e-57   Volvox carteri f. nagariensis
ref|XP_001695916.1|  GDP-D-mannose pyrophosphorylase                    194   4e-57   Chlamydomonas reinhardtii
ref|XP_010427339.1|  PREDICTED: probable mannose-1-phosphate guan...    193   1e-56   
ref|XP_010275250.1|  PREDICTED: mannose-1-phosphate guanylyltrans...    192   3e-56   Nelumbo nucifera [Indian lotus]
gb|KDP38962.1|  hypothetical protein JCGZ_00719                         190   3e-55   Jatropha curcas
ref|XP_005652260.1|  GDP-D-mannose pyrophosphorylase                    189   4e-55   Coccomyxa subellipsoidea C-169
ref|XP_004368238.1|  GDPmannose pyrophosphorylase                       187   2e-54   Acanthamoeba castellanii str. Neff
ref|XP_005851739.1|  hypothetical protein CHLNCDRAFT_133102             187   5e-54   Chlorella variabilis
ref|XP_011399603.1|  Mannose-1-phosphate guanyltransferase              186   1e-53   Auxenochlorella protothecoides
dbj|BAP75927.1|  GDP-mannose pyrophosphorylase                          184   2e-53   Moringa oleifera [maranga]
emb|CCA19060.1|  mannose1phosphate guanyltransferase beta putative      183   1e-52   Albugo laibachii Nc14
gb|AGL46676.1|  GDP-mannose pyrophosphorylase                           181   5e-52   Gracilaria changii
gb|AGC69739.1|  mannose-1-phosphate guanylyltransferase                 181   6e-52   Tieghemostelium lacteum
ref|XP_009537794.1|  hypothetical protein PHYSODRAFT_319613             180   2e-51   Phytophthora sojae
ref|XP_008903956.1|  hypothetical protein PPTG_09918                    179   3e-51   Phytophthora parasitica INRA-310
ref|XP_002899327.1|  mannose-1-phosphate guanyltransferase beta, ...    179   5e-51   Phytophthora infestans T30-4
ref|XP_003610574.1|  Mannose-1-phosphate guanyltransferase              178   5e-51   
gb|EMS58078.1|  Mannose-1-phosphate guanyltransferase beta              180   6e-51   Triticum urartu
ref|XP_005706305.1|  mannose-1-phosphate guanylyltransferase            178   7e-51   Galdieria sulphuraria
emb|CCI41880.1|  unnamed protein product                                186   1e-50   Albugo candida
ref|XP_637125.1|  mannose-1-phosphate guanylyltransferase               178   1e-50   Dictyostelium discoideum AX4
ref|XP_003287195.1|  mannose-1-phosphate guanylyltransferase            177   2e-50   Dictyostelium purpureum
gb|ACN88684.2|  GDP-D-mannose pyrophosphorylase                         176   3e-50   Malus domestica [apple tree]
ref|XP_005710557.1|  mannose-1-phosphate guanylyltransferase            176   4e-50   Chondrus crispus [carageen]
ref|XP_007790760.1|  putative mannose-1-phosphate guanyltransfera...    170   6e-50   
gb|EPY51214.1|  mannose-1-phosphate guanyltransferase Mpg1              176   8e-50   Schizosaccharomyces cryophilus OY26
dbj|BAN16547.1|  ADB2008858                                             176   1e-49   Acytostelium subglobosum
ref|XP_009650791.1|  mannose-1-phosphate guanyltransferase              175   1e-49   Verticillium dahliae VdLs.17
ref|XP_004353971.1|  mannose-1-phosphate guanylyltransferase            174   2e-49   Cavenderia fasciculata
gb|AAP80837.1|  GDP-D-mannose pyrophosphorylase                         168   2e-49   Griffithsia japonica
ref|XP_006682149.1|  hypothetical protein BATDEDRAFT_20856              174   3e-49   Batrachochytrium dendrobatidis JAM81
ref|XP_002174350.1|  mannose-1-phosphate guanyltransferase Mpg1         174   3e-49   Schizosaccharomyces japonicus yFS275
emb|CDS14169.1|  Putative Mannose-1-phosphate guanyltransferase         174   3e-49   Lichtheimia ramosa
emb|CEJ05128.1|  Putative Mannose-1-phosphate guanyltransferase         172   3e-49   Rhizopus microsporus
gb|EFA80657.1|  mannose-1-phosphate guanylyltransferase                 174   4e-49   Heterostelium album PN500
dbj|BAA13790.1|  unnamed protein product                                174   5e-49   Schizosaccharomyces pombe
ref|NP_588405.1|  mannose-1-phosphate guanyltransferase Mpg1            174   5e-49   
dbj|GAM18590.1|  hypothetical protein SAMD00019534_017650               173   7e-49   Acytostelium subglobosum LB1
gb|EIE85443.1|  mannose-1-phosphate guanyltransferase                   173   7e-49   Rhizopus delemar RA 99-880
gb|EPX73569.1|  mannose-1-phosphate guanyltransferase Mpg1              173   1e-48   Schizosaccharomyces octosporus yFS286
emb|CEP10265.1|  hypothetical protein                                   173   1e-48   Parasitella parasitica
emb|CDR44464.1|  CYFA0S14e02960g1_1                                     172   1e-48   Cyberlindnera fabianii
emb|CEI86119.1|  Putative Mannose-1-phosphate guanyltransferase         173   2e-48   Rhizopus microsporus
dbj|GAN07474.1|  conserved hypothetical protein                         172   2e-48   Mucor ambiguus
gb|KFH62576.1|  mannose-1-phosphate guanyltransferase                   172   2e-48   Mortierella verticillata NRRL 6337
emb|CEG73578.1|  Putative Mannose-1-phosphate guanyltransferase         172   2e-48   Rhizopus microsporus
gb|EGA87676.1|  Psa1p                                                   169   2e-48   Saccharomyces cerevisiae VL3
gb|EPB86770.1|  mannose-1-phosphate guanyltransferase                   172   2e-48   Mucor circinelloides f. circinelloides 1006PhL
gb|EGA75738.1|  Psa1p                                                   169   2e-48   Saccharomyces cerevisiae AWRI796
ref|XP_004347896.1|  mannose-1-phosphate guanyltransferase beta         172   2e-48   Capsaspora owczarzaki ATCC 30864
ref|XP_006678904.1|  hypothetical protein BATDEDRAFT_16693              172   3e-48   Batrachochytrium dendrobatidis JAM81
gb|EGA59462.1|  Psa1p                                                   169   3e-48   Saccharomyces cerevisiae FostersB
gb|KIW41620.1|  mannose-1-phosphate guanyltransferase, variant          172   3e-48   Exophiala oligosperma
ref|XP_011102864.1|  psa1p                                              172   3e-48   
emb|CDH56858.1|  mannose-1-phosphate guanyltransferase                  171   3e-48   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDS14396.1|  Putative Mannose-1-phosphate guanyltransferase         171   4e-48   Lichtheimia ramosa
gb|KFH70136.1|  mannose-1-phosphate guanyltransferase                   171   4e-48   Mortierella verticillata NRRL 6337
emb|CDH56859.1|  mannose-1-phosphate guanyltransferase                  171   4e-48   Lichtheimia corymbifera JMRC:FSU:9682
emb|CDH48439.1|  mannose-1-phosphate guanyltransferase                  171   4e-48   Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_010432972.1|  PREDICTED: probable mannose-1-phosphate guan...    171   5e-48   
emb|CDS03573.1|  Putative Mannose-1-phosphate guanyltransferase         171   5e-48   Lichtheimia ramosa
gb|EIE84524.1|  mannose-1-phosphate guanyltransferase                   171   5e-48   Rhizopus delemar RA 99-880
dbj|BAO41930.1|  mannose-1-phosphate guanyltransferase                  171   5e-48   Kluyveromyces marxianus DMKU3-1042
gb|EIE79690.1|  mannose-1-phosphate guanyltransferase                   171   6e-48   Rhizopus delemar RA 99-880
emb|CEI86118.1|  Putative Mannose-1-phosphate guanyltransferase         173   6e-48   Rhizopus microsporus
ref|XP_002495260.1|  ZYRO0B07150p                                       171   6e-48   Zygosaccharomyces rouxii
emb|CCX14363.1|  Similar to Mannose-1-phosphate guanyltransferase...    171   8e-48   Pyronema omphalodes CBS 100304
emb|CEP07577.1|  hypothetical protein                                   171   8e-48   Parasitella parasitica
emb|CDH17206.1|  Mannose-1-phosphate guanyltransferase                  170   9e-48   Zygosaccharomyces bailii ISA1307
emb|CDF91365.1|  ZYBA0S11-01222g1_1                                     170   9e-48   Zygosaccharomyces bailii CLIB 213
ref|NP_986146.1|  AFR599Wp                                              170   9e-48   Eremothecium gossypii ATCC 10895
ref|XP_011273620.1|  Mannose-1-phosphate guanyltransferase              170   1e-47   Wickerhamomyces ciferrii
ref|XP_002840397.1|  hypothetical protein                               170   1e-47   Tuber melanosporum Mel28
gb|KIV83904.1|  mannose-1-phosphate guanyltransferase                   170   1e-47   Exophiala sideris
ref|NP_010228.1|  mannose-1-phosphate guanylyltransferase               170   1e-47   Saccharomyces cerevisiae S288C
gb|AGO10911.1|  AaceriAFR599Wp                                          170   1e-47   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_447012.1|  hypothetical protein                                  170   1e-47   [Candida] glabrata
gb|KIW58406.1|  mannose-1-phosphate guanyltransferase                   170   1e-47   Exophiala xenobiotica
emb|CCG83440.1|  Mannose-1-phosphate guanylyltransferase                170   1e-47   Taphrina deformans PYCC 5710
gb|KFY61094.1|  hypothetical protein V496_05148                         170   1e-47   Pseudogymnoascus sp. VKM F-4515 (FW-2607)
ref|XP_004576712.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   2e-47   
gb|KFY85514.1|  hypothetical protein V500_08352                         170   2e-47   Pseudogymnoascus sp. VKM F-4518 (FW-2643)
gb|KFY75477.1|  hypothetical protein V499_04519                         170   2e-47   Pseudogymnoascus sp. VKM F-103
gb|KFX86865.1|  hypothetical protein V490_08766                         170   2e-47   Pseudogymnoascus sp. VKM F-3557
ref|XP_007416726.1|  hypothetical protein MELLADRAFT_73277              170   2e-47   Melampsora larici-populina 98AG31
gb|ELR08715.1|  mannose-1-phosphate guanyltransferase                   169   2e-47   Pseudogymnoascus destructans 20631-21
ref|XP_001642832.1|  hypothetical protein Kpol_414p7                    169   2e-47   Vanderwaltozyma polyspora DSM 70294
dbj|GAM82195.1|  hypothetical protein ANO11243_001740                   169   2e-47   fungal sp. No.11243
gb|KFY30807.1|  hypothetical protein V494_08049                         169   3e-47   Pseudogymnoascus sp. VKM F-4513 (FW-928)
gb|EHN03270.1|  Psa1p                                                   169   4e-47   Saccharomyces cerevisiae x Saccharomyces kudriavzevii VIN7
gb|EJU01665.1|  mannose-1-phosphate guanylyltransferase                 169   4e-47   Dacryopinax primogenitus
ref|XP_454190.1|  hypothetical protein                                  169   4e-47   Kluyveromyces lactis
emb|CCK70177.1|  hypothetical protein KNAG_0D04310                      169   4e-47   Kazachstania naganishii CBS 8797
gb|KIW14322.1|  mannose-1-phosphate guanyltransferase                   169   4e-47   Exophiala spinifera
gb|EPZ31169.1|  Mannose-1-phosphate guanyltransferase                   169   4e-47   Rozella allomycis CSF55
gb|AAA69677.1|  mannose-1-phosphate guanyltransferase                   169   5e-47   Saccharomyces cerevisiae [brewer's yeast]
ref|XP_003684339.1|  hypothetical protein TPHA_0B02325                  168   5e-47   Tetrapisispora phaffii CBS 4417
gb|KFY19685.1|  hypothetical protein V491_04283                         169   5e-47   Pseudogymnoascus sp. VKM F-3775
ref|XP_003330316.1|  mannose-1-phosphate guanyltransferase              169   5e-47   Puccinia graminis f. sp. tritici CRL 75-36-700-3
ref|XP_007416733.1|  hypothetical protein MELLADRAFT_45596              168   5e-47   Melampsora larici-populina 98AG31
ref|XP_003684195.1|  hypothetical protein TPHA_0B00890                  168   5e-47   Tetrapisispora phaffii CBS 4417
ref|XP_007925621.1|  hypothetical protein MYCFIDRAFT_88680              168   5e-47   Pseudocercospora fijiensis CIRAD86
ref|XP_009154013.1|  mannose-1-phosphate guanyltransferase              169   6e-47   Exophiala dermatitidis NIH/UT8656
emb|CDO94334.1|  unnamed protein product                                168   6e-47   Kluyveromyces dobzhanskii CBS 2104
ref|XP_002670915.1|  predicted protein                                  169   6e-47   Naegleria gruberi strain NEG-M
gb|EPB82783.1|  mannose-1-phosphate guanyltransferase                   168   6e-47   Mucor circinelloides f. circinelloides 1006PhL
dbj|GAN08793.1|  conserved hypothetical protein                         168   7e-47   Mucor ambiguus
gb|KFY24564.1|  hypothetical protein V493_05165                         168   8e-47   Pseudogymnoascus sp. VKM F-4281 (FW-2241)
ref|XP_001483241.1|  mannose-1-phosphate guanyltransferase              168   8e-47   Meyerozyma guilliermondii ATCC 6260
ref|XP_958811.1|  mannose-1-phosphate guanyltransferase                 168   9e-47   Neurospora crassa OR74A
ref|XP_009216053.1|  mannose-1-phosphate guanyltransferase              168   9e-47   Gaeumannomyces tritici R3-111a-1
emb|CCE42239.1|  hypothetical protein CPAR2_807880                      168   9e-47   
dbj|GAD97068.1|  mannose-1-phosphate guanyltransferase, putative        168   9e-47   
ref|XP_003868406.1|  Srb1 protein                                       167   1e-46   
gb|ERS98065.1|  mannose-1-phosphate guanyltransferase                   167   1e-46   
gb|KIW41619.1|  mannose-1-phosphate guanyltransferase                   168   1e-46   
gb|ESA01850.1|  hypothetical protein GLOINDRAFT_256407                  167   1e-46   
ref|XP_007416573.1|  hypothetical protein MELLADRAFT_112114             167   1e-46   
ref|XP_001247805.1|  hypothetical protein CIMG_01576                    167   2e-46   
ref|XP_002840424.1|  hypothetical protein                               167   2e-46   
gb|KIW02373.1|  mannose-1-phosphate guanyltransferase                   167   2e-46   
gb|EER39809.1|  mannose-1-phosphate guanyltransferase                   166   2e-46   
ref|XP_003065665.1|  mannose-1-phosphate guanyltransferase, putative    167   2e-46   
ref|XP_445459.1|  hypothetical protein                                  167   2e-46   
ref|XP_004178122.1|  hypothetical protein TBLA_0A08130                  167   2e-46   
gb|ESZ99359.1|  mannose-1-phosphate guanyltransferase                   167   2e-46   
ref|XP_007784388.1|  mannose-1-phosphate guanyltransferase              167   2e-46   
emb|CEP60435.1|  LALA0S01e10814g1_1                                     167   2e-46   
ref|XP_003645297.1|  hypothetical protein Ecym_2782                     167   2e-46   
gb|EGD99736.1|  mannose-1-phosphate guanyltransferase                   167   2e-46   
ref|XP_002553315.1|  KLTH0D13948p                                       167   2e-46   
gb|EZF26089.1|  mannose-1-phosphate guanyltransferase                   167   3e-46   
ref|XP_003714211.1|  mannose-1-phosphate guanyltransferase              167   3e-46   
ref|XP_007288932.1|  mannose-1-phosphate guanyltransferase              167   3e-46   
gb|KHJ35688.1|  putative mannose-1-phosphate guanyltransferase          167   3e-46   
ref|XP_501519.1|  YALI0C06490p                                          167   3e-46   
ref|XP_003958483.1|  hypothetical protein KAFR_0G03160                  166   3e-46   
ref|XP_009261432.1|  hypothetical protein FPSE_10040                    166   3e-46   
gb|EMG49043.1|  Mannose-1-phosphate guanyltransferase                   166   3e-46   
ref|XP_007376666.1|  mannose-1-phosphate guanyltransferase              166   3e-46   
ref|XP_002419678.1|  GDP-mannose pyrophosphorylase, putative; man...    166   3e-46   
ref|XP_003681594.1|  hypothetical protein TDEL_0E01400                  166   4e-46   
ref|XP_003170792.1|  mannose-1-phosphate guanyltransferase              166   4e-46   
ref|XP_007674996.1|  hypothetical protein BAUCODRAFT_146867             166   4e-46   
