BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C15

Length=508
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CAA70700.1|  transformer-SR ribonucleoprotein                       155   2e-43   Nicotiana tabacum [American tobacco]
emb|CDP01837.1|  unnamed protein product                                154   4e-43   Coffea canephora [robusta coffee]
gb|AIX10950.1|  transformer-2 protein-like alpha-like protein           154   7e-43   Gardenia jasminoides
ref|XP_011079075.1|  PREDICTED: serine/arginine-rich splicing fac...    153   1e-42   Sesamum indicum [beniseed]
ref|XP_004135013.1|  PREDICTED: uncharacterized RNA-binding prote...    152   2e-42   
ref|XP_004158852.1|  PREDICTED: uncharacterized LOC101219220            152   2e-42   
gb|EYU30367.1|  hypothetical protein MIMGU_mgv1a012795mg                150   3e-42   Erythranthe guttata [common monkey flower]
gb|EPS65363.1|  hypothetical protein M569_09415                         151   3e-42   Genlisea aurea
ref|XP_009788034.1|  PREDICTED: serine/arginine-rich splicing fac...    151   6e-42   Nicotiana sylvestris
ref|XP_009788035.1|  PREDICTED: serine/arginine-rich splicing fac...    150   7e-42   Nicotiana sylvestris
ref|XP_011022229.1|  PREDICTED: serine/arginine-rich splicing fac...    150   1e-41   Populus euphratica
gb|KDP43705.1|  hypothetical protein JCGZ_22332                         150   2e-41   Jatropha curcas
ref|XP_008440881.1|  PREDICTED: LOW QUALITY PROTEIN: ankyrin repe...    156   2e-41   
gb|EYU30368.1|  hypothetical protein MIMGU_mgv1a012795mg                149   5e-41   Erythranthe guttata [common monkey flower]
ref|XP_006383019.1|  hypothetical protein POPTR_0005s10780g             148   5e-41   
gb|EYU29909.1|  hypothetical protein MIMGU_mgv1a025336mg                149   6e-41   Erythranthe guttata [common monkey flower]
ref|XP_009623497.1|  PREDICTED: ankyrin repeat domain-containing ...    155   8e-41   
ref|XP_006343342.1|  PREDICTED: transformer-2 protein homolog alp...    148   1e-40   Solanum tuberosum [potatoes]
ref|XP_006383020.1|  hypothetical protein POPTR_0005s10780g             148   1e-40   Populus trichocarpa [western balsam poplar]
ref|NP_001238379.1|  uncharacterized protein LOC100499944               145   2e-40   
ref|XP_004232529.1|  PREDICTED: serine/arginine-rich splicing fac...    147   3e-40   Solanum lycopersicum
gb|KEH27602.1|  RNA-binding (RRM/RBD/RNP motif) family protein          145   8e-40   Medicago truncatula
gb|KEH27603.1|  RNA-binding (RRM/RBD/RNP motif) family protein          144   1e-39   Medicago truncatula
ref|XP_010033540.1|  PREDICTED: serine/arginine-rich splicing fac...    145   1e-39   Eucalyptus grandis [rose gum]
ref|XP_002530643.1|  Arginine/serine-rich-splicing factor, putative     145   1e-39   
ref|XP_006425349.1|  hypothetical protein CICLE_v10026375mg             142   1e-39   
ref|XP_006425346.1|  hypothetical protein CICLE_v10026375mg             143   1e-39   
ref|NP_001238605.1|  uncharacterized protein LOC100527350               143   2e-39   
gb|KJB17552.1|  hypothetical protein B456_003G005400                    142   3e-39   Gossypium raimondii
ref|NP_001237888.1|  uncharacterized protein LOC100500170               144   4e-39   
emb|CBI24453.3|  unnamed protein product                                144   4e-39   Vitis vinifera
gb|KHN35554.1|  Putative RNA-binding protein C25G10.01                  144   4e-39   Glycine soja [wild soybean]
gb|KJB17554.1|  hypothetical protein B456_003G005400                    141   5e-39   Gossypium raimondii
gb|KDO71363.1|  hypothetical protein CISIN_1g026421mg                   142   7e-39   Citrus sinensis [apfelsine]
ref|XP_010918157.1|  PREDICTED: serine/arginine-rich splicing fac...    143   9e-39   Elaeis guineensis
ref|XP_010918156.1|  PREDICTED: serine/arginine-rich splicing fac...    143   9e-39   Elaeis guineensis
gb|KJB17555.1|  hypothetical protein B456_003G005400                    140   1e-38   Gossypium raimondii
ref|XP_003612260.1|  Scaffold attachment factor B1                      144   1e-38   Medicago truncatula
gb|KHG21989.1|  Scaffold attachment factor B2                           141   1e-38   Gossypium arboreum [tree cotton]
gb|AFK45871.1|  unknown                                                 144   1e-38   Medicago truncatula
ref|XP_003629227.1|  ELAV-like protein                                  144   1e-38   Medicago truncatula
gb|KJB17557.1|  hypothetical protein B456_003G005400                    142   2e-38   Gossypium raimondii
ref|XP_006425350.1|  hypothetical protein CICLE_v10026375mg             142   2e-38   
ref|XP_006425348.1|  hypothetical protein CICLE_v10026375mg             142   2e-38   Citrus clementina [clementine]
gb|KJB17553.1|  hypothetical protein B456_003G005400                    142   2e-38   Gossypium raimondii
ref|XP_006467033.1|  PREDICTED: transformer-2 protein homolog bet...    142   2e-38   
gb|KDO71362.1|  hypothetical protein CISIN_1g026421mg                   142   3e-38   Citrus sinensis [apfelsine]
gb|KHN00439.1|  Putative RNA-binding protein C25G10.01                  143   4e-38   Glycine soja [wild soybean]
ref|XP_007202500.1|  hypothetical protein PRUPE_ppa010685mg             141   4e-38   Prunus persica
ref|XP_007157858.1|  hypothetical protein PHAVU_002G104100g             142   5e-38   Phaseolus vulgaris [French bean]
ref|XP_006409259.1|  hypothetical protein EUTSA_v10022831mg             140   7e-38   Eutrema salsugineum [saltwater cress]
ref|XP_008393698.1|  PREDICTED: transformer-2 protein homolog bet...    140   1e-37   
ref|XP_009344819.1|  PREDICTED: serine/arginine-rich splicing fac...    140   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_008393706.1|  PREDICTED: transformer-2 protein homolog bet...    140   1e-37   
ref|XP_009344818.1|  PREDICTED: serine/arginine-rich splicing fac...    140   2e-37   
ref|XP_010526825.1|  PREDICTED: serine/arginine-rich splicing fac...    139   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_004509406.1|  PREDICTED: transformer-2 protein homolog alp...    140   2e-37   Cicer arietinum [garbanzo]
ref|XP_008791954.1|  PREDICTED: serine/arginine-rich splicing fac...    139   2e-37   Phoenix dactylifera
gb|AFK46395.1|  unknown                                                 140   3e-37   Lotus japonicus
ref|XP_009408202.1|  PREDICTED: serine/arginine-rich splicing fac...    139   3e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006572837.1|  PREDICTED: uncharacterized protein LOC100527...    139   4e-37   
ref|XP_006282702.1|  hypothetical protein CARUB_v10005648mg             137   4e-37   
ref|XP_010935190.1|  PREDICTED: serine/arginine-rich splicing fac...    137   5e-37   
gb|KHN35992.1|  Putative RNA-binding protein C25G10.01                  139   7e-37   Glycine soja [wild soybean]
ref|XP_010696606.1|  PREDICTED: serine/arginine-rich splicing fac...    137   7e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002867054.1|  hypothetical protein ARALYDRAFT_912788             135   8e-37   