ref|XP_710946.1|  GDP-mannose pyrophosphorylase                         166   4e-46   
ref|XP_001544505.1|  mannose-1-phosphate guanyltransferase              166   4e-46   
ref|XP_006689599.1|  mannose-1-phosphate guanyltransferase              166   4e-46   
ref|XP_007915413.1|  putative mannose-1-phosphate guanyltransfera...    166   4e-46   
sp|Q5B1J4.2|MPG1_EMENI  RecName: Full=Mannose-1-phosphate guanylt...    166   4e-46   
gb|EGC43154.1|  mannose-1-phosphate guanylyltransferase                 166   5e-46   
gb|EEH08109.1|  mannose-1-phosphate guanylyltransferase                 166   5e-46   
gb|AAC64911.1|  putative GDP-mannose pyrophosphorylase                  166   5e-46   
gb|AAC64912.1|  putative GDP-mannose pyrophosphorylase                  166   5e-46   
ref|XP_001598078.1|  hypothetical protein SS1G_00164                    164   5e-46   
ref|XP_003350612.1|  hypothetical protein SMAC_07928                    166   6e-46   
ref|XP_004996866.1|  GDP-D-mannose pyrophosphorylase                    166   7e-46   
ref|XP_010757055.1|  mannose-1-phosphate guanyltransferase              166   7e-46   
ref|XP_004203570.1|  Piso0_001182                                       165   7e-46   
ref|XP_007725958.1|  mannose-1-phosphate guanyltransferase              166   7e-46   
ref|XP_003650465.1|  hypothetical protein THITE_2169612                 165   8e-46   
ref|XP_002844376.1|  mannose-1-phosphate guanyltransferase              165   8e-46   
gb|EEH40742.2|  mannose-1-phosphate guanyltransferase                   166   8e-46   
gb|ELU15028.1|  hypothetical protein CAPTEDRAFT_154984                  165   9e-46   
gb|KIX05331.1|  mannose-1-phosphate guanyltransferase                   165   9e-46   
ref|XP_003448400.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   9e-46   
ref|XP_002374260.1|  mannose-1-phosphate guanylyltransferase            165   1e-45   
ref|XP_002151296.1|  mannose-1-phosphate guanylyltransferase            165   1e-45   
gb|EKG18392.1|  hypothetical protein MPH_04393                          165   1e-45   
ref|NP_194786.1|  Glucose-1-phosphate adenylyltransferase family ...    164   1e-45   
gb|KIV97142.1|  mannose-1-phosphate guanyltransferase, variant 3        164   1e-45   
gb|EPS33496.1|  hypothetical protein PDE_08458                          165   1e-45   
gb|EPE08982.1|  mannose-1-phosphate guanyltransferase                   165   1e-45   
ref|NP_001280244.1|  mannose-1-phosphate guanyltransferase beta         165   1e-45   
ref|XP_007589492.1|  putative mannose-1-phosphate guanyltransfera...    165   1e-45   
ref|XP_007888693.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   1e-45   
gb|KIV97140.1|  mannose-1-phosphate guanyltransferase, variant 1        165   1e-45   
gb|EGU80538.1|  hypothetical protein FOXB_08998                         165   1e-45   
ref|XP_007804518.1|  Mannose-1-phosphate guanyltransferase              165   1e-45   
ref|XP_003001766.1|  mannose-1-phosphate guanyltransferase              163   1e-45   
ref|XP_001946280.2|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   1e-45   
gb|EXX60943.1|  mannose-1-phosphate guanylyltransferase                 165   1e-45   
gb|AGO64472.1|  GDP-D-mannose pyrophosphorylase                         159   2e-45   
ref|XP_001227041.1|  hypothetical protein CHGG_09114                    164   2e-45   
dbj|GAM41645.1|  mannose-1-phosphate guanyltransferase                  164   2e-45   
ref|XP_009199022.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-45   
gb|EWC45282.1|  mannose-1-phosphate guanyltransferase                   164   2e-45   
ref|XP_001906060.1|  hypothetical protein                               164   2e-45   
ref|XP_003678452.1|  hypothetical protein NCAS_0J01350                  164   2e-45   
ref|XP_004944488.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   2e-45   
ref|XP_009089239.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    164   2e-45   
ref|XP_005522264.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    164   2e-45   
ref|XP_001387247.1|  Mannose-1-phosphate guanyltransferase (ATP-m...    164   2e-45   
ref|XP_003853791.1|  hypothetical protein MYCGRDRAFT_108572             164   2e-45   
emb|CCF45415.1|  mannose-1-phosphate guanyltransferase                  164   2e-45   
ref|XP_009089238.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   2e-45   
gb|EKV04708.1|  Mannose-1-phosphate guanyltransferase                   164   2e-45   
ref|XP_006408596.1|  hypothetical protein EUTSA_v10002042mg             163   2e-45   
gb|KGO38018.1|  Nucleotidyl transferase                                 164   2e-45   
emb|CDM36708.1|  Mannose-1-phosphate guanyltransferase                  164   2e-45   
gb|EME45421.1|  hypothetical protein DOTSEDRAFT_52701                   164   2e-45   
ref|XP_569600.1|  mannose-1-phosphate guanylyltransferase               164   2e-45   
ref|XP_002564636.1|  Pc22g06040                                         164   2e-45   
gb|AFR98009.2|  mannose-1-phosphate guanyltransferase                   164   2e-45   
ref|XP_001526390.1|  mannose-1-phosphate guanyltransferase              164   3e-45   
gb|KGO78487.1|  Nucleotidyl transferase                                 164   3e-45   
ref|XP_004944486.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   3e-45   
gb|KFA61058.1|  hypothetical protein S40285_06340                       164   3e-45   
ref|XP_005522263.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    164   3e-45   
ref|XP_004944487.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    165   3e-45   
gb|EIF49787.1|  gdp-mannose pyrophosphorylase                           164   3e-45   
ref|XP_001401863.1|  mannose-1-phosphate guanyltransferase              164   3e-45   
ref|XP_005536787.1|  mannose-1-phosphate guanylyltransferase            164   3e-45   
ref|XP_005938954.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    164   3e-45   
gb|KIL89588.1|  hypothetical protein FAVG1_07168                        164   4e-45   
ref|XP_007003956.1|  hypothetical protein TREMEDRAFT_38768              164   4e-45   
emb|CCD51420.1|  similar to mannose-1-phosphate guanyltransferase       164   4e-45   
emb|CDK29954.1|  unnamed protein product                                164   4e-45   
gb|EEQ85656.1|  mannose-1-phosphate guanylyltransferase                 164   4e-45   
gb|KIV97139.1|  mannose-1-phosphate guanyltransferase                   164   4e-45   
ref|XP_002622272.1|  mannose-1-phosphate guanylyltransferase            164   4e-45   
ref|XP_008497167.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   4e-45   
ref|XP_007527319.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   4e-45   
ref|XP_006783131.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   4e-45   
ref|XP_002493105.1|  GDP-mannose pyrophosphorylase (mannose-1-pho...    163   5e-45   
sp|Q9Y725.1|MPG11_CANGA  RecName: Full=Mannose-1-phosphate guanyl...    163   5e-45   
gb|KIM96308.1|  hypothetical protein OIDMADRAFT_44510                   163   5e-45   
gb|ENH81504.1|  mannose-1-phosphate guanyltransferase                   163   5e-45   
ref|XP_003672349.1|  hypothetical protein NDAI_0J02140                  163   5e-45   
ref|XP_002876313.1|  hypothetical protein ARALYDRAFT_906986             155   5e-45   
ref|XP_003800644.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    164   5e-45   
gb|EMD93443.1|  hypothetical protein COCHEDRAFT_1171155                 163   5e-45   
gb|AET14212.1|  GDP-D-mannose pyrophosphorylase                         162   5e-45   
ref|XP_005279714.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   6e-45   
ref|XP_002758401.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   6e-45   
ref|XP_009022655.1|  hypothetical protein HELRODRAFT_106916             163   6e-45   
ref|XP_003727955.1|  PREDICTED: LOW QUALITY PROTEIN: mannose-1-ph...    163   7e-45   
gb|EJY68450.1|  Mannose-1-phosphate guanyltransferase beta, putative    163   7e-45   
ref|XP_005279713.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   7e-45   
sp|Q4U3E8.1|MPG1_ASPFU  RecName: Full=Mannose-1-phosphate guanylt...    163   7e-45   
ref|XP_006275003.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   7e-45   
ref|XP_008497166.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   7e-45   
gb|KEY70742.1|  hypothetical protein S7711_03238                        163   8e-45   
ref|XP_006892962.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   8e-45   
ref|XP_006694627.1|  hypothetical protein CTHT_0042260                  162   8e-45   
ref|XP_005326986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   9e-45   
ref|XP_004760688.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   9e-45   
ref|XP_003843812.1|  similar to mannose-1-phosphate guanyltransfe...    162   9e-45   
ref|XP_007527318.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   9e-45   
ref|XP_001266878.1|  mannose-1-phosphate guanylyltransferase            163   9e-45   
ref|XP_002683492.1|  predicted protein                                  163   1e-44   
ref|XP_007738522.1|  mannose-1-phosphate guanyltransferase              163   1e-44   
ref|XP_003217595.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
gb|KEQ58368.1|  mannose-1-phosphate guanyltransferase                   162   1e-44   
ref|XP_006171011.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
gb|KJB76118.1|  hypothetical protein B456_012G072800                    162   1e-44   
ref|XP_002713245.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
ref|XP_009825089.1|  hypothetical protein, variant 7                    160   1e-44   
ref|XP_003936705.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
sp|Q9Y5P6.2|GMPPB_HUMAN  RecName: Full=Mannose-1-phosphate guanyl...    162   1e-44   
ref|XP_007594195.1|  mannose-1-phosphate guanyltransferase              162   1e-44   
ref|NP_068806.1|  mannose-1-phosphate guanyltransferase beta isof...    162   1e-44   
ref|XP_003894464.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
ref|NP_001252910.1|  mannose-1-phosphate guanyltransferase beta         162   1e-44   
ref|XP_001272013.1|  mannose-1-phosphate guanylyltransferase            162   1e-44   
ref|XP_008153791.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
ref|XP_005326985.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    163   1e-44   
ref|XP_009825085.1|  hypothetical protein, variant 3                    160   1e-44   
ref|XP_001637465.1|  predicted protein                                  162   1e-44   
gb|EYE92195.1|  mannose-1-phosphate guanyltransferase                   162   1e-44   
ref|XP_004715224.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   1e-44   
gb|EFX03295.1|  mannose-1-phosphate guanylyltransferase                 162   1e-44   
gb|KIW74238.1|  mannose-1-phosphate guanyltransferase                   162   1e-44   
ref|XP_002118061.1|  hypothetical protein TRIADDRAFT_33563              162   2e-44   
ref|XP_003053081.1|  predicted protein                                  162   2e-44   
ref|XP_004615299.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_004581526.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_460408.1|  DEHA2F01056p                                          162   2e-44   
ref|XP_008061359.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_005724499.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_007129912.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
gb|KEQ68936.1|  mannose-1-phosphate guanyltransferase                   162   2e-44   
ref|XP_005279711.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_005279712.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_009825088.1|  hypothetical protein, variant 6                    160   2e-44   
ref|XP_006284084.1|  hypothetical protein CARUB_v10005214mg             161   2e-44   
ref|XP_007446277.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_006196371.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_010967477.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_008865910.1|  hypothetical protein, variant 3                    160   2e-44   
ref|XP_004676214.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_004399306.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_003982282.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_004419768.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_004715223.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_007129911.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_007168787.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
gb|KEQ87376.1|  mannose-1-phosphate guanyltransferase                   161   2e-44   
ref|XP_008970505.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   2e-44   
ref|XP_003670001.1|  hypothetical protein NDAI_0D04440                  161   2e-44   
ref|XP_006053329.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   2e-44   
ref|XP_006744594.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_004018504.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_003383986.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_008865909.1|  hypothetical protein, variant 1                    160   3e-44   
ref|XP_006631022.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_007953540.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_002920584.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_005969337.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_010345461.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
gb|EAW65012.1|  GDP-mannose pyrophosphorylase B, isoform CRA_a          162   3e-44   
ref|XP_009825084.1|  hypothetical protein, variant 2                    159   3e-44   
tpg|DAA16917.1|  TPA: mannose-1-phosphate guanyltransferase beta        161   3e-44   
ref|XP_004284004.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|NP_037466.2|  mannose-1-phosphate guanyltransferase beta isof...    162   3e-44   
ref|XP_007808986.1|  Mannose-1-phosphate guanyltransferase              161   3e-44   
ref|XP_009237280.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
ref|XP_007873665.1|  hypothetical protein PNEG_01701                    161   3e-44   
ref|XP_005696010.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    160   3e-44   
gb|EMF13242.1|  mannose-1-phosphate guanylyltransferase                 161   3e-44   
ref|XP_006966629.1|  mannose-1-phosphate guanyltransferase              161   3e-44   
gb|KER00901.1|  hypothetical protein AUEXF2481DRAFT_35153               161   3e-44   
gb|EHK44358.1|  putative mannose-1-phosphate guanylyltransferase        161   3e-44   
ref|XP_009443776.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
ref|XP_009199021.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
gb|EHK24181.1|  mannose-1-phosphate guanyltransferase                   161   3e-44   
ref|XP_011432652.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_007982437.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
gb|KEF55157.1|  mannose-1-phosphate guanyltransferase                   161   3e-44   
ref|XP_002613614.1|  hypothetical protein BRAFLDRAFT_93657              161   3e-44   
ref|XP_005547197.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    162   3e-44   
ref|XP_005347941.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   
ref|XP_004368596.1|  PREDICTED: mannose-1-phosphate guanyltransfe...    161   3e-44   