ref|XP_010266988.1|  PREDICTED: ankyrin repeat domain-containing ...    144   9e-37   
ref|XP_006828824.1|  hypothetical protein AMTR_s00001p00140760          137   9e-37   Amborella trichopoda
ref|XP_002270437.3|  PREDICTED: uncharacterized protein LOC100241946    145   1e-36   
ref|XP_010437422.1|  PREDICTED: serine/arginine-rich splicing fac...    137   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007046578.1|  Ankyrin repeat protein                             144   1e-36   
emb|CDY20808.1|  BnaC07g06570D                                          138   1e-36   Brassica napus [oilseed rape]
ref|XP_010935189.1|  PREDICTED: serine/arginine-rich splicing fac...    137   2e-36   Elaeis guineensis
ref|XP_004512185.1|  PREDICTED: serine/arginine-rich splicing fac...    137   2e-36   
ref|XP_010935188.1|  PREDICTED: serine/arginine-rich splicing fac...    137   2e-36   Elaeis guineensis
ref|XP_006282703.1|  hypothetical protein CARUB_v10005648mg             136   3e-36   
ref|XP_008806158.1|  PREDICTED: serine/arginine-rich splicing fac...    136   3e-36   Phoenix dactylifera
gb|KFK30200.1|  hypothetical protein AALP_AA7G231300                    134   4e-36   Arabis alpina [alpine rockcress]
ref|XP_008242002.1|  PREDICTED: ankyrin repeat domain-containing ...    142   4e-36   
ref|XP_009400377.1|  PREDICTED: serine/arginine-rich splicing fac...    135   5e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006412060.1|  hypothetical protein EUTSA_v10026015mg             136   7e-36   Eutrema salsugineum [saltwater cress]
ref|XP_009150254.1|  PREDICTED: serine/arginine-rich splicing fac...    135   9e-36   Brassica rapa
ref|NP_001154288.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    134   1e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010113281.1|  Ankyrin repeat domain-containing protein           140   2e-35   
ref|NP_001190929.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    133   2e-35   Arabidopsis thaliana [mouse-ear cress]
emb|CDX69165.1|  BnaC01g02880D                                          135   3e-35   
ref|XP_004512184.1|  PREDICTED: serine/arginine-rich splicing fac...    135   3e-35   Cicer arietinum [garbanzo]
emb|CDX75526.1|  BnaA01g01760D                                          135   3e-35   
ref|XP_004287763.2|  PREDICTED: ankyrin repeat domain-containing ...    139   3e-35   Fragaria vesca subsp. vesca
ref|NP_001190930.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    134   3e-35   
ref|NP_974690.4|  RNA-binding (RRM/RBD/RNP motifs) family protein       133   5e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_680768.5|  RNA-binding (RRM/RBD/RNP motifs) family protein       133   6e-35   
ref|XP_008361349.1|  PREDICTED: uncharacterized protein LOC103425049    138   9e-35   
ref|XP_009337079.1|  PREDICTED: ankyrin repeat domain-containing ...    137   2e-34   
ref|XP_009363438.1|  PREDICTED: ankyrin repeat domain-containing ...    137   2e-34   
ref|XP_009387324.1|  PREDICTED: serine/arginine-rich splicing fac...    131   3e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_001756218.1|  predicted protein                                  127   2e-33   
gb|ADE76245.1|  unknown                                                 127   5e-33   Picea sitchensis
gb|KHN06831.1|  RNA-binding motif protein, X chromosome                 125   1e-32   Glycine soja [wild soybean]
ref|XP_009109272.1|  PREDICTED: serine/arginine-rich splicing fac...    127   1e-32   Brassica rapa
ref|XP_010521922.1|  PREDICTED: serine/arginine-rich splicing fac...    122   4e-32   Tarenaya hassleriana [spider flower]
ref|NP_001058614.1|  Os06g0724600                                       124   4e-32   
gb|ABR46234.1|  At4g35785                                               122   9e-32   Arabidopsis thaliana [mouse-ear cress]
emb|CDY42653.1|  BnaC01g00650D                                          127   6e-31   Brassica napus [oilseed rape]
gb|EEE66378.1|  hypothetical protein OsJ_22698                          123   1e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EEC81329.1|  hypothetical protein OsI_24503                          123   1e-30   Oryza sativa Indica Group [Indian rice]
dbj|BAD61690.1|  putative transformer-SR ribonucleoprotein              122   1e-30   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006657354.1|  PREDICTED: transformer-2 protein homolog bet...    123   2e-30   
gb|ABW81106.1|  putRNAbp29                                              122   4e-30   Tarenaya spinosa
ref|XP_010521921.1|  PREDICTED: serine/arginine-rich splicing fac...    122   5e-30   Tarenaya hassleriana [spider flower]
ref|XP_010521920.1|  PREDICTED: serine/arginine-rich splicing fac...    122   7e-30   Tarenaya hassleriana [spider flower]
ref|NP_849605.1|  serine/arginine rich-like protein SR45a               116   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009109965.1|  PREDICTED: serine/arginine-rich splicing fac...    119   3e-29   
ref|XP_001778182.1|  predicted protein                                  116   3e-29   
gb|EEE68615.1|  hypothetical protein OsJ_27155                          118   5e-29   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001061706.1|  Os08g0385900                                       118   6e-29   
ref|XP_002437609.1|  hypothetical protein SORBIDRAFT_10g030460          117   7e-29   
ref|XP_006659363.1|  PREDICTED: serine/arginine-rich splicing fac...    118   7e-29   
ref|XP_002304510.1|  hypothetical protein POPTR_0003s13030g             116   8e-29   Populus trichocarpa [western balsam poplar]
ref|XP_001757377.1|  predicted protein                                  114   9e-29   
ref|XP_003563264.1|  PREDICTED: serine/arginine-rich splicing fac...    117   1e-28   Brachypodium distachyon [annual false brome]
ref|XP_006586189.1|  PREDICTED: uncharacterized RNA-binding prote...    114   2e-28   
emb|CDY10270.1|  BnaC05g05130D                                          118   2e-28   Brassica napus [oilseed rape]
ref|XP_008779363.1|  PREDICTED: serine/arginine-rich splicing fac...    115   2e-28   Phoenix dactylifera
ref|XP_011022643.1|  PREDICTED: serine/arginine-rich splicing fac...    115   2e-28   Populus euphratica
ref|XP_006586014.1|  PREDICTED: transformer-2 protein homolog bet...    113   2e-28   
ref|XP_004973345.1|  PREDICTED: serine/arginine-rich splicing fac...    117   3e-28   Setaria italica
ref|XP_002892395.1|  hypothetical protein ARALYDRAFT_470756             118   3e-28   
gb|KDP25408.1|  hypothetical protein JCGZ_20564                         115   3e-28   Jatropha curcas
ref|XP_002444277.1|  hypothetical protein SORBIDRAFT_07g019390          114   3e-28   
gb|AFK40884.1|  unknown                                                 117   4e-28   Lotus japonicus
ref|XP_009118966.1|  PREDICTED: serine/arginine-rich splicing fac...    117   5e-28   