>ref|XP_010095035.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB58141.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009594230.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
 ref|XP_009594231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
tomentosiformis]
Length=361

 Score =   232 bits (591),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVIS+YPF
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSGEPFFVLNSDVISDYPF  118



>ref|NP_001275205.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
 gb|AAD01737.1| GDP-mannose pyrophosphorylase [Solanum tuberosum]
Length=361

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|NP_001234025.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|AAT37498.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_004240924.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240926.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_004240927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322173.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
 ref|XP_010322174.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Solanum 
lycopersicum]
Length=361

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSGEPFFVLNSDVISEYPF  118



>ref|NP_001276259.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACU21199.1| unknown [Glycine max]
Length=361

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|NP_001234084.1| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
 gb|ABE03745.2| GDP-mannose pyrophosphorylase [Solanum lycopersicum]
Length=361

 Score =   231 bits (590),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEASLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>gb|KHN13115.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   231 bits (590),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>emb|CBI31615.3| unnamed protein product [Vitis vinifera]
Length=263

 Score =   228 bits (581),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGI I+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>gb|KDO69185.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=358

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPF  118



>ref|XP_007163469.1| hypothetical protein PHAVU_001G236800g, partial [Phaseolus vulgaris]
 gb|ESW35463.1| hypothetical protein PHAVU_001G236800g, partial [Phaseolus vulgaris]
Length=146

 Score =   224 bits (570),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLVDASGEPFFVLNSDVISEYPL  118



>ref|XP_006486418.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Citrus sinensis]
Length=361

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPF  118



>ref|XP_006435610.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
 gb|ESR48850.1| hypothetical protein CICLE_v10033733mg [Citrus clementina]
Length=361

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPF  118



>gb|KDO69184.1| hypothetical protein CISIN_1g018060mg [Citrus sinensis]
Length=361

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPF  118



>gb|ADV59923.1| putative GDP-mannose pyrophosphorylase [Citrus unshiu]
Length=361

 Score =   231 bits (589),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI CSQETEPLGTAGPLALARDKLIDD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGIKIICSQETEPLGTAGPLALARDKLIDDTGEPFFVLNSDVISEYPF  118



>ref|XP_006338820.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006338821.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006338822.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X3 [Solanum tuberosum]
Length=361

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 117/118 (99%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+DD+GEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDAGEPFFVLNSDVISEYPF  118



>ref|NP_001276240.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 gb|ACX37458.1| GDP-D-mannose pyrophosphorylase [Glycine max]
 gb|KHN20905.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_007141846.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 ref|XP_007141847.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13840.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
 gb|ESW13841.1| hypothetical protein PHAVU_008G230600g [Phaseolus vulgaris]
Length=361

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>gb|EYU19947.1| hypothetical protein MIMGU_mgv1a008833mg [Erythranthe guttata]
Length=361

 Score =   230 bits (587),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFESKLAIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_003544186.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Glycine 
max]
Length=374

 Score =   231 bits (588),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>gb|ACN38266.1| GDP-D-mannose pyrophosphorylase [Actinidia latifolia]
Length=361

 Score =   230 bits (587),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009388596.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009388598.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   230 bits (587),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 113/118 (96%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPF  118



>ref|XP_011076786.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
 ref|XP_011076787.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Sesamum 
indicum]
Length=361

 Score =   230 bits (586),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>gb|AGI78460.1| GDP-D-mannose pyrophosphorylase [Camellia sinensis]
Length=361

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009759296.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759297.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
 ref|XP_009759298.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nicotiana 
sylvestris]
Length=361

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+DDS EPFFVLNSDVIS+YPF
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLVDDSAEPFFVLNSDVISDYPF  118



>ref|XP_004490906.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cicer 
arietinum]
Length=361

 Score =   230 bits (586),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKATGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGI ISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGITISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009797660.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797661.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009797662.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=361

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPE M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEEM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEANLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>gb|AIN40499.1| GDP-D-mannose pyrophosphorylase [Ziziphus jujuba]
Length=361

 Score =   229 bits (585),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>gb|KJB74050.1| hypothetical protein B456_011G269100 [Gossypium raimondii]
Length=361

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGI I+CSQETEPLGTAGPLALARDKL+D+SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFETKLGITITCSQETEPLGTAGPLALARDKLVDESGEPFFVLNSDVISEYPF  118



>ref|XP_010262630.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=361

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLKDFESKLGIKI+CS+ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LSFLKDFESKLGIKITCSRETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>dbj|BAB62108.1| GDP-D-mannose pyrophosphorylase [Nicotiana tabacum]
Length=361

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPE M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEEM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEANLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_010256792.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Nelumbo 
nucifera]
Length=361

 Score =   229 bits (584),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE++LGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEARLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>gb|KDO35843.1| hypothetical protein CISIN_1g046608mg, partial [Citrus sinensis]
Length=256

 Score =   226 bits (575),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_002282422.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Vitis vinifera]
Length=361

 Score =   229 bits (583),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGI I+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_009592609.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009592610.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+ L IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEANLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_008803133.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803134.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008803135.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   229 bits (583),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFES+LGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESRLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_009387284.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
 ref|XP_009387293.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKEFENKLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_010691388.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Beta vulgaris 
subsp. vulgaris]
Length=361

 Score =   228 bits (582),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGI I+CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGITITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPL  118



>ref|XP_011085013.1| PREDICTED: LOW QUALITY PROTEIN: mannose-1-phosphate guanylyltransferase 
1-like [Sesamum indicum]
Length=358

 Score =   228 bits (581),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGI I+CSQETEPLGTAGPLALA+DKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGITITCSQETEPLGTAGPLALAKDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_007218178.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
 ref|XP_008233488.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 ref|XP_008233489.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Prunus 
mume]
 dbj|BAH03298.1| GDP-D-mannose pyrophosphorylase [Prunus persica]
 gb|EMJ19377.1| hypothetical protein PRUPE_ppa007618mg [Prunus persica]
Length=361

 Score =   228 bits (581),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 116/118 (98%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GV+EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVSEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FLK+FE+K+GIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   MTFLKEFETKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_003616475.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AAT58365.1| GMPase [Medicago sativa]
 gb|AES99433.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   228 bits (581),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKATGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGI ISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVIS+YP 
Sbjct  61   LNFLKDFEAKLGITISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISDYPL  118



>gb|KDO48143.1| hypothetical protein CISIN_1g0201131mg, partial [Citrus sinensis]
Length=269

 Score =   225 bits (573),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_008371997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Malus domestica]
 ref|XP_009351402.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Pyrus x 
bretschneideri]
Length=361

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FLK+FE K+GIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|XP_006601845.1| PREDICTED: uncharacterized protein LOC100818016 isoform X1 [Glycine 
max]
 ref|XP_006601846.1| PREDICTED: uncharacterized protein LOC100818016 isoform X2 [Glycine 
max]
 ref|XP_006601847.1| PREDICTED: uncharacterized protein LOC100818016 isoform X3 [Glycine 
max]
 ref|XP_006601848.1| PREDICTED: uncharacterized protein LOC100818016 isoform X4 [Glycine 
max]
 ref|XP_006601849.1| PREDICTED: uncharacterized protein LOC100818016 isoform X5 [Glycine 
max]
 gb|KHN07601.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   228 bits (580),  Expect = 8e-70, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_002311190.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88557.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   228 bits (580),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009343927.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Pyrus 
x bretschneideri]
Length=361

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FLK+FE K+GIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   MTFLKEFEEKVGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  118



>ref|NP_001242262.1| uncharacterized protein LOC100818016 [Glycine max]
 gb|ACU23379.1| unknown [Glycine max]
Length=361

 Score =   227 bits (579),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEAKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_010937548.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937549.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010937550.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE++LGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFENRLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_004984923.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X1 [Setaria italica]
 ref|XP_004984924.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
isoform X2 [Setaria italica]
Length=361

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLVDGSGDPFFVLNSDVISEYPF  118



>ref|XP_008441398.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Cucumis 
melo]
Length=361

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVEEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KLGIKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_008785513.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785515.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785516.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785518.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785519.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785520.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
 ref|XP_008785521.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/118 (95%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPF  118



>ref|XP_007009211.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009212.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009214.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18021.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18022.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY18024.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVIEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+K+GIKISCSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPF  118



>emb|CDP16056.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   227 bits (578),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPL  118



>ref|XP_010923222.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923223.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
 ref|XP_010923224.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+V+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPF  118



>gb|ABB53473.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
 gb|ABX80393.1| GDP-mannose pyrophosphorylase [Malpighia glabra]
Length=361

 Score =   227 bits (578),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KL IKI+CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEKKLDIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPL  118



>ref|XP_002316262.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEF02433.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=361

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_011036070.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
 ref|XP_011036071.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Populus 
euphratica]
Length=361

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_010931208.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Elaeis guineensis]
Length=361

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVILAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPF  118



>ref|XP_004307574.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
 ref|XP_004307575.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Fragaria 
vesca subsp. vesca]
Length=361

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+K+GIKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKVGIKITCSQETEPLGTAGPLALARDKLIDQSGEPFFVLNSDVISEYPL  118



>ref|XP_003558261.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228817.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228818.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
 ref|XP_010228819.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Brachypodium distachyon]
Length=361

 Score =   226 bits (577),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>ref|XP_006429173.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
 gb|ESR42413.1| hypothetical protein CICLE_v10012040mg [Citrus clementina]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_006493574.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Citrus sinensis]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/118 (94%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>emb|CDP00140.1| unnamed protein product [Coffea canephora]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGI+I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGIRITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPL  118



>ref|XP_011035050.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
 ref|XP_011035125.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALK +GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKVIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_008801635.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
 ref|XP_008801636.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X1 [Phoenix dactylifera]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGIKI+CSQETEPLGTAGPLALARD L+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDNLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_008777609.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
[Phoenix dactylifera]
Length=361

 Score =   226 bits (576),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKEVGVTEVILAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVI+EYPF
Sbjct  61   LNFLKDFESKLDIKITCSQETEPLGTAGPLALARDKLIDSSGEPFFVLNSDVINEYPF  118



>gb|KHG16049.1| Mannose-1-phosphate guanyltransferase [Gossypium arboreum]
Length=361

 Score =   226 bits (575),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KLGIKI+CSQETEPLGTAGP+ALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPIALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_002524227.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
 gb|EEF38151.1| mannose-1-phosphate guanyltransferase, putative [Ricinus communis]
Length=361

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGI I+CSQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLIDESGDPFFVLNSDVISEYPL  118



>ref|XP_008801637.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1 
isoform X2 [Phoenix dactylifera]
Length=358

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGIKI+CSQETEPLGTAGPLALARD L+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDNLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_010067451.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067452.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067453.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 ref|XP_010067454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW65590.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65591.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65592.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
 gb|KCW65593.1| hypothetical protein EUGRSUZ_G02988 [Eucalyptus grandis]
Length=361

 Score =   226 bits (575),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV+EVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVSEVVLAINYQPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK FE+KLGIKI+CSQETEPLGTAGPLALARDKL+DDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKGFEAKLGIKITCSQETEPLGTAGPLALARDKLLDDSGEPFFVLNSDVISEYPL  118



>gb|KJB76777.1| hypothetical protein B456_012G106900 [Gossypium raimondii]
Length=361

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KLGIKI+CSQETEPLGTAGP+ALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPIALARDKLIDGSGEPFFVLNSDVISEYPL  118



>gb|ABI48955.1| GDP-D-mannose pyrophosphorylase [Viola baoshanensis]
Length=361

 Score =   225 bits (574),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK FE+KLGI I+CSQETEPLGTAGPLALARDKL  DSGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKQFETKLGITITCSQETEPLGTAGPLALARDKLTGDSGEPFFVLNSDVISEYPF  118



>ref|NP_001142215.1| hypothetical protein [Zea mays]
 ref|XP_008668541.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668543.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008668544.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACF87905.1| unknown [Zea mays]
 gb|ACR38500.1| unknown [Zea mays]
 tpg|DAA44594.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44595.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44596.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44597.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
 tpg|DAA44598.1| TPA: hypothetical protein ZEAMMB73_810828 [Zea mays]
Length=361

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPF  118



>gb|ACW84415.1| GDP-D-mannose pyrophosphorylase [Glycine max]
Length=361

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPL  118



>gb|EAY89395.1| hypothetical protein OsI_10901 [Oryza sativa Indica Group]
Length=361

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPF  118



>ref|NP_001049673.1| Os03g0268400 [Oryza sativa Japonica Group]
 sp|Q84JH5.1|GMPP1_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
1 [Oryza sativa Japonica Group]
 gb|AAP06900.1| COG1208, GCD1, Nucleoside-diphosphate-sugar pyrophosphorylase 
involved in lipopolysaccharide biosynthesis/translation initiation 
factor 2B, gamma/epsilon subunits (eIF-2Bgamma/eIF-2Bepsilon) 
[Cell envelope biogenesis, outer membrane / Translation, 
ribosomal structure and biogenesis] [Oryza sativa Japonica 
Group]
 gb|AAP06910.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|ABF95179.1| mannose-1-phosphate guanyltransferase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF11587.1| Os03g0268400 [Oryza sativa Japonica Group]
 gb|EAZ26390.1| hypothetical protein OsJ_10274 [Oryza sativa Japonica Group]
 dbj|BAH00737.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   225 bits (574),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 110/118 (93%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALARDKLADGSGDPFFVLNSDVISEYPF  118



>gb|KDP44883.1| hypothetical protein JCGZ_01383 [Jatropha curcas]
Length=361

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEAKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>gb|KHN17882.1| Mannose-1-phosphate guanylyltransferase 1 [Glycine soja]
Length=361

 Score =   225 bits (574),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPL  118



>ref|NP_001240188.1| mannose-1-phosphate guanylyltransferase 1-like [Glycine max]
 ref|XP_006590281.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like isoform 
X1 [Glycine max]
 gb|ACU21527.1| unknown [Glycine max]
Length=361

 Score =   225 bits (573),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVNEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE+KLGIKI+CSQETEPLGTAGPLALARDKLI DSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFETKLGIKITCSQETEPLGTAGPLALARDKLISDSGEPFFVLNSDVISEYPL  118



>ref|XP_010088589.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
 gb|EXB36730.1| Mannose-1-phosphate guanylyltransferase 1 [Morus notabilis]
Length=361

 Score =   224 bits (571),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEA KA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEAFKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPL  118



>ref|XP_009412560.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=360

 Score =   224 bits (570),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGIKI+CSQETEPLGTAGPLALARD+L+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGIKITCSQETEPLGTAGPLALARDRLMDGSGEPFFVLNSDVISEYPF  118



>ref|XP_009407514.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Musa acuminata subsp. malaccensis]
Length=361

 Score =   224 bits (570),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_006649823.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 1-like 
[Oryza brachyantha]
Length=361

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFGNKPMILHQIEALKEVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEPLGTAGPLALAR+KL D SG+PFFVLNSDVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPLGTAGPLALAREKLADGSGDPFFVLNSDVISEYPF  118



>ref|NP_001044795.1| Os01g0847200 [Oryza sativa Japonica Group]
 sp|Q941T9.1|GMPP2_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Oryza sativa Japonica Group]
 dbj|BAB64272.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAB89577.1| putative GMPase [Oryza sativa Japonica Group]
 dbj|BAF06709.1| Os01g0847200 [Oryza sativa Japonica Group]
 gb|EAZ41985.1| hypothetical protein OsJ_26535 [Oryza sativa Japonica Group]
 dbj|BAG88187.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   223 bits (569),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>sp|Q6Z9A3.1|GMPP3_ORYSJ RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
3 [Oryza sativa Japonica Group]
 dbj|BAD05471.1| putative GDP-mannose pyrophosphorylase [Oryza sativa Japonica 
Group]
 gb|EAZ06115.1| hypothetical protein OsI_28352 [Oryza sativa Indica Group]
 gb|EAZ14142.1| hypothetical protein OsJ_04069 [Oryza sativa Japonica Group]
 dbj|BAH01407.1| unnamed protein product [Oryza sativa Japonica Group]
Length=361

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_006645004.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Oryza brachyantha]
Length=361

 Score =   223 bits (569),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_003600761.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
 gb|AES71012.1| mannose-1-phosphate guanylyltransferase-like protein [Medicago 
truncatula]
Length=361

 Score =   223 bits (568),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK +GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEEKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_006846369.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
 gb|ERN08044.1| hypothetical protein AMTR_s00012p00262290 [Amborella trichopoda]
Length=361

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 115/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQE EPLGTAGPLALARD+LID+SGEPFFVLNSDVISE+P 
Sbjct  61   LNFLKDFEAKLGIKITCSQEKEPLGTAGPLALARDELIDESGEPFFVLNSDVISEFPL  118



>ref|XP_007026922.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 ref|XP_007026923.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07424.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
 gb|EOY07425.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
1 [Theobroma cacao]
Length=361

 Score =   223 bits (567),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_007009213.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY18023.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 115/119 (97%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEV-  377
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKAVGV EVVLAINYQPEV 
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAVGVIEVVLAINYQPEVV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNFLK+FE+K+GIKISCSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPF
Sbjct  61   MLNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPF  119



>ref|XP_007009215.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
 gb|EOY18025.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
5 [Theobroma cacao]
Length=362

 Score =   222 bits (566),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 115/119 (97%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQ-IEALKAVGVTEVVLAINYQPEV  377
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQ IEALKAVGV EVVLAINYQPEV
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQQIEALKAVGVIEVVLAINYQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNFLK+FE+K+GIKISCSQETEPLGTAGPLALARDKLID SG+PFFVLNSDVISEYPF
Sbjct  61   MLNFLKEFEAKVGIKISCSQETEPLGTAGPLALARDKLIDGSGKPFFVLNSDVISEYPF  119



>ref|XP_010554624.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010554625.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   222 bits (566),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE  LGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEKNLGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>emb|CDY07636.1| BnaA03g18750D [Brassica napus]
Length=401

 Score =   223 bits (569),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  EHRILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAIN  362
            + R + MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAIN
Sbjct  35   KERRIKMKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAIN  94

Query  363  YQPEVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVIS  542
            YQPEVMLNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKL+D SGEPFFVLNSDVIS
Sbjct  95   YQPEVMLNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVIS  154

Query  543  EYPF  554
            EYP 
Sbjct  155  EYPL  158



>gb|EPS66224.1| hypothetical protein M569_08552 [Genlisea aurea]
Length=361

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK  GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDAGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKI+CSQETEPLGTAGPLALARDKL+D S EPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLGIKITCSQETEPLGTAGPLALARDKLLDSSNEPFFVLNSDVISEYPL  118



>ref|XP_002879816.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56075.1| hypothetical protein ARALYDRAFT_483004 [Arabidopsis lyrata subsp. 
lyrata]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>emb|CDM85018.1| unnamed protein product [Triticum aestivum]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>emb|CDY07033.1| BnaA04g22820D [Brassica napus]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>gb|EMT31032.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_010505663.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010505664.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010508973.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
 ref|XP_010517339.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Camelina 
sativa]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>ref|XP_006294448.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
 gb|EOA27346.1| hypothetical protein CARUB_v10023461mg, partial [Capsella rubella]
Length=371

 Score =   222 bits (566),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/124 (88%), Positives = 116/124 (94%), Gaps = 0/124 (0%)
 Frame = +3

Query  183  EHRILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAIN  362
            +++   MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAIN
Sbjct  5    DNQGFKMKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAIN  64

Query  363  YQPEVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVIS  542
            YQPEVMLNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVIS
Sbjct  65   YQPEVMLNFLKDFEAKLEIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVIS  124

Query  543  EYPF  554
            EYP 
Sbjct  125  EYPL  128



>dbj|BAJ95730.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91553.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEV+LAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKDVGVTEVILAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>gb|AFL69833.1| mannose-1-phosphate guanyltransferase 4 [Oryza sativa Indica 
Group]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSD ISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDAISEYPF  118



>ref|XP_006846372.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
 gb|ERN08047.1| hypothetical protein AMTR_s00012p00262630 [Amborella trichopoda]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KL IKI+CSQE EPLGTAGPLALARDKLIDDSGEPFFVLNSDVISE+P 
Sbjct  61   LNFLKDFEEKLCIKITCSQEMEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEFPL  118



>ref|XP_009141836.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Brassica 
rapa]
Length=361

 Score =   222 bits (565),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_006411211.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
 dbj|BAJ34137.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ52664.1| hypothetical protein EUTSA_v10016850mg [Eutrema salsugineum]
Length=361

 Score =   222 bits (565),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>gb|AFL69830.1| mannose-1-phosphate guanyltransferase 1 [Oryza sativa Indica 
Group]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALEEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>gb|AFL69832.1| mannose-1-phosphate guanyltransferase 3 [Oryza sativa Indica 
Group]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEAL+ VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALEEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_002308180.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
 gb|EEE91703.1| hypothetical protein POPTR_0006s09130g [Populus trichocarpa]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK++E +L IKI+CSQETEPLGTAGPLALARDKLIDDSG PFFVLNSDVISEYP 
Sbjct  61   LNFLKEYEKRLEIKITCSQETEPLGTAGPLALARDKLIDDSGAPFFVLNSDVISEYPL  118



>gb|ACN66754.1| GMP [Carica papaya]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA GV+EV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVSEVILAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPL  118



>emb|CAC35355.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPL  118



>ref|XP_004138454.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004154737.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Cucumis 
sativus]
 gb|KGN45744.1| hypothetical protein Csa_6G008750 [Cucumis sativus]
Length=361

 Score =   221 bits (564),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVEEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KLGIKI+CSQETEPLGTAGPLALAR KLID SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLGIKITCSQETEPLGTAGPLALARGKLIDASGEPFFVLNSDVISEYPL  118



>ref|NP_181507.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 ref|NP_001189713.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 sp|O22287.1|GMPP1_ARATH RecName: Full=Mannose-1-phosphate guanylyltransferase 1; AltName: 
Full=GDP-mannose pyrophosphorylase 1; AltName: Full=Protein 
CYTOKINESIS DEFECTIVE 1; AltName: Full=Protein EMBRYO DEFECTIVE 
101; AltName: Full=Protein HYPERSENSITIVE TO AMMONIUM 
ION 1; AltName: Full=Protein SENSITIVE TO OZONE 1; AltName: 
Full=Protein VITAMIN C DEFECTIVE 1 [Arabidopsis thaliana]
 gb|AAK32825.1|AF361812_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAL16129.1|AF428297_1 At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAB87126.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAC78474.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAD04627.1| CYT1 protein [Arabidopsis thaliana]
 gb|AAL09781.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAM65235.1| GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAM91473.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AAN31841.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AAP21173.1| At2g39770/T5I7.7 [Arabidopsis thaliana]
 gb|AEC09721.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
 gb|AEC09722.1| GDP-mannose pyrophosphorylase/ mannose-1-pyrophosphatase [Arabidopsis 
thaliana]
Length=361

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFETKLEIKITCSQETEPLGTAGPLALARDKLLDGSGEPFFVLNSDVISEYPL  118



>ref|XP_009133383.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
 emb|CDY61780.1| BnaC03g72590D [Brassica napus]
Length=361

 Score =   221 bits (563),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>ref|XP_011016812.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like, partial 
[Populus euphratica]
Length=349

 Score =   221 bits (562),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK++E KL IKI+CSQETEPLGTAGPLALARDKLIDD+G PFFVLNSDVISEYP 
Sbjct  61   LNFLKEYEKKLEIKITCSQETEPLGTAGPLALARDKLIDDTGAPFFVLNSDVISEYPL  118



>ref|XP_003564604.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brachypodium distachyon]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLVDGSGKPFFVLNSDVISEYPF  118



>ref|NP_001142302.1| uncharacterized protein LOC100274471 [Zea mays]
 ref|XP_008654645.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654646.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 ref|XP_008654647.1| PREDICTED: uncharacterized protein LOC100274471 isoform X1 [Zea 
mays]
 gb|ACF80591.1| unknown [Zea mays]
 gb|ACF88136.1| unknown [Zea mays]
 gb|AFW84601.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84602.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84603.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84604.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
 gb|AFW84605.1| hypothetical protein ZEAMMB73_169513 [Zea mays]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>emb|CDX93234.1| BnaC04g46620D [Brassica napus]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KL IKI+CSQETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKDFEAKLEIKITCSQETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>ref|XP_004970565.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>ref|XP_010534527.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
 ref|XP_010534528.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1 [Tarenaya 
hassleriana]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 114/118 (97%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLKDFE++LGIKI+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   LSFLKDFETELGIKITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>ref|XP_002456631.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
 gb|EES01751.1| hypothetical protein SORBIDRAFT_03g039740 [Sorghum bicolor]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>gb|AHB17740.1| GDP-mannose pyrophosphorylase [Pogonatherum paniceum]
Length=361

 Score =   221 bits (563),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>gb|ABR15468.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLK FE+KLGIKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LSFLKAFETKLGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>gb|ACK87007.1| GDP-mannose pyrophosphorylase [Carica papaya]
Length=361

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA GV+EV+LAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVSEVILAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLID+SGEPFFVLNSDVISEYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLIDESGEPFFVLNSDVISEYPL  118



>ref|XP_008674826.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674827.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 ref|XP_008674828.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Zea mays]
 gb|ACR38121.1| unknown [Zea mays]
 tpg|DAA56851.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
 tpg|DAA56852.1| TPA: hypothetical protein ZEAMMB73_139428 [Zea mays]
Length=361

 Score =   220 bits (560),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SG+PFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGQPFFVLNSDVISEYPF  118



>ref|XP_004977599.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3-like 
[Setaria italica]
Length=361

 Score =   220 bits (560),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ+EALK VGVTEVVLAINY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQMEALKEVGVTEVVLAINYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDFE KLGI I+CSQETEPLGTAGPLALARDKL D SGEPFFVLNSDVISEYPF
Sbjct  61   INFLKDFEDKLGITITCSQETEPLGTAGPLALARDKLADGSGEPFFVLNSDVISEYPF  118



>gb|ABR17757.1| unknown [Picea sitchensis]
Length=361

 Score =   220 bits (560),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 113/118 (96%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLK FE+K+GIKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   LSFLKAFETKIGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  118



>ref|XP_002310933.1| cytokinesis defective 1 family protein [Populus trichocarpa]
 gb|EEE88300.1| cytokinesis defective 1 family protein [Populus trichocarpa]
Length=375

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/118 (90%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL  PKPLVEFANKPMILHQIEALKA+GVTEVVLAINY+PE M
Sbjct  1    MKALILVGGFGTRLRPLTLKHPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYKPEEM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDF++KL IKI+CSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVI EYP 
Sbjct  61   MNFLKDFDTKLDIKITCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVICEYPL  118



>gb|AHX59161.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=198

 Score =   214 bits (544),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLK+FE+KLGIKI+CSQETEP+GTAGPLALARDKL D S EPFFVLNSDVI EYP 
Sbjct  61   LSFLKEFEAKLGIKITCSQETEPMGTAGPLALARDKLDDGSAEPFFVLNSDVICEYPL  118



>ref|XP_010529799.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529800.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
 ref|XP_010529801.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Tarenaya 
hassleriana]
Length=361

 Score =   218 bits (556),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/118 (91%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSMPKPLVDFANKPMILHQIEALKAAGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKL D+SGEPFFVLNSDVI EYP 
Sbjct  61   LNFLKEFEKKLEIKITCSQETEPLGTAGPLALARDKLFDESGEPFFVLNSDVICEYPL  118



>ref|XP_007026924.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
 gb|EOY07426.1| Glucose-1-phosphate adenylyltransferase family protein isoform 
3 [Theobroma cacao]
Length=362

 Score =   218 bits (555),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQ-IEALKAVGVTEVVLAINYQPEV  377
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ IEALKA+GVTEVVLAINYQPE+
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQQIEALKAIGVTEVVLAINYQPEI  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNFLK+FE KL IKI+CSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   MLNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  119



>gb|ABK24420.1| unknown [Picea sitchensis]
 gb|ACN39840.1| unknown [Picea sitchensis]
Length=361

 Score =   217 bits (552),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLK+FE+KLGIKI+CSQETEP+GTAGPLALARDKL D SGEPFFVLNSDVI EYP 
Sbjct  61   LSFLKEFEAKLGIKITCSQETEPMGTAGPLALARDKLDDGSGEPFFVLNSDVICEYPL  118



>ref|XP_002966693.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
 ref|XP_002978048.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ20705.1| hypothetical protein SELMODRAFT_271290 [Selaginella moellendorffii]
 gb|EFJ32720.1| hypothetical protein SELMODRAFT_168373 [Selaginella moellendorffii]
Length=361

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMI HQIEALKAVGVTEVVLAI+YQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMIFHQIEALKAVGVTEVVLAISYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLKDFE+KLG+KI+CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVI EYP 
Sbjct  61   LSFLKDFEAKLGVKITCSQEREPMGTAGPLALARDKLLDGSGEPFFVLNSDVICEYPL  118



>ref|XP_011033044.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Populus 
euphratica]
Length=375

 Score =   217 bits (552),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANKPMILHQIEALKA+GVTEVVLAINY+ E M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYKHEEM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFLKDF++KL IKI+CSQETEPLGTAGPLALARDKL DDSGEPFFVLNSDVI EYP 
Sbjct  61   MNFLKDFDTKLDIKITCSQETEPLGTAGPLALARDKLTDDSGEPFFVLNSDVICEYPL  118