ref|XP_010055674.1|  PREDICTED: serine/arginine-rich splicing fac...    115   6e-28   Eucalyptus grandis [rose gum]
gb|AFW69545.1|  hypothetical protein ZEAMMB73_512754                    112   7e-28   
ref|XP_002963380.1|  hypothetical protein SELMODRAFT_80254              112   7e-28   
ref|XP_011082380.1|  PREDICTED: serine/arginine-rich splicing fac...    116   8e-28   Sesamum indicum [beniseed]
ref|XP_004966485.1|  PREDICTED: RNA-binding motif protein, X chro...    115   9e-28   Setaria italica
ref|XP_006417810.1|  hypothetical protein EUTSA_v10008061mg             116   9e-28   Eutrema salsugineum [saltwater cress]
ref|XP_002509834.1|  Arginine/serine-rich-splicing factor, putative     113   1e-27   Ricinus communis
ref|XP_009624179.1|  PREDICTED: serine/arginine-rich splicing fac...    116   1e-27   Nicotiana tomentosiformis
gb|AFW69542.1|  hypothetical protein ZEAMMB73_512754                    114   1e-27   
gb|AAK92735.1|  putative transformer-SR ribonucleoprotein               116   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CBI16010.3|  unnamed protein product                                113   1e-27   Vitis vinifera
ref|NP_563787.2|  serine/arginine rich-like protein SR45a               116   1e-27   Arabidopsis thaliana [mouse-ear cress]
emb|CBI34365.3|  unnamed protein product                                111   2e-27   Vitis vinifera
dbj|BAK07261.1|  predicted protein                                      111   2e-27   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006827527.1|  hypothetical protein AMTR_s00009p00202570          114   2e-27   
emb|CDP09143.1|  unnamed protein product                                115   2e-27   Coffea canephora [robusta coffee]
ref|XP_002974665.1|  hypothetical protein SELMODRAFT_102224             113   2e-27   
gb|EMS64978.1|  Scaffold attachment factor B2                           110   2e-27   Triticum urartu
ref|XP_006305290.1|  hypothetical protein CARUB_v10009665mg             114   3e-27   Capsella rubella
ref|XP_011460914.1|  PREDICTED: serine/arginine-rich splicing fac...    110   3e-27   Fragaria vesca subsp. vesca
gb|EMT02480.1|  Putative RNA-binding protein                            113   3e-27   
emb|CDY06701.1|  BnaA10g04800D                                          114   3e-27   
ref|XP_009392818.1|  PREDICTED: serine/arginine-rich splicing fac...    112   4e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006476526.1|  PREDICTED: uncharacterized RNA-binding prote...    110   4e-27   
ref|XP_008787412.1|  PREDICTED: serine/arginine-rich splicing fac...    112   4e-27   Phoenix dactylifera
gb|EYU38329.1|  hypothetical protein MIMGU_mgv1a013947mg                112   4e-27   Erythranthe guttata [common monkey flower]
ref|XP_009778762.1|  PREDICTED: serine/arginine-rich splicing fac...    114   5e-27   Nicotiana sylvestris
ref|XP_009778763.1|  PREDICTED: serine/arginine-rich splicing fac...    114   5e-27   Nicotiana sylvestris
ref|XP_010033040.1|  PREDICTED: serine/arginine-rich splicing fac...    109   6e-27   Eucalyptus grandis [rose gum]
ref|XP_011463909.1|  PREDICTED: serine/arginine-rich splicing fac...    111   7e-27   Fragaria vesca subsp. vesca
emb|CAN63579.1|  hypothetical protein VITISV_029585                     112   7e-27   Vitis vinifera
ref|XP_004298819.1|  PREDICTED: serine/arginine-rich splicing fac...    111   7e-27   Fragaria vesca subsp. vesca
ref|XP_009337333.1|  PREDICTED: serine/arginine-rich splicing fac...    114   8e-27   
ref|XP_009337331.1|  PREDICTED: serine/arginine-rich splicing fac...    114   8e-27   
ref|XP_008238932.1|  PREDICTED: uncharacterized RNA-binding prote...    111   9e-27   Prunus mume [ume]
ref|XP_008785439.1|  PREDICTED: serine/arginine-rich splicing fac...    114   9e-27   Phoenix dactylifera
ref|XP_007209603.1|  hypothetical protein PRUPE_ppa011480mg             111   1e-26   Prunus persica
ref|XP_009337332.1|  PREDICTED: serine/arginine-rich splicing fac...    114   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_008384864.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    114   1e-26   
ref|XP_009337328.1|  PREDICTED: serine/arginine-rich splicing fac...    114   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_008220282.1|  PREDICTED: serine/arginine repetitive matrix...    114   1e-26   Prunus mume [ume]
ref|NP_001149397.1|  transformer-2 protein                              112   1e-26   Zea mays [maize]
gb|AFW69546.1|  hypothetical protein ZEAMMB73_512754                    112   1e-26   
ref|XP_001752273.1|  predicted protein                                  107   1e-26   
ref|XP_010940583.1|  PREDICTED: serine/arginine-rich splicing fac...    110   1e-26   Elaeis guineensis
ref|XP_009375026.1|  PREDICTED: serine/arginine-rich splicing fac...    109   1e-26   Pyrus x bretschneideri [bai li]
ref|XP_008384865.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    113   1e-26   
ref|XP_008384862.1|  PREDICTED: pre-mRNA-splicing factor cwc22 is...    113   1e-26   
gb|AFK47423.1|  unknown                                                 113   1e-26   Medicago truncatula
ref|XP_010475492.1|  PREDICTED: serine/arginine-rich splicing fac...    112   1e-26   Camelina sativa [gold-of-pleasure]
ref|XP_007016195.1|  RNA-binding family protein isoform 2               108   1e-26   
ref|XP_010475491.1|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_010239167.1|  PREDICTED: serine/arginine-rich splicing fac...    110   2e-26   
ref|XP_010457908.1|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_006350816.1|  PREDICTED: serine/arginine repetitive matrix...    113   2e-26   Solanum tuberosum [potatoes]
ref|XP_010255285.1|  PREDICTED: serine/arginine-rich splicing fac...    110   2e-26   Nelumbo nucifera [Indian lotus]
gb|EMT21403.1|  Putative RNA-binding protein                            111   2e-26   
ref|XP_006649804.1|  PREDICTED: scaffold attachment factor B2-lik...    108   2e-26   
gb|AFW62088.1|  hypothetical protein ZEAMMB73_489339                    108   2e-26   
ref|XP_010457907.1|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   Camelina sativa [gold-of-pleasure]
ref|XP_002992560.1|  hypothetical protein SELMODRAFT_49595              106   2e-26   
ref|XP_002280779.2|  PREDICTED: serine/arginine-rich splicing fac...    112   2e-26   
gb|ADE75667.1|  unknown                                                 110   2e-26   Picea sitchensis
ref|XP_009375025.1|  PREDICTED: serine/arginine-rich splicing fac...    109   3e-26   
ref|XP_010685629.1|  PREDICTED: serine/arginine-rich splicing fac...    112   3e-26   Beta vulgaris subsp. vulgaris [field beet]
emb|CDP12048.1|  unnamed protein product                                111   3e-26   Coffea canephora [robusta coffee]
ref|XP_003530834.1|  PREDICTED: uncharacterized RNA-binding prote...    112   3e-26   Glycine max [soybeans]
ref|XP_002279684.1|  PREDICTED: serine/arginine-rich splicing fac...    109   3e-26   Vitis vinifera