>ref|XP_001782193.1| predicted protein [Physcomitrella patens]
 gb|EDQ53016.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFL+DFE  LGIKI+CSQETEP+GTAGPLALARDKL D SGE FFVLNSDVISEYP 
Sbjct  61   MNFLRDFEKSLGIKITCSQETEPMGTAGPLALARDKLDDGSGESFFVLNSDVISEYPL  118



>gb|AHX74219.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=362

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/119 (90%), Positives = 113/119 (95%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQ-IEALKAVGVTEVVLAINYQPEV  377
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ IEALKA+GV EVVLAINYQPEV
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQQIEALKAIGVDEVVLAINYQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ML+FLK FE+KLGIKI+CSQETEP+GTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  61   MLSFLKAFETKLGIKITCSQETEPMGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  119



>ref|XP_002974469.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
 gb|EFJ24691.1| hypothetical protein SELMODRAFT_267755 [Selaginella moellendorffii]
Length=361

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK  GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKEAGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FLKDFE+KLGIKI+CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   MRFLKDFEAKLGIKITCSQEREPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>ref|XP_002990832.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
 gb|EFJ08105.1| hypothetical protein SELMODRAFT_185648 [Selaginella moellendorffii]
Length=361

 Score =   216 bits (550),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK  GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKEAGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FLKDFE+KLGIKI+CSQE EP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYP 
Sbjct  61   MRFLKDFEAKLGIKITCSQEREPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPL  118



>gb|ABK24789.1| unknown [Picea sitchensis]
Length=361

 Score =   215 bits (548),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 112/118 (95%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKAL+LVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPE+M
Sbjct  1    MKALVLVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPELM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++FLK+FE+KLGIKI+CSQETEP+GTAGPLALAR KLID SG PFFVLNSDVISEYP 
Sbjct  61   MSFLKEFETKLGIKITCSQETEPMGTAGPLALARSKLIDGSGRPFFVLNSDVISEYPL  118



>ref|XP_009143286.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Brassica 
rapa]
Length=361

 Score =   214 bits (546),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVL +NYQ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKD E+KL IKI+CS+ETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDVEAKLEIKITCSRETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>ref|XP_001769404.1| predicted protein [Physcomitrella patens]
 gb|EDQ65773.1| predicted protein [Physcomitrella patens]
Length=361

 Score =   214 bits (546),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAVGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +NFL+DFE  LGIKI+CSQETEP+GTAGPLALAR+KL D SGE FFVLNSDVISEYP 
Sbjct  61   MNFLRDFEKSLGIKITCSQETEPMGTAGPLALARNKLDDGSGEAFFVLNSDVISEYPL  118



>emb|CDX74832.1| BnaA05g05780D [Brassica napus]
Length=361

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKAVGV EVVL +NYQ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKD E KL IKI+CS+ETEP+GTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  61   LNFLKDVEEKLEIKITCSRETEPMGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  118



>gb|ABR15469.1| GDP-mannose pyrophosphorylase [Pinus taeda]
Length=361

 Score =   213 bits (542),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FLK+FE+K+GIKI+CSQETEP+GTAGPLALARDKL D S EPFFVLNSDVI EYP 
Sbjct  61   LSFLKEFEAKVGIKITCSQETEPMGTAGPLALARDKLDDGSAEPFFVLNSDVICEYPL  118



>ref|XP_004246437.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
lycopersicum]
Length=361

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             NFLK+FE KL IKI+CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP 
Sbjct  61   QNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPL  118



>ref|XP_006340997.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Solanum 
tuberosum]
Length=361

 Score =   213 bits (542),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             NFLK+FE KL IKI+CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP 
Sbjct  61   QNFLKEFEKKLDIKITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPL  118



>ref|XP_009601713.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
 ref|XP_009601714.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=361

 Score =   212 bits (539),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 102/118 (86%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEVVLAINYQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKAIGVTEVVLAINYQPKIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             NFLK+FE KL I+I+CSQETEPLGTAGPLALARD L DDSGEPFFVLNSDVI +YP 
Sbjct  61   QNFLKEFEKKLDIRITCSQETEPLGTAGPLALARDILRDDSGEPFFVLNSDVICDYPL  118



>gb|AFK47417.1| unknown [Lotus japonicus]
Length=353

 Score =   206 bits (523),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 105/118 (89%), Positives = 106/118 (90%), Gaps = 8/118 (7%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP        MILHQIEALKA GVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKP--------MILHQIEALKAAGVTEVVLAINYQPEVM  52

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFE+KLGIKISCSQETEPLGTAGPLALARDKLID SGEPFFVLNSDVISEYP 
Sbjct  53   LNFLKDFEAKLGIKISCSQETEPLGTAGPLALARDKLIDGSGEPFFVLNSDVISEYPL  110



>emb|CDY05114.1| BnaC03g29120D [Brassica napus]
Length=263

 Score =   201 bits (512),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>ref|XP_009134205.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009134206.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=356

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>ref|XP_010432971.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X1 [Camelina sativa]
Length=358

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q P+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL IKI+ SQETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPL  119



>ref|XP_009137936.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
 ref|XP_009137937.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Brassica rapa]
Length=354

 Score =   202 bits (514),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>emb|CDX90771.1| BnaA03g24510D [Brassica napus]
Length=347

 Score =   202 bits (513),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>ref|XP_010438164.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=346

 Score =   201 bits (512),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT + PKPLV+F NKPMILHQIEALKA GVTEVVLAIN Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFTMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINQQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL IKI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLIDESGQPFFVLNSDVICEYPL  119



>gb|KFK29636.1| hypothetical protein AALP_AA7G159400 [Arabis alpina]
Length=434

 Score =   204 bits (518),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 101/127 (80%), Positives = 113/127 (89%), Gaps = 1/127 (1%)
 Frame = +3

Query  177  LEEHRILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLA  356
            L + +   MKALILVGGFGTRLRPLT + PKPLV+FANKPMILHQIEALKA GVT+VVLA
Sbjct  68   LPQQKSHKMKALILVGGFGTRLRPLTFTMPKPLVDFANKPMILHQIEALKAAGVTQVVLA  127

Query  357  INYQ-PEVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSD  533
            IN+Q P+VMLNF+K++E KL IKI+ SQETEPLGTAGPLALARDKLID+SGEPFFVLNSD
Sbjct  128  INHQQPQVMLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLIDESGEPFFVLNSD  187

Query  534  VISEYPF  554
            VI EYP 
Sbjct  188  VICEYPL  194



>emb|CDX90770.1| BnaA03g24500D [Brassica napus]
Length=374

 Score =   202 bits (514),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 100/119 (84%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSIPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>ref|NP_191118.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
 sp|Q9M2S0.1|GMPP2_ARATH RecName: Full=Probable mannose-1-phosphate guanylyltransferase 
2 [Arabidopsis thaliana]
 emb|CAB75917.1| mannose-1-phosphate guanylyltransferase-like protein [Arabidopsis 
thaliana]
 gb|AAY78774.1| putative GDP-mannose pyrophosphorylase [Arabidopsis thaliana]
 gb|AEE79405.1| probable mannose-1-phosphate guanylyltransferase 2 [Arabidopsis 
thaliana]
Length=364

 Score =   201 bits (512),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 100/121 (83%), Positives = 108/121 (89%), Gaps = 3/121 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPE--  374
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EVVLAINY+PE  
Sbjct  1    MKALILVGGFGTRLRPLTLSLPKPLVDFANKPMILHQIEALKAIGVDEVVLAINYEPEQL  60

Query  375  -VMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  551
             VM  F  D E+ LGIKI+CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVIS+YP
Sbjct  61   LVMSKFSNDVEATLGIKITCSQETEPLGTAGPLALARDKLVDGSGQPFFVLNSDVISDYP  120

Query  552  F  554
             
Sbjct  121  L  121



>emb|CDY39219.1| BnaA03g50310D [Brassica napus]
Length=354

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPM+LHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMLLHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>ref|XP_010941227.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941228.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941229.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
 ref|XP_010941231.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Elaeis 
guineensis]
Length=361

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGT+LRPLTLS PKPLV+FANKPMILHQIEALKA+GVTEV+LAINYQP+VM
Sbjct  1    MKALILVGGFGTQLRPLTLSMPKPLVDFANKPMILHQIEALKAIGVTEVILAINYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L FL++FES+LGIKI+CSQE EPLGTAGPLALA++KL+ ++ +PFFVLNSD+  EYP 
Sbjct  61   LRFLEEFESRLGIKITCSQENEPLGTAGPLALAKEKLLQEAEKPFFVLNSDITCEYPL  118



>emb|CAB79775.1| GDP-mannose pyrophosphorylase like protein [Arabidopsis thaliana]
Length=351

 Score =   201 bits (511),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/119 (83%), Positives = 109/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            +KALILVGGFGTRLRPLTLS PKPLV+F NKPMILHQIEALK  GVTEVVLAIN+Q PEV
Sbjct  1    LKALILVGGFGTRLRPLTLSMPKPLVDFGNKPMILHQIEALKGAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL IKI+ SQETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLEIKITFSQETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPL  119



>gb|EMT15706.1| Mannose-1-phosphate guanyltransferase beta [Aegilops tauschii]
Length=297

 Score =   199 bits (505),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/118 (86%), Positives = 104/118 (88%), Gaps = 10/118 (8%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALK VGVTEVVLAINYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQIEALKDVGVTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLKDFESKLGIKI+CSQETEP+GTAGPLALARDKL D           DVISEYPF
Sbjct  61   LNFLKDFESKLGIKITCSQETEPMGTAGPLALARDKLDD----------GDVISEYPF  108



>ref|XP_010438160.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
[Camelina sativa]
Length=358

 Score =   200 bits (508),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 98/117 (84%), Positives = 108/117 (92%), Gaps = 1/117 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q P+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEY  548
            MLNF+KD+E KL IKI+ SQETEPLGTAGPLALARDKL+D++G+PFFVLNSDVI EY
Sbjct  61   MLNFVKDYEKKLEIKITFSQETEPLGTAGPLALARDKLVDETGQPFFVLNSDVICEY  117



>ref|XP_009791580.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
 ref|XP_009791581.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nicotiana 
sylvestris]
Length=360

 Score =   199 bits (505),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/118 (83%), Positives = 108/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLV+FANKPMILHQIEALKA+GVTEVVLAI+YQP++M
Sbjct  1    MKALILVGGFGTRLRPLTLNVPKPLVDFANKPMILHQIEALKAIGVTEVVLAISYQPKIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             NFLK+FE K  IKI+CS+ETEPLGTAGPLALARD L DDS EPFFVLNSDVI +YP 
Sbjct  61   QNFLKEFEKK-DIKITCSEETEPLGTAGPLALARDILRDDSDEPFFVLNSDVICDYPL  117



>emb|CDX72252.1| BnaC07g42740D [Brassica napus]
Length=357

 Score =   198 bits (503),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 98/119 (82%), Positives = 108/119 (91%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+Q PEV
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF++++E KL +KI+ SQETEPLGTAGPLALARDKLI +SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVEEYEKKLEMKITFSQETEPLGTAGPLALARDKLIHESGKPFFVLNSDVICEYPL  119



>ref|XP_010412788.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=358

 Score =   197 bits (502),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 108/121 (89%), Gaps = 3/121 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPE--  374
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EV+L INY+PE  
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVILTINYEPEQL  60

Query  375  -VMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  551
             VM NF ++ E+ LGIKI+CSQETEPLGTAGPLALAR+KL+D S +PFFVLNSDVISEYP
Sbjct  61   LVMSNFSREVETNLGIKITCSQETEPLGTAGPLALAREKLVDGSDQPFFVLNSDVISEYP  120

Query  552  F  554
             
Sbjct  121  L  121



>gb|EMS68890.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=412

 Score =   199 bits (506),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 107/169 (63%), Positives = 113/169 (67%), Gaps = 51/169 (30%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQ-----------------------  311
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ                       
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQVDKRLRLRLIEIVYYGAVSQISP  60

Query  312  ----------------------------IEALKAVGVTEVVLAINYQPEVMLNFLKDFES  407
                                        IEALK VGVTEV+LAINY+PEVM+NFLKDFE 
Sbjct  61   SFVVTNAEQVVQIRGKKNLLIKTYQFVQIEALKDVGVTEVILAINYRPEVMINFLKDFED  120

Query  408  KLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            KLGI I+CSQETEPLGTAGPLALARDKL+D SGEPFFVLNSDVISEYPF
Sbjct  121  KLGITITCSQETEPLGTAGPLALARDKLVDGSGEPFFVLNSDVISEYPF  169



>ref|XP_008799379.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Phoenix 
dactylifera]
Length=361

 Score =   197 bits (502),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGT+LRPLT+S PKPLV+FANKPMILHQIEALKA GVTEV+LAINYQP+VM
Sbjct  1    MKALILVGGFGTQLRPLTISMPKPLVDFANKPMILHQIEALKATGVTEVILAINYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L+FL++FES+LGI+I+CSQE EP+GTAGPLALA++KL+ ++ +PFFVLNSD+  EYP 
Sbjct  61   LSFLEEFESRLGIEITCSQENEPMGTAGPLALAKEKLLQEADKPFFVLNSDITCEYPL  118



>ref|XP_006412681.1| hypothetical protein EUTSA_v10025578mg [Eutrema salsugineum]
 gb|ESQ54134.1| hypothetical protein EUTSA_v10025578mg [Eutrema salsugineum]
Length=353

 Score =   197 bits (500),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 99/120 (83%), Positives = 109/120 (91%), Gaps = 2/120 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINY-QPEV  377
            MKALILVGG GTRLRPLTLS PKPLVEFANKPMILHQIEALKA GVTE+VLAIN+ QPEV
Sbjct  1    MKALILVGGLGTRLRPLTLSTPKPLVEFANKPMILHQIEALKAAGVTEIVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLID-DSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKL+D +S EPFFVLNSD+I EYP 
Sbjct  61   MLNFVKEYEKKLEMKITFSQETEPLGTAGPLALARDKLVDEESSEPFFVLNSDIICEYPL  120



>emb|CDY39215.1| BnaA03g50270D [Brassica napus]
Length=321

 Score =   195 bits (495),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 97/119 (82%), Positives = 107/119 (90%), Gaps = 1/119 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ-PEV  377
            MK LILVGGFGTRLR LT S PKPLV+F NKPMILHQIEA+KA GVTEVVLAIN+Q PEV
Sbjct  1    MKDLILVGGFGTRLRQLTFSMPKPLVDFGNKPMILHQIEAVKAAGVTEVVLAINHQQPEV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            MLNF+K++E KL +KI+ SQETEPLGTAGPLALARDKLID+SG+PFFVLNSDVI EYP 
Sbjct  61   MLNFVKEYEKKLDMKITFSQETEPLGTAGPLALARDKLIDESGKPFFVLNSDVICEYPL  119



>emb|CDY20480.1| BnaC04g05640D [Brassica napus]
Length=360

 Score =   196 bits (497),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKA ILVGGFGTRLRPLTLS PKPLV+FANKP+I+HQIEALKAVGV EVVL +NYQ EVM
Sbjct  1    MKAFILVGGFGTRLRPLTLSLPKPLVDFANKPIIIHQIEALKAVGVDEVVLTVNYQAEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            LNFLK  E+ L IKI+C +ETE +G AGPLALARDKL+D SGEPFFVL+SDVISEYPF
Sbjct  61   LNFLKGVEANLKIKITCLRETESIGMAGPLALARDKLVDGSGEPFFVLSSDVISEYPF  118



>ref|XP_002952855.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
 gb|EFJ46105.1| hypothetical protein VOLCADRAFT_81984 [Volvox carteri f. nagariensis]
Length=360

 Score =   195 bits (495),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            M+ALILVGG+GTRLRPLTLS PKPLVEFANKPMI+HQIEALK+ G TEVVLAINYQPEVM
Sbjct  1    MRALILVGGYGTRLRPLTLSCPKPLVEFANKPMIIHQIEALKSAGCTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + F+++++ KLG+KI CSQE EP+GTAGPLALAR+ L D  G PFFVLNSDVI +YP 
Sbjct  61   MGFIEEWQEKLGVKIVCSQEKEPMGTAGPLALARETLDDGKGTPFFVLNSDVICDYPL  118



>ref|XP_001695916.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
 gb|EDP01253.1| GDP-D-mannose pyrophosphorylase [Chlamydomonas reinhardtii]
Length=360

 Score =   194 bits (494),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 103/118 (87%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            M+ALILVGG+GTRLRPLTLS PKPLVEFANKPMI+HQIEALK  G TEVVLAINYQPEVM
Sbjct  1    MRALILVGGYGTRLRPLTLSCPKPLVEFANKPMIIHQIEALKVAGCTEVVLAINYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L F+++++ KLG++I CSQE EP+GTAGPLALAR+ L D  G PFFVLNSDVI +YP 
Sbjct  61   LGFIQEWQEKLGVRIVCSQEKEPMGTAGPLALARETLDDGKGTPFFVLNSDVICDYPL  118



>ref|XP_010427339.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
 ref|XP_010427340.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 2 
[Camelina sativa]
Length=356

 Score =   193 bits (491),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/118 (81%), Positives = 105/118 (89%), Gaps = 5/118 (4%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQIEALKA+GV EV+LAINY+PE +
Sbjct  1    MKALILVGGFGTRLRPLTLSFPKPLVDFANKPMILHQIEALKAIGVDEVILAINYEPEQL  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L       + LGIKI+CSQETEPLGTAGPLALARDKL+D SG+PFFVLNSDVISEYP 
Sbjct  61   LVM-----TNLGIKITCSQETEPLGTAGPLALARDKLVDGSGQPFFVLNSDVISEYPL  113



>ref|XP_010275250.1| PREDICTED: mannose-1-phosphate guanylyltransferase 1-like [Nelumbo 
nucifera]
Length=360

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 94/118 (80%), Positives = 109/118 (92%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV+FANKP+ILHQIEALKAVGV+EV+LAI+YQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPLVDFANKPIILHQIEALKAVGVSEVILAISYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             + L++FE K+GIK++CSQE EPLGTAGPLALAR+KLI + GEPFFVLNSD+I EYP 
Sbjct  61   RSALEEFEVKVGIKVTCSQEMEPLGTAGPLALAREKLI-EFGEPFFVLNSDIICEYPL  117



>gb|KDP38962.1| hypothetical protein JCGZ_00719 [Jatropha curcas]
Length=355

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 92/118 (78%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALIL GGFGT L PLT++ P+ LVEFANKP+IL+QIEALK VGV+EVVLAINY+ EV+
Sbjct  1    MKALILAGGFGTHLMPLTVTVPRALVEFANKPIILYQIEALKGVGVSEVVLAINYKQEVI  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L FLK+ E KLGIKI+CSQET+PLGTAG LALA+DKLID +GEPFFVLNSDVISEYP 
Sbjct  61   LEFLKEHEKKLGIKITCSQETKPLGTAGSLALAKDKLIDGTGEPFFVLNSDVISEYPL  118



>ref|XP_005652260.1| GDP-D-mannose pyrophosphorylase [Coccomyxa subellipsoidea C-169]
 gb|EIE27716.1| GDP-D-mannose pyrophosphorylase [Coccomyxa subellipsoidea C-169]
Length=361

 Score =   189 bits (481),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGG+GTRLRPLTL+ PKP+V+FANKPMI+HQIEALK  G  EVVLAINYQP+VM
Sbjct  1    MKALILVGGYGTRLRPLTLTVPKPIVDFANKPMIIHQIEALKNAGCNEVVLAINYQPKVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++FLK++E KL IKI+CSQE EP+GTAGPLALA + L D SG+PFFVLNSDVI E+P 
Sbjct  61   MDFLKEWEEKLAIKITCSQEKEPMGTAGPLALASEILNDGSGDPFFVLNSDVICEFPL  118



>ref|XP_004368238.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
 gb|ELR25483.1| GDPmannose pyrophosphorylase [Acanthamoeba castellanii str. Neff]
Length=359

 Score =   187 bits (476),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 105/118 (89%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEFANK MILHQIEAL  VGV EVVLAINY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVEFANKAMILHQIEALVKVGVKEVVLAINYKPELM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             N+LK +ES+LGIKIS SQET+PLGTAGPLALAR+ ++++ GEPFFVLNSD+  EYP 
Sbjct  61   ANYLKKYESELGIKISYSQETQPLGTAGPLALARE-ILEEDGEPFFVLNSDITCEYPL  117



>ref|XP_005851739.1| hypothetical protein CHLNCDRAFT_133102 [Chlorella variabilis]
 gb|EFN59637.1| hypothetical protein CHLNCDRAFT_133102 [Chlorella variabilis]
Length=368

 Score =   187 bits (474),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  KALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVML  383
            KAL+LVGG+GTRLRPLTL+ PKP+++FAN+PMI+HQIEALK  G  EVVLAINY+P+VM+
Sbjct  9    KALVLVGGYGTRLRPLTLTVPKPIIDFANRPMIVHQIEALKEAGCDEVVLAINYRPQVMM  68

Query  384  NFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +FLK++E KLGIKI+CSQE EP+GTAGPLALARD L +D G PFFVLNSDV+  YP 
Sbjct  69   DFLKEWEEKLGIKITCSQEPEPMGTAGPLALARDILHNDEGVPFFVLNSDVVCGYPM  125



>ref|XP_011399603.1| Mannose-1-phosphate guanyltransferase [Auxenochlorella protothecoides]
 gb|KFM26665.1| Mannose-1-phosphate guanyltransferase [Auxenochlorella protothecoides]
Length=372

 Score =   186 bits (472),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/117 (74%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  204  KALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVML  383
            KAL+LVGG+GTRLRPLTL+ PKP+++F NKPMI HQIEALK  G  EVVLAINY+P+VM+
Sbjct  13   KALVLVGGYGTRLRPLTLTVPKPIIDFGNKPMICHQIEALKEAGCDEVVLAINYRPQVMM  72

Query  384  NFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +FLK++E KLGIKI+CSQE EP+GTAGPLALAR  L D  G PFFVLNSDVI EYP 
Sbjct  73   DFLKEWEEKLGIKITCSQEPEPMGTAGPLALARHILEDGHGTPFFVLNSDVICEYPL  129



>dbj|BAP75927.1| GDP-mannose pyrophosphorylase, partial [Moringa oleifera]
Length=342

 Score =   184 bits (468),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 89/99 (90%), Positives = 94/99 (95%), Gaps = 0/99 (0%)
 Frame = +3

Query  258  SAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKDFESKLGIKISCSQ  437
            S PKPLVEFANKPMILHQIEALKA+GVTEVVLAINYQPEVMLNFLK+FE+KLGI I+CSQ
Sbjct  1    SFPKPLVEFANKPMILHQIEALKAIGVTEVVLAINYQPEVMLNFLKEFEAKLGIMITCSQ  60

Query  438  ETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ETEPLGTAGPLALARDKL+D SG PFFVLNSDVISEYP 
Sbjct  61   ETEPLGTAGPLALARDKLVDGSGAPFFVLNSDVISEYPL  99



>emb|CCA19060.1| mannose1phosphate guanyltransferase beta putative [Albugo laibachii 
Nc14]
Length=359

 Score =   183 bits (464),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEVVLA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSVVVHQIEALVAVGVTEVVLAVNYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            L  L   E K  IKISCS E+EPLGTAGPLALA+D L  D G+PFFVLNSDVI EYP 
Sbjct  61   LQALSSMEEKYHIKISCSHESEPLGTAGPLALAKDLL--DDGDPFFVLNSDVICEYPL  116



>gb|AGL46676.1| GDP-mannose pyrophosphorylase [Gracilaria changii]
 gb|AGL46677.1| GDP-mannose pyrophosphorylase [Gracilaria changii]
Length=358

 Score =   181 bits (460),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 99/118 (84%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLV F NKPMILHQIEAL AVGVTEVVLA+NYQPE M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPLVHFCNKPMILHQIEALVAVGVTEVVLAVNYQPEKM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              FLK+  SKLGIKI+ SQETEPLGTAGP+ LA   L D  GEPFFVLNSDV  EYPF
Sbjct  61   QAFLKEQASKLGIKITTSQETEPLGTAGPIKLAEPFLND--GEPFFVLNSDVSCEYPF  116



>gb|AGC69739.1| mannose-1-phosphate guanylyltransferase [Dictyostelium lacteum]
Length=359

 Score =   181 bits (460),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 91/118 (77%), Positives = 103/118 (87%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSRPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             ++LK +E KLGIKIS SQET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF
Sbjct  61   SSYLKPYEEKLGIKISYSQETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPF  116



>ref|XP_009537794.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
 gb|EGZ07030.1| hypothetical protein PHYSODRAFT_319613 [Phytophthora sojae]
Length=359

 Score =   180 bits (456),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEF NK ++LHQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVLHQIEALVAVGVTEVILAVNYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEY  548
            L  L+  E K  IKISCS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY
Sbjct  61   LAALESMEKKYQIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEY  114



>ref|XP_008903956.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETI48632.1| hypothetical protein F443_07367 [Phytophthora parasitica P1569]
 gb|ETI48660.1| hypothetical protein F443_07363 [Phytophthora parasitica P1569]
 gb|ETK88560.1| hypothetical protein L915_07220 [Phytophthora parasitica]
 gb|ETL41954.1| hypothetical protein L916_07172 [Phytophthora parasitica]
 gb|ETL95106.1| hypothetical protein L917_07061 [Phytophthora parasitica]
 gb|ETM48339.1| hypothetical protein L914_07131 [Phytophthora parasitica]
 gb|ETN10852.1| hypothetical protein PPTG_09918 [Phytophthora parasitica INRA-310]
 gb|ETO77385.1| hypothetical protein F444_07427 [Phytophthora parasitica P1976]
 gb|ETP18433.1| hypothetical protein F441_07370 [Phytophthora parasitica CJ01A1]
 gb|ETP46326.1| hypothetical protein F442_07420 [Phytophthora parasitica P10297]
Length=359

 Score =   179 bits (455),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVMHQIEALVAVGVTEVILAVNYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEY  548
            L  L+  E K  IKISCS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY
Sbjct  61   LAALESMEKKYNIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEY  114



>ref|XP_002899327.1| mannose-1-phosphate guanyltransferase beta, putative [Phytophthora 
infestans T30-4]
 gb|EEY62296.1| mannose-1-phosphate guanyltransferase beta, putative [Phytophthora 
infestans T30-4]
Length=359

 Score =   179 bits (454),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 89/116 (77%), Positives = 98/116 (84%), Gaps = 2/116 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEV+LA+NYQP+VM
Sbjct  1    MKALILVGGFGTRLRPLTLSCPKPLVEFCNKSIVMHQIEALVAVGVTEVILAVNYQPQVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEY  548
            L  L+  E K  IKISCS ETEPLGTAGPLALAR+ L  D G+PFFV NSDVI EY
Sbjct  61   LAALESMEKKYHIKISCSHETEPLGTAGPLALARELL--DDGDPFFVFNSDVICEY  114



>ref|XP_003610574.1| Mannose-1-phosphate guanyltransferase [Medicago truncatula]
Length=350

 Score =   178 bits (452),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 102/133 (77%), Gaps = 23/133 (17%)
 Frame = +3

Query  177  LEEHRILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQ-------IEALKAVG  335
            + E R L+ K    +GGFGTRLRPLTL+ PKPLV+FANKPMILHQ       IEALKA G
Sbjct  8    IREMRNLAKK----LGGFGTRLRPLTLNFPKPLVDFANKPMILHQLKIYQGYIEALKATG  63

Query  336  VTEVVLAINYQPEVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPF  515
            VTEVVLAINYQPE            LGIKISCSQETEPLGTAGPLALARDKLIDDSGEPF
Sbjct  64   VTEVVLAINYQPE------------LGIKISCSQETEPLGTAGPLALARDKLIDDSGEPF  111

Query  516  FVLNSDVISEYPF  554
            FVLNSDVI EYP 
Sbjct  112  FVLNSDVICEYPL  124



>gb|EMS58078.1| Mannose-1-phosphate guanyltransferase beta [Triticum urartu]
Length=403

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 96/122 (79%), Gaps = 21/122 (17%)
 Frame = +3

Query  189  RILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQ  368
            R  +MKALILVGGFGTRLRPLTLS PKPLV+FANKPMILHQ                   
Sbjct  152  RTATMKALILVGGFGTRLRPLTLSVPKPLVDFANKPMILHQ-------------------  192

Query  369  PEVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEY  548
              VMLNFLKDFESKLGIKI+CSQETEP+GTAGPLALARDKL D SGEPFFVLNSDVISEY
Sbjct  193  --VMLNFLKDFESKLGIKITCSQETEPMGTAGPLALARDKLDDGSGEPFFVLNSDVISEY  250

Query  549  PF  554
            PF
Sbjct  251  PF  252



>ref|XP_005706305.1| mannose-1-phosphate guanylyltransferase [Galdieria sulphuraria]
 gb|EME29785.1| mannose-1-phosphate guanylyltransferase [Galdieria sulphuraria]
Length=358

 Score =   178 bits (452),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGG+GTRLRPLTLS PKPLVEF NKPM+ HQIEAL AVGV EVVLA++YQP+ M
Sbjct  1    MKALILVGGYGTRLRPLTLSYPKPLVEFCNKPMVFHQIEALAAVGVNEVVLAVSYQPQAM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             +FL+  + KLGIKI+CS+ETEPLGTAGP+ LA   L D  GEPFFVLNSD+I +YPF
Sbjct  61   QDFLESEQQKLGIKITCSRETEPLGTAGPIKLAESLLND--GEPFFVLNSDIICDYPF  116