ref|XP_006476525.1|  PREDICTED: uncharacterized RNA-binding prote...    109   3e-26   Citrus sinensis [apfelsine]
ref|XP_007146720.1|  hypothetical protein PHAVU_006G064000g             112   3e-26   Phaseolus vulgaris [French bean]
ref|XP_007040292.1|  RNA-binding family protein                         109   3e-26   Theobroma cacao [chocolate]
gb|AFW62092.1|  hypothetical protein ZEAMMB73_489339                    108   4e-26   
ref|XP_006476524.1|  PREDICTED: uncharacterized RNA-binding prote...    109   4e-26   Citrus sinensis [apfelsine]
ref|XP_002972503.1|  hypothetical protein SELMODRAFT_26372              106   5e-26   
ref|XP_010235085.1|  PREDICTED: serine/arginine-rich splicing fac...    110   6e-26   Brachypodium distachyon [annual false brome]
gb|EYU45746.1|  hypothetical protein MIMGU_mgv1a008547mg                111   7e-26   Erythranthe guttata [common monkey flower]
ref|XP_003563207.1|  PREDICTED: serine/arginine-rich splicing fac...    109   7e-26   Brachypodium distachyon [annual false brome]
ref|XP_002520437.1|  FUS-interacting serine-arginine-rich protein...    111   7e-26   Ricinus communis
ref|XP_003551321.1|  PREDICTED: pre-mRNA-splicing factor cwc22-like     111   7e-26   Glycine max [soybeans]
ref|XP_004241182.1|  PREDICTED: serine/arginine-rich splicing fac...    111   7e-26   Solanum lycopersicum
gb|KJB21247.1|  hypothetical protein B456_003G125000                    111   9e-26   Gossypium raimondii
gb|KHN06265.1|  Putative RNA-binding protein C25G10.01                  110   1e-25   Glycine soja [wild soybean]
ref|XP_002972807.1|  hypothetical protein SELMODRAFT_59634              105   1e-25   
ref|XP_010487367.1|  PREDICTED: serine/arginine-rich splicing fac...    110   1e-25   Camelina sativa [gold-of-pleasure]
dbj|BAJ89187.1|  predicted protein                                      106   1e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010487375.1|  PREDICTED: serine/arginine-rich splicing fac...    110   1e-25   Camelina sativa [gold-of-pleasure]
ref|XP_004294256.1|  PREDICTED: serine/arginine-rich splicing fac...    110   1e-25   Fragaria vesca subsp. vesca
ref|XP_009375024.1|  PREDICTED: serine/arginine-rich splicing fac...    108   1e-25   Pyrus x bretschneideri [bai li]
gb|AAF79558.1|AC022464_16  F22G5.31                                     110   1e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009375022.1|  PREDICTED: serine/arginine-rich splicing fac...    108   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_010923140.1|  PREDICTED: serine/arginine-rich splicing fac...    110   2e-25   Elaeis guineensis
ref|XP_006439504.1|  hypothetical protein CICLE_v10021507mg             107   2e-25   
ref|XP_006439508.1|  hypothetical protein CICLE_v10021507mg             107   2e-25   
gb|KDP46559.1|  hypothetical protein JCGZ_08531                         110   2e-25   Jatropha curcas
ref|XP_006439510.1|  hypothetical protein CICLE_v10021507mg             107   2e-25   
ref|XP_006439505.1|  hypothetical protein CICLE_v10021507mg             107   2e-25   
gb|ACF82503.1|  unknown                                                 108   3e-25   Zea mays [maize]
gb|AAY84876.1|  alternative splicing regulator                          107   3e-25   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001148693.1|  LOC100282309                                       108   4e-25   
gb|KHG02619.1|  Scaffold attachment factor B2                           107   4e-25   Gossypium arboreum [tree cotton]
ref|XP_010089074.1|  Uncharacterized RNA-binding protein                108   4e-25   
ref|NP_001049650.1|  Os03g0265600                                       104   4e-25   
dbj|BAJ99477.1|  predicted protein                                      107   5e-25   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KJB52108.1|  hypothetical protein B456_008G248300                    106   5e-25   Gossypium raimondii
gb|KCW52572.1|  hypothetical protein EUGRSUZ_J01947                     108   5e-25   Eucalyptus grandis [rose gum]
ref|XP_004500218.1|  PREDICTED: pre-mRNA-splicing factor cwc22-like     108   5e-25   Cicer arietinum [garbanzo]
ref|XP_006439507.1|  hypothetical protein CICLE_v10021507mg             107   5e-25   
ref|XP_004984684.1|  PREDICTED: serine/arginine repetitive matrix...    103   6e-25   
ref|XP_010935769.1|  PREDICTED: serine/arginine-rich splicing fac...    106   6e-25   Elaeis guineensis
ref|XP_006848090.1|  hypothetical protein AMTR_s00029p00209460          108   7e-25   
ref|XP_006439511.1|  hypothetical protein CICLE_v10021507mg             107   7e-25   
gb|KJB52106.1|  hypothetical protein B456_008G248300                    105   7e-25   Gossypium raimondii
gb|KDO76279.1|  hypothetical protein CISIN_1g028130mg                   105   9e-25   Citrus sinensis [apfelsine]
gb|KDO76280.1|  hypothetical protein CISIN_1g028130mg                   105   1e-24   Citrus sinensis [apfelsine]
gb|KDO66764.1|  hypothetical protein CISIN_1g016540mg                   107   1e-24   Citrus sinensis [apfelsine]
ref|XP_003536651.1|  PREDICTED: uncharacterized RNA-binding prote...    105   1e-24   Glycine max [soybeans]
ref|XP_007016194.1|  RNA-binding family protein isoform 1               107   2e-24   
ref|XP_007016197.1|  RNA-binding family protein isoform 4               107   2e-24   
ref|XP_010104693.1|  Uncharacterized RNA-binding protein                108   2e-24   
ref|XP_006425006.1|  hypothetical protein CICLE_v10028652mg             107   3e-24   Citrus clementina [clementine]
gb|KHF98970.1|  putative RNA-binding C25G10.01                          107   3e-24   Gossypium arboreum [tree cotton]
ref|XP_006649803.1|  PREDICTED: scaffold attachment factor B2-lik...    106   3e-24   Oryza brachyantha
ref|XP_011035209.1|  PREDICTED: serine/arginine-rich splicing fac...    102   4e-24   Populus euphratica
ref|XP_004145262.1|  PREDICTED: uncharacterized protein LOC101211183    105   6e-24   Cucumis sativus [cucumbers]
ref|XP_010256685.1|  PREDICTED: serine/arginine-rich splicing fac...    105   8e-24   Nelumbo nucifera [Indian lotus]
ref|XP_009380617.1|  PREDICTED: serine/arginine-rich splicing fac...    105   9e-24   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACN26118.1|  unknown                                                 105   9e-24   Zea mays [maize]
ref|XP_002314126.1|  transformer serine/arginine-rich ribonucleop...    105   9e-24   
ref|XP_009380616.1|  PREDICTED: serine/arginine-rich splicing fac...    105   1e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010676454.1|  PREDICTED: serine/arginine-rich splicing fac...    103   1e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011032165.1|  PREDICTED: serine/arginine-rich splicing fac...    104   2e-23   Populus euphratica
ref|XP_011032164.1|  PREDICTED: serine/arginine-rich splicing fac...    104   2e-23   Populus euphratica
ref|XP_011032161.1|  PREDICTED: serine/arginine-rich splicing fac...    104   2e-23   Populus euphratica
gb|EMT18238.1|  Scaffold attachment factor B2                           104   2e-23   
ref|XP_008457405.1|  PREDICTED: serine/arginine-rich splicing fac...    104   2e-23   Cucumis melo [Oriental melon]
ref|XP_004163746.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    103   3e-23   
ref|XP_004984682.1|  PREDICTED: serine/arginine repetitive matrix...    103   4e-23   
ref|XP_010262758.1|  PREDICTED: serine/arginine-rich splicing fac...    103   5e-23   Nelumbo nucifera [Indian lotus]
ref|XP_010262757.1|  PREDICTED: serine/arginine-rich splicing fac...    103   5e-23   Nelumbo nucifera [Indian lotus]
gb|KJB83722.1|  hypothetical protein B456_013G261000                    103   5e-23   Gossypium raimondii
ref|XP_004984683.1|  PREDICTED: serine/arginine repetitive matrix...    103   5e-23   Setaria italica
gb|AAP06839.1|  putative transformer serine/arginine-rich ribonuc...    102   8e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010228830.1|  PREDICTED: serine/arginine-rich splicing fac...    102   9e-23   Brachypodium distachyon [annual false brome]
gb|EAY89362.1|  hypothetical protein OsI_10866                          102   1e-22   Oryza sativa Indica Group [Indian rice]
gb|ABF95135.1|  RNA recognition motif family protein, expressed         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
gb|ABF95136.1|  RNA recognition motif family protein, expressed         102   1e-22   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011035207.1|  PREDICTED: serine/arginine-rich splicing fac...    102   1e-22   Populus euphratica
ref|XP_002299830.2|  hypothetical protein POPTR_0001s25520g             102   1e-22   
ref|XP_011035206.1|  PREDICTED: serine/arginine-rich splicing fac...    102   1e-22   
ref|XP_011035205.1|  PREDICTED: serine/arginine-rich splicing fac...    102   1e-22   
ref|XP_002984383.1|  hypothetical protein SELMODRAFT_49471            96.3    2e-22   
gb|EMS59082.1|  Uncharacterized RNA-binding protein C25G10.01           103   4e-22   
ref|XP_002298021.2|  hypothetical protein POPTR_0001s09650g           92.0    1e-20   
emb|CDY41631.1|  BnaC03g62530D                                        92.0    6e-19   
ref|XP_004336466.1|  RNA recognition motif domain containing protein  87.0    2e-17   
ref|XP_007762605.1|  RNA-binding domain-containing protein            82.4    1e-16   
gb|EMS20097.1|  transformer-SR ribonucleoprotein                      83.2    4e-16   
ref|XP_002473663.1|  predicted protein                                85.5    6e-16   
ref|XP_007850789.1|  hypothetical protein Moror_796                   81.6    7e-16   
gb|KDN43545.1|  RNA-binding domain-containing protein                 80.1    7e-16   
gb|ELU39394.1|  RNA recognition motif domain-containing protein       83.2    7e-16   
gb|KIP04932.1|  hypothetical protein PHLGIDRAFT_176971                80.5    1e-15   
gb|ESA17395.1|  hypothetical protein GLOINDRAFT_149806                80.1    1e-15   
emb|CCA73260.1|  related to Transformer-2 protein homolog             81.3    1e-15   
gb|KJA28346.1|  hypothetical protein HYPSUDRAFT_129369                78.6    2e-15   
gb|EPT03124.1|  hypothetical protein FOMPIDRAFT_1022487               81.3    2e-15   
ref|XP_008676182.1|  PREDICTED: LOW QUALITY PROTEIN: RNA binding ...  81.6    2e-15   
ref|XP_007364416.1|  RNA-binding domain-containing protein            81.3    2e-15   
dbj|GAA98830.1|  hypothetical protein E5Q_05518                       82.0    2e-15   
dbj|GAA98831.1|  hypothetical protein E5Q_05519                       82.0    3e-15   
ref|XP_009540671.1|  hypothetical protein HETIRDRAFT_308332           77.8    3e-15   
emb|CDS05949.1|  hypothetical protein LRAMOSA08477                    80.5    3e-15   
dbj|GAC74764.1|  hsp27-ere-tata-binding protein/Scaffold attachme...  80.5    3e-15   
gb|KDQ62974.1|  hypothetical protein JAAARDRAFT_188608                80.5    3e-15   
emb|CDO74157.1|  hypothetical protein BN946_scf185043.g208            79.7    4e-15   
ref|XP_007298101.1|  RNA-binding domain-containing protein            78.2    4e-15   
ref|XP_007862612.1|  RNA-binding domain-containing protein            80.1    5e-15   
gb|ETS62642.1|  hypothetical protein PaG_03286                        80.5    5e-15   
gb|EMD40972.1|  hypothetical protein CERSUDRAFT_111545                79.7    6e-15   
gb|KDN49090.1|  hypothetical protein RSAG8_02443                      79.3    6e-15   
gb|EMD32604.1|  hypothetical protein CERSUDRAFT_77305                 79.7    6e-15   
gb|EIE80732.1|  hypothetical protein RO3G_05437                       79.3    6e-15   
dbj|GAN05750.1|  conserved hypothetical protein                       79.3    8e-15   
ref|XP_002912240.1|  hypothetical protein CC1G_13772                  79.0    9e-15   
ref|XP_008035847.1|  RNA-binding domain-containing protein            78.6    9e-15   
gb|EXX80020.1|  Pub1p                                                 79.0    1e-14   
emb|CBQ71214.1|  related to Transformer-2 protein homolog             79.7    1e-14   
emb|CCF48487.1|  related to Transformer-2 protein homolog             79.7    1e-14   
gb|KIJ53709.1|  hypothetical protein M422DRAFT_155027                 78.2    1e-14   
gb|KDE04808.1|  hypothetical protein MVLG_04772                       79.0    1e-14   
gb|KIN94444.1|  hypothetical protein M404DRAFT_1008347                78.6    1e-14   
gb|EST05979.1|  hypothetical protein PSEUBRA_SCAF4g05113              79.3    2e-14   
gb|KDQ15586.1|  hypothetical protein BOTBODRAFT_108308                75.9    2e-14   
ref|XP_003026365.1|  hypothetical protein SCHCODRAFT_30182            75.1    2e-14   
gb|KIM35628.1|  hypothetical protein M413DRAFT_347217                 77.4    3e-14   
emb|CCI41219.1|  unnamed protein product                              79.3    3e-14   
gb|KDQ08825.1|  hypothetical protein BOTBODRAFT_555164                77.4    3e-14   
gb|AFR92532.2|  transformer-2-beta isoform 3                          77.8    4e-14   
ref|XP_007402728.1|  hypothetical protein PHACADRAFT_266187           77.0    4e-14   
gb|KIK94391.1|  hypothetical protein PAXRUDRAFT_33541                 77.0    5e-14   
gb|KIL71231.1|  hypothetical protein M378DRAFT_206494                 76.6    5e-14   
ref|XP_002997732.1|  conserved hypothetical protein                   76.6    5e-14   
gb|KDQ31587.1|  hypothetical protein PLEOSDRAFT_173268                76.6    6e-14   
emb|CEP17746.1|  hypothetical protein                                 76.6    6e-14   
gb|KDQ65030.1|  hypothetical protein JAAARDRAFT_43836                 76.6    8e-14   
emb|CCO29814.1|  putative RNA-binding protein C25G10,01               76.3    8e-14   
gb|KDE02910.1|  hypothetical protein MVLG_06570                       76.3    8e-14   
ref|XP_007392122.1|  hypothetical protein PHACADRAFT_250155           76.3    9e-14   