>emb|CCI41880.1| unnamed protein product [Albugo candida]
Length=1045

 Score =   186 bits (472),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +3

Query  192  ILSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQP  371
            +++MKALILVGGFGTRLRPLTLS PKPLVEF NK +++HQIEAL AVGVTEVVLA+NYQP
Sbjct  31   LVTMKALILVGGFGTRLRPLTLSCPKPLVEFCNKSVVVHQIEALVAVGVTEVVLAVNYQP  90

Query  372  EVMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYP  551
            +VML  L   E K  IKISCS E+EPLGTAGPLALA+D L  D G+PFFVLNSDVI EYP
Sbjct  91   QVMLQALSTMEEKYHIKISCSHESEPLGTAGPLALAKDLL--DDGDPFFVLNSDVICEYP  148

Query  552  F  554
             
Sbjct  149  L  149



>ref|XP_637125.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
 sp|Q54K39.1|GMPPB_DICDI RecName: Full=Mannose-1-phosphate guanyltransferase beta; AltName: 
Full=GDP-mannose pyrophosphorylase B; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase beta [Dictyostelium 
discoideum]
 gb|EAL63618.1| mannose-1-phosphate guanylyltransferase [Dictyostelium discoideum 
AX4]
Length=359

 Score =   178 bits (451),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L+ +E KLGIKIS S ET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF
Sbjct  61   SQYLEPYEKKLGIKISYSHETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPF  116



>ref|XP_003287195.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
 gb|EGC36249.1| mannose-1-phosphate guanylyltransferase [Dictyostelium purpureum]
Length=359

 Score =   177 bits (449),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/118 (75%), Positives = 101/118 (86%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSKPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L+ +E KLGIKIS S ET PLGTAGPLALARD L D  GEPFFVLNSD+I ++PF
Sbjct  61   SAYLQPYEEKLGIKISYSHETVPLGTAGPLALARDLLND--GEPFFVLNSDIICDFPF  116



>gb|ACN88684.2| GDP-D-mannose pyrophosphorylase [Malus domestica]
Length=333

 Score =   176 bits (446),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/90 (92%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  285  ANKPMILHQIEALKAVGVTEVVLAINYQPEVMLNFLKDFESKLGIKISCSQETEPLGTAG  464
            ANKPMILHQIEALKA+GVTEVVLAINYQPEVM+ FLK+FE K+GIKI+CSQETEPLGTAG
Sbjct  1    ANKPMILHQIEALKAIGVTEVVLAINYQPEVMMTFLKEFEEKVGIKITCSQETEPLGTAG  60

Query  465  PLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            PLALARDKLIDDSGEPFFVLNSDVISEYPF
Sbjct  61   PLALARDKLIDDSGEPFFVLNSDVISEYPF  90



>ref|XP_005710557.1| mannose-1-phosphate guanylyltransferase [Chondrus crispus]
 emb|CDF40263.1| mannose-1-phosphate guanylyltransferase [Chondrus crispus]
Length=358

 Score =   176 bits (447),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 102/118 (86%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGG+GTRLRPLTLS PKPLV+F NKPMILHQIEAL AVGVTEVVLA+NYQPE M
Sbjct  1    MKALILVGGYGTRLRPLTLSCPKPLVDFCNKPMILHQIEALVAVGVTEVVLAVNYQPEKM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            + FL+  E +LGIKI+ SQE EPLGTAGP+ LA +K ++DS EPFFVLNSDV  +YPF
Sbjct  61   MAFLEKQEKELGIKITTSQEFEPLGTAGPIKLA-EKYLNDS-EPFFVLNSDVSCDYPF  116



>ref|XP_007790760.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
 gb|EMR70143.1| putative mannose-1-phosphate guanyltransferase protein [Eutypa 
lata UCREL1]
Length=170

 Score =   170 bits (431),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMI+HQIEAL AVGVT+VVLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTMPKPLVEFANKPMIMHQIEALAAVGVTDVVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               L ++  KLG+KI  S E EPLGTAGPL LA ++++  + EPFFVLNSDV  EYPF
Sbjct  61   ERVLGEYGDKLGVKIHFSLEPEPLGTAGPLKLA-EEILSKNDEPFFVLNSDVTCEYPF  117



>gb|EPY51214.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
cryophilus OY26]
Length=363

 Score =   176 bits (445),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E +  +KI+ S E EPLGTAGPLALARD L  DS  PFFVLNSDVI EYPF
Sbjct  61   VQALKKYEEEYKVKITFSVENEPLGTAGPLALARDILGKDS-SPFFVLNSDVICEYPF  117



>dbj|BAN16547.1| ADB2008858, partial [Acytostelium subglobosum]
 dbj|GAM21573.1| hypothetical protein SAMD00019534_047480, partial [Acytostelium 
subglobosum LB1]
Length=366

 Score =   176 bits (445),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/120 (73%), Positives = 101/120 (84%), Gaps = 2/120 (2%)
 Frame = +3

Query  195  LSMKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPE  374
            + MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P+
Sbjct  6    IKMKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQ  65

Query  375  VMLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +M  +L+ +  KLGIKIS S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++PF
Sbjct  66   LMSAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFPF  123



>ref|XP_009650791.1| mannose-1-phosphate guanyltransferase [Verticillium dahliae VdLs.17]
 gb|EGY14437.1| mannose-1-phosphate guanyltransferase [Verticillium dahliae VdLs.17]
Length=364

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKA+ILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIEAL A GVT+VVLA+NY+PE+M
Sbjct  1    MKAIILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEALAAAGVTDVVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               L ++E + GIKI+ S ETEPLGTAGPL LA D L  D   PFFVLNSDVI +YPF
Sbjct  61   EKHLAEYEERFGIKITFSIETEPLGTAGPLKLAEDVLAKDDA-PFFVLNSDVICDYPF  117



>ref|XP_004353971.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
 gb|EGG14534.1| mannose-1-phosphate guanylyltransferase [Dictyostelium fasciculatum]
Length=359

 Score =   174 bits (442),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L+ +  KLGIKIS S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++PF
Sbjct  61   SAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFPF  116



>gb|AAP80837.1| GDP-D-mannose pyrophosphorylase [Griffithsia japonica]
Length=148

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 95/118 (81%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGG+GTRLRPLTLS PKPLV+F NK MILHQIEAL A GVTEVVLA+NYQPE M
Sbjct  1    MKALILVGGYGTRLRPLTLSVPKPLVDFCNKAMILHQIEALAAAGVTEVVLAVNYQPEKM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             +FL + E +LGIKI+ S+E EPL TAGP+ LA   L D  GEPFFVLNSDV   YPF
Sbjct  61   RSFLNEKEKQLGIKITTSKEDEPLDTAGPIKLAEPHLND--GEPFFVLNSDVSCAYPF  116



>ref|XP_006682149.1| hypothetical protein BATDEDRAFT_20856 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF77188.1| hypothetical protein BATDEDRAFT_20856 [Batrachochytrium dendrobatidis 
JAM81]
Length=360

 Score =   174 bits (441),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 102/118 (86%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQIEALVKAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
             NF+  +E++LG+ I+ S ETEPLGTAGPLALA D ++  + +PFFVLNSDVI ++PF
Sbjct  61   ANFIATYEAQLGVHITFSVETEPLGTAGPLALASD-VLGKNDDPFFVLNSDVICDFPF  117



>ref|XP_002174350.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
japonicus yFS275]
 gb|EEB08057.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
japonicus yFS275]
Length=363

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E++  +KI+ S E EPLGTAGPLALARD L  D   PFFVLNSDVI +YPF
Sbjct  61   VQALKKYEAEYNVKITFSVENEPLGTAGPLALARDVLGKDD-SPFFVLNSDVICDYPF  117



>emb|CDS14169.1| Putative Mannose-1-phosphate guanyltransferase [Absidia idahoensis 
var. thermophila]
Length=364

 Score =   174 bits (442),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEHLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++ LK +E + G+ I+ S ETEPLGTAGPLALARD L  D   PFFVLNSD+I +YPF
Sbjct  61   VSTLKKYEQEFGVTITFSVETEPLGTAGPLALARDILAKDD-SPFFVLNSDIICDYPF  117



>emb|CEJ05128.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=273

 Score =   172 bits (435),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLSKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  L+++E +  +KI+ S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALQEYEKEYNVKITFSVETEPLGTAGPLALARDILGKDDS-PFFVLNSDVICDYPF  117



>gb|EFA80657.1| mannose-1-phosphate guanylyltransferase [Polysphondylium pallidum 
PN500]
Length=359

 Score =   174 bits (440),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L+ +  KLGIKIS S ET PLGTAGPLALARD L D  G+PFFVLNSD+I ++PF
Sbjct  61   SAYLEPYAEKLGIKISYSHETTPLGTAGPLALARDLLND--GQPFFVLNSDIICDFPF  116



>dbj|BAA13790.1| unnamed protein product [Schizosaccharomyces pombe]
Length=363

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E +  + I+ S E EPLGTAGPLALARD L  D   PFFVLNSDVI EYPF
Sbjct  61   VEALKKYEKEYNVNITFSVENEPLGTAGPLALARDILAKDH-SPFFVLNSDVICEYPF  117



>ref|NP_588405.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
pombe 972h-]
 sp|O74484.1|MPG1_SCHPO RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase [Schizosaccharomyces pombe 
972h-]
 emb|CAA20770.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
pombe]
Length=363

 Score =   174 bits (440),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NKPMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E +  + I+ S E EPLGTAGPLALARD L  D   PFFVLNSDVI EYPF
Sbjct  61   VEALKKYEKEYNVNITFSVENEPLGTAGPLALARDILAKDH-SPFFVLNSDVICEYPF  117



>dbj|GAM18590.1| hypothetical protein SAMD00019534_017650 [Acytostelium subglobosum 
LB1]
Length=359

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 100/118 (85%), Gaps = 2/118 (2%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTLS PKP+VEFANK MILHQIEAL  +GV EVVLA+NY+P++M
Sbjct  1    MKALILVGGFGTRLRPLTLSVPKPIVEFANKAMILHQIEALCKIGVNEVVLAVNYRPQLM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L+ +  KLGIKIS S ET PLGTAGPLALAR+ L D  G+PFFVLNSD+I ++PF
Sbjct  61   SAYLEPYAQKLGIKISYSHETTPLGTAGPLALARELLND--GQPFFVLNSDIICDFPF  116



>gb|EIE85443.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=361

 Score =   173 bits (439),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E +  ++I+ S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEEEYNVRITFSVETEPLGTAGPLALARDILAKDD-SPFFVLNSDVICDYPF  117



>gb|EPX73569.1| mannose-1-phosphate guanyltransferase Mpg1 [Schizosaccharomyces 
octosporus yFS286]
Length=363

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF N+PMILHQ+EAL A GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVEALAAAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E +  ++I+ S E EPLGTAGPLALARD L  D+  PFFVLNSDVI EYPF
Sbjct  61   VQALKKYEEEYKVRITFSVENEPLGTAGPLALARDILGKDN-SPFFVLNSDVICEYPF  117



>emb|CEP10265.1| hypothetical protein [Parasitella parasitica]
Length=363

 Score =   173 bits (438),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E + G+KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEQEYGVKITFSVETEPLGTAGPLALAREILGKDE-SPFFVLNSDVICDYPF  117



>emb|CDR44464.1| CYFA0S14e02960g1_1 [Cyberlindnera fabianii]
Length=362

 Score =   172 bits (437),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFANRPMILHQIEALAKAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +N LK +E + G+ I+ S ETEPLGTAGPL LA + L  D   PFFVLNSDVI EYPF
Sbjct  61   VNTLKKYEEEYGVSITFSVETEPLGTAGPLKLAEEVLKKDD-SPFFVLNSDVICEYPF  117



>emb|CEI86119.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=389

 Score =   173 bits (438),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E +  +KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKQYNVKITFSVETEPLGTAGPLALAREILAKDDS-PFFVLNSDVICDYPF  117



>dbj|GAN07474.1| conserved hypothetical protein [Mucor ambiguus]
Length=363

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E + G+ I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKEYGVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPF  117



>gb|KFH62576.1| mannose-1-phosphate guanyltransferase [Mortierella verticillata 
NRRL 6337]
Length=363

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/118 (73%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTMPKPLVEFANKPMILHQIEALAKAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++ L+ +E    +KI+ S ETEPLGTAGPLALARD L  D   PFFVLNSDVI ++PF
Sbjct  61   VSILQKYEDLYNVKITFSVETEPLGTAGPLALARDILGKDD-SPFFVLNSDVICDFPF  117



>emb|CEG73578.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=363

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLSKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  L+++E +  +KI+ S ETEPLGTAGPLALARD L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALQEYEKEYNVKITFSVETEPLGTAGPLALARDILGKDD-SPFFVLNSDVICDYPF  117



>gb|EGA87676.1| Psa1p [Saccharomyces cerevisiae VL3]
Length=253

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPF  117



>gb|EPB86770.1| mannose-1-phosphate guanyltransferase [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=363

 Score =   172 bits (436),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E + G+ I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKEYGVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPF  117



>gb|EGA75738.1| Psa1p [Saccharomyces cerevisiae AWRI796]
Length=253

 Score =   169 bits (428),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPF  117



>ref|XP_004347896.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
 gb|KJE93259.1| mannose-1-phosphate guanyltransferase beta [Capsaspora owczarzaki 
ATCC 30864]
Length=359

 Score =   172 bits (435),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL  PKPLVEFANKPM+LHQ+EAL   GVT V+LA+NY+ EVM
Sbjct  1    MKALILVGGFGTRLRPLTLGLPKPLVEFANKPMLLHQVEALVKAGVTHVILAVNYRAEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               L+ FE    IKIS SQETEPLGTAGPLALARD ++++   PFFVLNSDVI ++PF
Sbjct  61   EKELRSFEQTYNIKISISQETEPLGTAGPLALARD-ILNEGDSPFFVLNSDVICDFPF  117



>ref|XP_006678904.1| hypothetical protein BATDEDRAFT_16693 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80487.1| hypothetical protein BATDEDRAFT_16693 [Batrachochytrium dendrobatidis 
JAM81]
Length=360

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 98/119 (82%), Gaps = 3/119 (3%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLT S PKPLV+FANKPMILHQI AL AVGV E+VLA+NYQPEVM
Sbjct  1    MKALILVGGFGTRLRPLTFSKPKPLVDFANKPMILHQIAALAAVGVKEIVLAVNYQPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKL-IDDSGEPFFVLNSDVISEYPF  554
             N ++  E +  IKI+ S E+EPLGTAGPL LARD L  DDS  PFFVLNSDVI E+PF
Sbjct  61   ANAMQKVEDEFNIKITFSIESEPLGTAGPLGLARDILGADDS--PFFVLNSDVICEFPF  117



>gb|EGA59462.1| Psa1p [Saccharomyces cerevisiae FostersB]
 gb|EGA83697.1| Psa1p [Saccharomyces cerevisiae Lalvin QA23]
Length=253

 Score =   169 bits (427),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDNS-PFFVLNSDVICEYPF  117