gb|EPB85733.1|  hypothetical protein HMPREF1544_07484                 76.3    9e-14   
gb|KIO26603.1|  hypothetical protein M407DRAFT_243694                 76.3    1e-13   
ref|XP_007843149.1|  hypothetical protein Moror_17576                 75.9    1e-13   
gb|EPS97798.1|  hypothetical protein FOMPIDRAFT_1127661               75.9    1e-13   
emb|CEL56126.1|  putative RNA-binding protein C25G10,01 OS=Schizo...  75.9    1e-13   
emb|CEI93424.1|  Putative RNA-binding domain-containing protein       75.5    1e-13   
ref|XP_007313119.1|  hypothetical protein SERLADRAFT_412645           75.9    1e-13   
ref|XP_009514980.1|  hypothetical protein PHYSODRAFT_472294           73.9    2e-13   
emb|CCA16496.1|  conserved hypothetical protein                       74.3    3e-13   
ref|XP_566727.1|  transformer-2-beta isoform 3                        74.7    3e-13   
gb|KIM62355.1|  hypothetical protein SCLCIDRAFT_119741                72.0    4e-13   
gb|KIK39484.1|  hypothetical protein CY34DRAFT_808222                 74.3    4e-13   
gb|EUC56720.1|  RNA recognition motif, putative                       73.9    4e-13   
gb|KJA16107.1|  hypothetical protein HYPSUDRAFT_71627                 74.7    4e-13   
gb|KIR31557.1|  transformer-2-beta isoform 3                          74.3    4e-13   
gb|KIM31734.1|  hypothetical protein M408DRAFT_327184                 73.9    5e-13   
gb|KIP09820.1|  hypothetical protein PHLGIDRAFT_11672                 74.3    5e-13   
gb|KIJ13812.1|  hypothetical protein PAXINDRAFT_170126                74.3    5e-13   
gb|KGB75667.1|  transformer-2-beta isoform 3                          74.3    5e-13   
dbj|GAC98552.1|  hypothetical protein PHSY_006146                     74.3    5e-13   
ref|XP_008032928.1|  hypothetical protein TRAVEDRAFT_108807           72.4    6e-13   
gb|KIR86800.1|  transformer-2-beta isoform 3                          73.6    6e-13   
gb|KDN40836.1|  hypothetical protein RSAG8_07854                      73.9    6e-13   
ref|XP_007856967.1|  hypothetical protein Moror_2102                  73.9    6e-13   
ref|XP_007305599.1|  RNA-binding domain-containing protein            73.6    7e-13   
gb|KIY62377.1|  RNA-binding domain-containing protein                 73.6    7e-13   
gb|KDR85886.1|  hypothetical protein GALMADRAFT_51853                 71.6    7e-13   
ref|XP_008338008.1|  PREDICTED: uncharacterized RNA-binding prote...  73.2    7e-13   
gb|KIR29731.1|  hypothetical protein I309_01216                       73.6    8e-13   
gb|KGB74799.1|  hypothetical protein CNBG_0637                        73.6    8e-13   
ref|XP_777899.1|  hypothetical protein CNBA3680                       73.6    8e-13   
gb|EJT46854.1|  hypothetical protein A1Q1_04405                       75.1    9e-13   
gb|KIM25233.1|  hypothetical protein M408DRAFT_331335                 73.9    9e-13   
ref|XP_570425.1|  hypothetical protein                                73.2    9e-13   
ref|XP_006460387.1|  hypothetical protein AGABI2DRAFT_192114          73.2    1e-12   
emb|CCO26540.1|  Transformer-2 protein homolog beta Short=TRA-2 beta  73.2    1e-12   
ref|XP_003191351.1|  transformer-2-beta isoform 3                     73.2    1e-12   
gb|KIR79837.1|  transformer-2-beta isoform 3                          72.8    1e-12   
gb|KDQ28892.1|  hypothetical protein PLEOSDRAFT_1075764               72.4    1e-12   
gb|EKD03814.1|  RRM protein                                           74.7    1e-12   
gb|KIR51025.1|  transformer-2-beta isoform 3                          72.8    1e-12   
ref|XP_007315263.1|  hypothetical protein SERLADRAFT_434943           73.2    1e-12   
gb|KFH65433.1|  hypothetical protein MVEG_08911                       72.8    1e-12   
ref|XP_007214333.1|  hypothetical protein PRUPE_ppb022899mg           72.8    1e-12   
ref|XP_778234.1|  hypothetical protein CNBA2340                       73.2    1e-12   
ref|XP_009543934.1|  hypothetical protein HETIRDRAFT_312140           72.4    1e-12   
gb|KIJ37430.1|  hypothetical protein M422DRAFT_60986                  72.8    1e-12   
ref|XP_003193552.1|  hypothetical protein CGB_D4310W                  72.8    1e-12   
gb|KIR49974.1|  hypothetical protein I312_01068                       72.8    2e-12   
ref|XP_007337845.1|  RNA-binding domain-containing protein            72.8    2e-12   
gb|AGV14344.1|  hypothetical protein, variant                         72.4    2e-12   
gb|KIL67231.1|  hypothetical protein M378DRAFT_185717                 72.4    2e-12   
gb|KFH71731.1|  hypothetical protein MVEG_02026                       72.0    2e-12   
gb|AFR95086.1|  hypothetical protein CNAG_01060                       72.0    2e-12   
gb|KIM42787.1|  hypothetical protein M413DRAFT_18510                  71.6    2e-12   
gb|KII96055.1|  hypothetical protein PLICRDRAFT_130236                72.4    2e-12   
ref|XP_008907232.1|  hypothetical protein, variant 2                  72.0    3e-12   
ref|XP_006453853.1|  hypothetical protein AGABI2DRAFT_189205          72.0    3e-12   
gb|KIR89480.1|  hypothetical protein I308_00487                       72.0    3e-12   
ref|XP_007325962.1|  hypothetical protein AGABI1DRAFT_110889          72.0    3e-12   
gb|KIK42846.1|  hypothetical protein CY34DRAFT_751619                 72.0    3e-12   
gb|KEP52728.1|  transformer-2 protein-like alpha (TRA-2 alpha)-li...  71.6    3e-12   
gb|KIY45966.1|  RNA-binding domain-containing protein                 71.2    3e-12   
ref|XP_007847123.1|  transformer-2-beta isoform 3                     72.0    3e-12   
gb|KIY71752.1|  RNA-binding domain-containing protein                 72.0    3e-12   
ref|XP_008907230.1|  hypothetical protein PPTG_13366                  71.6    3e-12   
gb|EUC57683.1|  transformer-2 protein-like alpha (TRA-2 alpha)-li...  71.6    3e-12   
gb|KIO03113.1|  hypothetical protein M404DRAFT_634079                 71.6    4e-12   
gb|KIJ66598.1|  hypothetical protein HYDPIDRAFT_26934                 71.2    4e-12   
ref|XP_566635.1|  hypothetical protein CNA02490                       72.0    4e-12   
gb|KIR48578.1|  transformer-2-beta isoform 3                          71.2    4e-12   
gb|KIR33818.1|  transformer-2 protein                                 71.6    4e-12   
gb|KIR40632.1|  transformer-2 protein                                 71.6    4e-12   
gb|KGB74473.1|  transformer-2 sex-determining protein                 71.6    4e-12   
gb|ETW49197.1|  hypothetical protein PFMALIP_02700                    69.7    5e-12   
ref|XP_006959286.1|  RNA-binding domain-containing protein            71.2    5e-12   
ref|XP_008907233.1|  hypothetical protein, variant 3                  70.9    5e-12   
gb|KIR25761.1|  transformer-2 protein                                 71.2    6e-12   
ref|XP_011388843.1|  hypothetical protein UMAG_10162                  72.0    6e-12   
ref|XP_008907231.1|  hypothetical protein, variant 1                  70.9    6e-12   