>gb|KIW41620.1| mannose-1-phosphate guanyltransferase, variant [Exophiala oligosperma]
Length=364

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               LK +E +  +KI+ S ETEPLGTAGPL LA +K++    +PFFVLNSDVI EYPF
Sbjct  61   TGALKQYEERYNVKITFSVETEPLGTAGPLKLA-EKILGRDDKPFFVLNSDVICEYPF  117



>ref|XP_011102864.1| psa1p [Saccharomyces arboricola H-6]
 gb|EJS44385.1| psa1p [Saccharomyces arboricola H-6]
Length=361

 Score =   172 bits (435),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +ES+ G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYESEYGVNITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICEYPF  117



>emb|CDH56858.1| mannose-1-phosphate guanyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=360

 Score =   171 bits (434),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSD+I +YPF
Sbjct  61   VAALKQYEKEFGVTITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDIICDYPF  117



>emb|CDS14396.1| Putative Mannose-1-phosphate guanyltransferase [Absidia idahoensis 
var. thermophila]
Length=363

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSD+I +YPF
Sbjct  61   VAALKQYEKEFGVTITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDIICDYPF  117



>gb|KFH70136.1| mannose-1-phosphate guanyltransferase [Mortierella verticillata 
NRRL 6337]
Length=363

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTMPKPLVEFANRPMILHQIEALAEAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++ L+ +E    +KI+ S ETEPLGTAGPLALARD L  D   PFFVLNSDVI ++PF
Sbjct  61   VSILQKYEEIYNVKITFSVETEPLGTAGPLALARDILGKDD-SPFFVLNSDVICDFPF  117



>emb|CDH56859.1| mannose-1-phosphate guanyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=363

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSD+I +YPF
Sbjct  61   VAALKQYEKEFGVTITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDIICDYPF  117



>emb|CDH48439.1| mannose-1-phosphate guanyltransferase [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=363

 Score =   171 bits (434),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEHLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E    +KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VRALKEYEELYNVKITFSVETEPLGTAGPLALAREILAKDD-SPFFVLNSDVICDYPF  117



>ref|XP_010432972.1| PREDICTED: probable mannose-1-phosphate guanylyltransferase 3 
isoform X2 [Camelina sativa]
Length=353

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/119 (75%), Positives = 97/119 (82%), Gaps = 6/119 (5%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINY-QPEV  377
            MKALILVGGFGTRLRPLT S PKPLV+F NKPMILHQIEALKA GVTEVVLAIN+ QP+V
Sbjct  1    MKALILVGGFGTRLRPLTFSMPKPLVDFGNKPMILHQIEALKAAGVTEVVLAINHQQPDV  60

Query  378  MLNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
                 ++    L I  S   ETEPLGTAGPLALARDKL+D+SG+PFFVLNSDVI EYP 
Sbjct  61   TYTIFRNH--NLTIHYS---ETEPLGTAGPLALARDKLVDESGQPFFVLNSDVICEYPL  114



>emb|CDS03573.1| Putative Mannose-1-phosphate guanyltransferase [Absidia idahoensis 
var. thermophila]
Length=363

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIEHLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E    +KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VRALKEYEELYNVKITFSVETEPLGTAGPLALAREILAKDD-SPFFVLNSDVICDYPF  117



>gb|EIE84524.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=355

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLSKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E +  + I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKEYNVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPF  117



>dbj|BAO41930.1| mannose-1-phosphate guanyltransferase [Kluyveromyces marxianus 
DMKU3-1042]
 dbj|BAP73354.1| mannose-1-phosphate guanyltransferase [Kluyveromyces marxianus]
Length=361

 Score =   171 bits (433),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI +YPF
Sbjct  61   VETLKKYEEEYGVSITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICDYPF  117



>gb|EIE79690.1| mannose-1-phosphate guanyltransferase [Rhizopus delemar RA 99-880]
Length=363

 Score =   171 bits (433),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLSKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E +  + I+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKEYNVNITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPF  117



>emb|CEI86118.1| Putative Mannose-1-phosphate guanyltransferase [Rhizopus microsporus]
Length=443

 Score =   173 bits (438),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 85/118 (72%), Positives = 99/118 (84%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIENLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK++E +  +KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKEYEKQYNVKITFSVETEPLGTAGPLALAREILAKDD-SPFFVLNSDVICDYPF  117



>ref|XP_002495260.1| ZYRO0B07150p [Zygosaccharomyces rouxii]
 emb|CAR26327.1| ZYRO0B07150p [Zygosaccharomyces rouxii]
Length=361

 Score =   171 bits (432),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA   L  DS  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEEEYGVSITFSVETEPLGTAGPLKLAEKVLKKDS-SPFFVLNSDVICEYPF  117



>emb|CCX14363.1| Similar to Mannose-1-phosphate guanyltransferase; acc. no. Q5B1J4 
[Pyronema omphalodes CBS 100304]
Length=364

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF N+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +N L+ +E +  +KI+ S ETEPLGTAGPL LA + L  D   PFFVLNSDVI EYPF
Sbjct  61   INVLQKYEEEYNVKITFSVETEPLGTAGPLKLAGEILGKDD-SPFFVLNSDVICEYPF  117



>emb|CEP07577.1| hypothetical protein [Parasitella parasitica]
Length=363

 Score =   171 bits (432),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFANKPMILHQIE+L   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANKPMILHQIESLAKAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  L+++E+   +KI+ S ETEPLGTAGPLALARD L  D   PFFVLNSD+I ++PF
Sbjct  61   VAALQEYEAIYNVKITFSVETEPLGTAGPLALARDILAKDD-SPFFVLNSDIICDFPF  117



>emb|CDH17206.1| Mannose-1-phosphate guanyltransferase [Zygosaccharomyces bailii 
ISA1307]
 emb|CDH10960.1| Mannose-1-phosphate guanyltransferase [Zygosaccharomyces bailii 
ISA1307]
Length=361

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPF  117



>emb|CDF91365.1| ZYBA0S11-01222g1_1 [Zygosaccharomyces bailii CLIB 213]
Length=361

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPF  117



>ref|NP_986146.1| AFR599Wp [Ashbya gossypii ATCC 10895]
 sp|Q752H4.1|MPG1_ASHGO RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=GTP-mannose-1-phosphate 
guanylyltransferase [Ashbya gossypii ATCC 10895]
 gb|AAS53970.1| AFR599Wp [Ashbya gossypii ATCC 10895]
 gb|AEY98284.1| FAFR599Wp [Ashbya gossypii FDAG1]
Length=361

 Score =   170 bits (431),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKQYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPF  117



>ref|XP_011273620.1| Mannose-1-phosphate guanyltransferase [Wickerhamomyces ciferrii]
 emb|CCH44528.1| Mannose-1-phosphate guanyltransferase [Wickerhamomyces ciferrii]
Length=362

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEFAN+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFANRPMILHQIEALAKAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  L+ +E + G+ I+ S ETEPLGTAGPL LA D L  D   PFFVLNSDVI EYPF
Sbjct  61   VETLQKYEKEYGVSITFSVETEPLGTAGPLKLAEDVLKKDK-SPFFVLNSDVICEYPF  117



>ref|XP_002840397.1| hypothetical protein [Tuber melanosporum Mel28]
 emb|CAZ84588.1| unnamed protein product [Tuber melanosporum]
Length=364

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/118 (69%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NKPMILHQ+E+L A GVT++VLA+NY+P+VM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMILHQVESLAAAGVTDIVLAVNYRPDVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++ LK +E + G+ I+ S E+EPLGTAGPL LA D ++  + EPFFVLNSDVI +YPF
Sbjct  61   ISVLKKYEEQYGVTITFSIESEPLGTAGPLKLAED-ILGKNQEPFFVLNSDVICDYPF  117



>gb|KIV83904.1| mannose-1-phosphate guanyltransferase [Exophiala sideris]
Length=364

 Score =   170 bits (431),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEFAN+PMILHQ+EAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFANRPMILHQVEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               LK +E K  +KI+ S E+EPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   TAALKKYEEKYNVKITFSVESEPLGTAGPLKLA-EKILGKDDNPFFVLNSDVICEYPF  117



>ref|NP_010228.1| mannose-1-phosphate guanylyltransferase [Saccharomyces cerevisiae 
S288c]
 sp|P41940.2|MPG1_YEAST RecName: Full=Mannose-1-phosphate guanyltransferase; AltName: 
Full=ATP-mannose-1-phosphate guanylyltransferase; AltName: 
Full=GDP-mannose pyrophosphorylase; AltName: Full=NDP-hexose 
pyrophosphorylase [Saccharomyces cerevisiae S288c]
 gb|AAC49289.1| Psa1p [Saccharomyces cerevisiae]
 emb|CAA98617.1| PSA1 [Saccharomyces cerevisiae]
 gb|EDN60300.1| GDP-mannose pyrophosphorylase [Saccharomyces cerevisiae YJM789]
 gb|EDV08332.1| GDP-mannose pyrophosphorylase [Saccharomyces cerevisiae RM11-1a]
 gb|EDZ73286.1| YDL055Cp-like protein [Saccharomyces cerevisiae AWRI1631]
 gb|EEU05989.1| Psa1p [Saccharomyces cerevisiae JAY291]
 emb|CAY78453.1| Psa1p [Saccharomyces cerevisiae EC1118]
 tpg|DAA11801.1| TPA: mannose-1-phosphate guanylyltransferase [Saccharomyces cerevisiae 
S288c]
 gb|EGA79694.1| Psa1p [Saccharomyces cerevisiae Vin13]
 dbj|GAA22191.1| K7_Psa1p [Saccharomyces cerevisiae Kyokai no. 7]
 gb|EHN07969.1| Psa1p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EIW11154.1| Psa1p [Saccharomyces cerevisiae CEN.PK113-7D]
 gb|EWG87021.1| Psa1p [Saccharomyces cerevisiae R008]
 gb|EWG91731.1| Psa1p [Saccharomyces cerevisiae P301]
 gb|EWG96943.1| Psa1p [Saccharomyces cerevisiae R103]
 gb|AHY74952.1| Psa1p [Saccharomyces cerevisiae YJM993]
 gb|AJP37691.1| Psa1p [Saccharomyces cerevisiae YJM1078]
Length=361

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 96/118 (81%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFGNRPMILHQIEALANAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA D L  D+  PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVNITFSVETEPLGTAGPLKLAEDVLKKDN-SPFFVLNSDVICEYPF  117



>gb|AGO10911.1| AaceriAFR599Wp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=361

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLTVPKPLVEFCNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK +E + G+ I+ S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   VETLKKYEKEYGVSITFSVETEPLGTAGPLKLA-EKVLKKDNSPFFVLNSDVICEYPF  117



>ref|XP_447012.1| hypothetical protein [Candida glabrata CBS 138]
 sp|Q6FRY2.1|MPG12_CANGA RecName: Full=Mannose-1-phosphate guanyltransferase 2; AltName: 
Full=ATP-mannose-1-phosphate guanylyltransferase 2; AltName: 
Full=GDP-mannose pyrophosphorylase 2 [Candida glabrata CBS 
138]
 emb|CAG59945.1| unnamed protein product [Candida glabrata]
Length=361

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MK LILVGG+GTRLRPLTLS PKPLVEF N+PMILHQIEAL   GVT++VLA+NY+PEVM
Sbjct  1    MKGLILVGGYGTRLRPLTLSVPKPLVEFCNRPMILHQIEALAEAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            ++ LK +E + G+ I+ S ETEPLGTAGPL LA +K++     PFFVLNSDVI EYPF
Sbjct  61   VDTLKKYEKEYGVNITFSVETEPLGTAGPLKLA-EKILKKDNSPFFVLNSDVICEYPF  117



>gb|KIW58406.1| mannose-1-phosphate guanyltransferase [Exophiala xenobiotica]
Length=364

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF N+PMILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNRPMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               LK +E K  +KI+ S E+EPLGTAGPL LA +K++    +PFFVLNSDVI EYPF
Sbjct  61   TGALKKYEEKYNVKITFSVESEPLGTAGPLKLA-EKILGKDDKPFFVLNSDVICEYPF  117



>emb|CCG83440.1| Mannose-1-phosphate guanylyltransferase [Taphrina deformans PYCC 
5710]
Length=361

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NKPMI HQ+EAL   GVT++VLA+NY+PE+M
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKPMIEHQVEALAEAGVTDIVLAVNYRPEIM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
            +  LK FE +  +KI+ S ETEPLGTAGPLALAR+ L  D   PFFVLNSDVI +YPF
Sbjct  61   VAALKKFEERYNVKITFSVETEPLGTAGPLALAREILGKDD-SPFFVLNSDVICDYPF  117



>gb|KFY61094.1| hypothetical protein V496_05148 [Pseudogymnoascus pannorum VKM 
F-4515 (FW-2607)]
Length=364

 Score =   170 bits (430),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L ++E +  +KI+ S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPF  117



>ref|XP_004576712.1| PREDICTED: mannose-1-phosphate guanyltransferase beta-like, partial 
[Maylandia zebra]
Length=134

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/118 (68%), Positives = 97/118 (82%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGG+GTRLRPLTLS PKPLVEF NKP++LHQ+EAL   GV  VVLA++Y  E++
Sbjct  1    MKALILVGGYGTRLRPLTLSVPKPLVEFCNKPILLHQVEALVKAGVDHVVLAVSYMSELL  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
               ++  E +LGI+IS S E EPLGTAGPLALARD L++D+ EPFFVLNSDVI ++PF
Sbjct  61   EREMRVQEQRLGIRISLSHEKEPLGTAGPLALARD-LLNDNSEPFFVLNSDVICDFPF  117



>gb|KFY85514.1| hypothetical protein V500_08352 [Pseudogymnoascus pannorum VKM 
F-4518 (FW-2643)]
 gb|KFY86261.1| hypothetical protein V498_07559 [Pseudogymnoascus pannorum VKM 
F-4517 (FW-2822)]
 gb|KFZ16574.1| hypothetical protein V502_05027 [Pseudogymnoascus pannorum VKM 
F-4520 (FW-2644)]
Length=364

 Score =   170 bits (430),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 84/118 (71%), Positives = 98/118 (83%), Gaps = 1/118 (1%)
 Frame = +3

Query  201  MKALILVGGFGTRLRPLTLSAPKPLVEFANKPMILHQIEALKAVGVTEVVLAINYQPEVM  380
            MKALILVGGFGTRLRPLTL+ PKPLVEF NK MILHQIEAL A GVT++VLA+NY+PEVM
Sbjct  1    MKALILVGGFGTRLRPLTLTLPKPLVEFGNKRMILHQIEALAAAGVTDIVLAVNYRPEVM  60

Query  381  LNFLKDFESKLGIKISCSQETEPLGTAGPLALARDKLIDDSGEPFFVLNSDVISEYPF  554
              +L ++E +  +KI+ S ETEPLGTAGPL LA +K +  + EPFFVLNSDVI EYPF
Sbjct  61   EKYLAEYEEQYNVKITFSIETEPLGTAGPLKLA-EKTLGKNNEPFFVLNSDVICEYPF  117



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760