dbj|GAK65123.1|  RNA-binding domain-containing protein                72.0    6e-12   
gb|KIL00481.1|  hypothetical protein PAXRUDRAFT_29810                 71.6    6e-12   
gb|KEP52585.1|  putative RNA recognition motif                        70.9    7e-12   
emb|CCA75325.1|  related to Transformer-2 protein                     70.1    7e-12   
gb|KIJ04716.1|  hypothetical protein PAXINDRAFT_183077                71.6    8e-12   
ref|XP_010278696.1|  PREDICTED: serine/arginine repetitive matrix...  70.9    8e-12   
ref|XP_003321679.1|  hypothetical protein PGTG_03216                  70.1    8e-12   
emb|CCA16044.1|  conserved hypothetical protein                       70.5    8e-12   
gb|ADE10071.1|  RRM                                                   71.2    9e-12   
ref|XP_007268255.1|  RNA-binding domain-containing protein            70.5    9e-12   
gb|KIK69743.1|  hypothetical protein GYMLUDRAFT_520951                70.1    1e-11   
gb|KIR55708.1|  transformer-2 protein                                 70.9    1e-11   
ref|XP_003192495.1|  hypothetical protein CGB_B2920W                  70.5    1e-11   
ref|XP_008365101.1|  PREDICTED: serine/arginine repetitive matrix...  72.0    1e-11   
gb|KIR50326.1|  transformer-2 protein                                 70.5    1e-11   
ref|XP_003036928.1|  hypothetical protein SCHCODRAFT_63824            70.1    1e-11   
gb|KIM83960.1|  hypothetical protein PILCRDRAFT_818992                70.5    1e-11   
gb|KIR67305.1|  transformer-2 protein                                 70.5    1e-11   
gb|KIK65688.1|  hypothetical protein GYMLUDRAFT_158917                69.7    1e-11   
gb|KIR87751.1|  transformer-2 protein                                 70.5    1e-11   
emb|CDO73389.1|  hypothetical protein BN946_scf185013.g23             69.7    1e-11   
ref|XP_007767617.1|  RNA-binding domain-containing protein            70.5    1e-11   
ref|XP_007854065.1|  hypothetical protein Moror_9723                  69.7    1e-11   
gb|KIJ70377.1|  hypothetical protein HYDPIDRAFT_77833                 69.3    2e-11   
gb|KIK65265.1|  hypothetical protein GYMLUDRAFT_39624                 69.7    2e-11   
gb|KIK00746.1|  hypothetical protein K443DRAFT_596114                 69.3    2e-11   
gb|KDR74388.1|  hypothetical protein GALMADRAFT_141433                70.5    2e-11   
emb|CEL56094.1|  putative RNA-binding protein C25G10,01 OS=Schizo...  69.7    2e-11   
gb|AFR92393.2|  transformer-2 protein                                 69.7    2e-11   
dbj|BAJ92808.1|  predicted protein                                    70.1    2e-11   
ref|XP_007359859.1|  hypothetical protein DICSQDRAFT_46822            67.4    2e-11   
ref|XP_001699108.1|  nuclear SR-like RNA binding protein              68.6    3e-11   
ref|XP_008365088.1|  PREDICTED: serine/arginine repetitive matrix...  70.9    3e-11   
ref|XP_007000902.1|  hypothetical protein TREMEDRAFT_37437            68.9    3e-11   
dbj|BAE28146.1|  unnamed protein product                              71.2    3e-11   
ref|XP_007877230.1|  hypothetical protein PFL1_01529                  69.7    3e-11   
gb|EGO01519.1|  hypothetical protein SERLA73DRAFT_120183              68.2    4e-11   
ref|XP_001732525.1|  hypothetical protein MGL_0300                    70.5    4e-11   
ref|XP_003324121.2|  hypothetical protein PGTG_06023                  69.3    4e-11   
ref|XP_009360988.1|  PREDICTED: serine/arginine-rich splicing fac...  70.5    4e-11   
emb|CCI48968.1|  unnamed protein product                              71.2    4e-11   
dbj|BAD32176.1|  mKIAA0138 protein                                    70.9    4e-11   
gb|KIK61782.1|  hypothetical protein GYMLUDRAFT_260799                68.6    4e-11   
dbj|GAA97500.1|  hypothetical protein E5Q_04178                       68.9    4e-11   
ref|XP_010276089.1|  PREDICTED: pre-mRNA-splicing factor CWC21-li...  70.1    4e-11   
ref|XP_007003211.1|  hypothetical protein TREMEDRAFT_28739            67.4    5e-11   
ref|XP_003889826.1|  hypothetical protein, variant                    67.8    5e-11   
gb|KEI41945.1|  hypothetical protein L969DRAFT_42659                  68.6    5e-11   
ref|XP_001884298.1|  predicted protein                                67.8    5e-11   
ref|XP_010923906.1|  PREDICTED: serine/arginine repetitive matrix...  70.1    5e-11   
ref|XP_004655039.1|  PREDICTED: scaffold attachment factor B2         70.9    5e-11   
ref|XP_010923908.1|  PREDICTED: serine/arginine repetitive matrix...  70.1    6e-11   
gb|KIK07698.1|  hypothetical protein K443DRAFT_170086                 68.6    7e-11   
gb|EGV93725.1|  Scaffold attachment factor B2                         70.9    7e-11   
ref|XP_003327294.2|  hypothetical protein PGTG_09843                  67.8    8e-11   
gb|ERE72782.1|  scaffold attachment factor B2                         70.5    8e-11   
gb|EEE54573.1|  hypothetical protein OsJ_01776                        70.5    8e-11   
ref|XP_007489010.1|  PREDICTED: scaffold attachment factor B2 iso...  70.5    8e-11   
ref|XP_007489009.1|  PREDICTED: scaffold attachment factor B2 iso...  70.5    8e-11   
gb|AAH28827.1|  Safb2 protein                                         70.1    9e-11   
gb|EEC70652.1|  hypothetical protein OsI_01937                        68.9    9e-11   
ref|XP_007489008.1|  PREDICTED: scaffold attachment factor B2 iso...  70.1    9e-11   
ref|XP_007489007.1|  PREDICTED: scaffold attachment factor B2 iso...  70.1    9e-11   
ref|XP_005884444.1|  PREDICTED: scaffold attachment factor B2         70.1    1e-10   
ref|XP_007489011.1|  PREDICTED: scaffold attachment factor B2 iso...  70.1    1e-10   
gb|EPQ19023.1|  Scaffold attachment factor B2                         70.1    1e-10   
ref|XP_006982319.1|  PREDICTED: scaffold attachment factor B2 iso...  70.1    1e-10   
ref|XP_748983.1|  transformer-SR ribonucleoprotein                    68.2    1e-10   
ref|XP_003760664.1|  PREDICTED: scaffold attachment factor B2         70.1    1e-10   
gb|ELK29841.1|  Scaffold attachment factor B2                         70.1    1e-10   
ref|XP_006982320.1|  PREDICTED: scaffold attachment factor B2 iso...  70.1    1e-10   
ref|XP_007407078.1|  hypothetical protein MELLADRAFT_42536            67.8    1e-10   
ref|XP_006764324.1|  PREDICTED: scaffold attachment factor B2         69.7    1e-10   
gb|KDP39131.1|  hypothetical protein JCGZ_00888                       69.3    1e-10   
ref|XP_006101151.1|  PREDICTED: scaffold attachment factor B2         70.1    1e-10   
ref|XP_008812624.1|  PREDICTED: serine/arginine repetitive matrix...  69.3    1e-10   
ref|XP_007410602.1|  hypothetical protein MELLADRAFT_31155            64.7    1e-10   
ref|WP_042725052.1|  RNA-binding protein                              66.2    1e-10   
gb|ERE72784.1|  scaffold attachment factor B2                         69.7    1e-10   
ref|XP_008226903.1|  PREDICTED: uncharacterized protein C2orf16-l...  68.9    1e-10   



>emb|CAA70700.1| transformer-SR ribonucleoprotein [Nicotiana tabacum]
Length=235

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKVKSVFLVVEPRSR+SRGFAF+TMD+ +DANR
Sbjct  63   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLEDANR  122

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  123  CIKHLNQSVLEGRYITVEKS  142



>emb|CDP01837.1| unnamed protein product [Coffea canephora]
Length=224

 Score =   154 bits (388),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/79 (90%), Positives = 78/79 (99%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAF+TMD+A+DANR
Sbjct  125  NSGNTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFITMDSAEDANR  184

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+KHLNQS+LEGRYITVE+
Sbjct  185  CIKHLNQSILEGRYITVER  203



>gb|AIX10950.1| transformer-2 protein-like alpha-like protein [Gardenia jasminoides]
Length=237

 Score =   154 bits (388),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G TLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAF+TMDN +DANR
Sbjct  67   NSGSTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFITMDNVEDANR  126

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQS+LEGRYITVE+S
Sbjct  127  CIKHLNQSILEGRYITVERS  146



>ref|XP_011079075.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Sesamum 
indicum]
Length=232

 Score =   153 bits (386),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 78/80 (98%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSR+SRGFAF+TMD  +DANR
Sbjct  62   NPGNTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRISRGFAFITMDCLEDANR  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  122  CIKHLNQSVLEGRYITVERS  141



>ref|XP_004135013.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like, 
partial [Cucumis sativus]
Length=238

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN DDANR
Sbjct  56   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDANR  115

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVKHLNQS+LEGRYITVEKS
Sbjct  116  CVKHLNQSILEGRYITVEKS  135



>ref|XP_004158852.1| PREDICTED: uncharacterized LOC101219220 [Cucumis sativus]
 gb|KGN48961.1| hypothetical protein Csa_6G507340 [Cucumis sativus]
Length=244

 Score =   152 bits (385),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN DDANR
Sbjct  62   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDANR  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVKHLNQS+LEGRYITVEKS
Sbjct  122  CVKHLNQSILEGRYITVEKS  141



>gb|EYU30367.1| hypothetical protein MIMGU_mgv1a012795mg [Erythranthe guttata]
Length=172

 Score =   150 bits (379),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTR TERDLEDHFSKEGKVKSVFLVVEPR+R+SRGFAFVTM+  +DANR
Sbjct  62   NPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVEDANR  121

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+KHLNQSVLEGRYITVE+
Sbjct  122  CIKHLNQSVLEGRYITVER  140



>gb|EPS65363.1| hypothetical protein M569_09415 [Genlisea aurea]
Length=198

 Score =   151 bits (381),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 69/79 (87%), Positives = 77/79 (97%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSR+SRGFAF+TM++ +DANR
Sbjct  99   NPGNGLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRISRGFAFITMESVEDANR  158

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+KHLNQSVLEGRYITVE+
Sbjct  159  CIKHLNQSVLEGRYITVER  177



>ref|XP_009788034.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Nicotiana sylvestris]
Length=231

 Score =   151 bits (381),  Expect = 6e-42, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKVKSVFLVVEPRSR+SRGFAF+TMD+ +DANR
Sbjct  54   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLEDANR  113

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  114  CIKNLNQSVLEGRYITVEKS  133



>ref|XP_009788035.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Nicotiana sylvestris]
Length=218

 Score =   150 bits (380),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKVKSVFLVVEPRSR+SRGFAF+TMD+ +DANR
Sbjct  54   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSVFLVVEPRSRISRGFAFITMDSLEDANR  113

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  114  CIKNLNQSVLEGRYITVEKS  133



>ref|XP_011022229.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Populus 
euphratica]
Length=236

 Score =   150 bits (380),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/80 (90%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN DDANR
Sbjct  68   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDANR  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  128  CVKYLNQSVLEGRYITVEKS  147



>gb|KDP43705.1| hypothetical protein JCGZ_22332 [Jatropha curcas]
Length=227

 Score =   150 bits (378),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN + ANR
Sbjct  66   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVEAANR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVKHLNQSVLEGRYITVEKS
Sbjct  126  CVKHLNQSVLEGRYITVEKS  145



>ref|XP_008440881.1| PREDICTED: LOW QUALITY PROTEIN: ankyrin repeat domain-containing 
protein, chloroplastic [Cucumis melo]
Length=663

 Score =   156 bits (395),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/80 (93%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLEDHFSKEGKV S FLVVEPR+R+SRGFAFVTMDN DDANR
Sbjct  62   NPGNTLYVTGLSTRVTERDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDDANR  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVKHLNQSVLEGRYITVEKS
Sbjct  122  CVKHLNQSVLEGRYITVEKS  141



>gb|EYU30368.1| hypothetical protein MIMGU_mgv1a012795mg [Erythranthe guttata]
Length=239

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTR TERDLEDHFSKEGKVKSVFLVVEPR+R+SRGFAFVTM+  +DANR
Sbjct  62   NPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVEDANR  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  122  CIKHLNQSVLEGRYITVERS  141



>ref|XP_006383019.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
 gb|ERP60816.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
Length=223

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN D ANR
Sbjct  55   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDGANR  114

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  115  CVKYLNQSVLEGRYITVEKS  134



>gb|EYU29909.1| hypothetical protein MIMGU_mgv1a025336mg [Erythranthe guttata]
Length=244

 Score =   149 bits (376),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/80 (88%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTR TERDLEDHFSKEGKVKSVFLVVEPR+R+SRGFAFVTM+  +DANR
Sbjct  62   NPGITLYVTGLSTRATERDLEDHFSKEGKVKSVFLVVEPRTRISRGFAFVTMETVEDANR  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  122  CIKHLNQSVLEGRYITVERS  141



>ref|XP_009623497.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Nicotiana tomentosiformis]
Length=702

 Score =   155 bits (392),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 79/80 (99%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKVKS+FLVVEPRSR+SRGFAF+TMD+ +DANR
Sbjct  52   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVKSIFLVVEPRSRISRGFAFITMDSLEDANR  111

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  112  CIKHLNQSVLEGRYITVEKS  131



>ref|XP_006343342.1| PREDICTED: transformer-2 protein homolog alpha-like [Solanum 
tuberosum]
Length=241

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT+RDLE+HFSKEGKVKS FLVVEPRSR+SRGFAF+TMD+ +DA+R
Sbjct  59   NPGATLYVTGLSTRVTQRDLEEHFSKEGKVKSAFLVVEPRSRISRGFAFITMDSLEDADR  118

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  119  CIKHLNQSVLEGRYITVEKS  138



>ref|XP_006383020.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
 gb|ERP60817.1| hypothetical protein POPTR_0005s10780g [Populus trichocarpa]
Length=236

 Score =   148 bits (373),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/80 (89%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN D ANR
Sbjct  68   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDNVDGANR  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  128  CVKYLNQSVLEGRYITVEKS  147



>ref|NP_001238379.1| uncharacterized protein LOC100499944 [Glycine max]
 gb|ACU14296.1| unknown [Glycine max]
Length=164

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTM++A+DA R
Sbjct  68   NPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYIT+E++
Sbjct  128  CIKYLNQSVLEGRYITIERN  147



>ref|XP_004232529.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Solanum 
lycopersicum]
Length=228

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVT+RDLE+HFSKEGKVKS FLVVEPRSR+SRGFAF+TMD+ +DANR
Sbjct  50   NPGNTLYVTGLSSRVTQRDLEEHFSKEGKVKSAFLVVEPRSRISRGFAFITMDSLEDANR  109

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGR ITVEKS
Sbjct  110  CIKHLNQSVLEGRSITVEKS  129



>gb|KEH27602.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=236

 Score =   145 bits (367),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  273  GDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANRCV  452
            GDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD A+DANRC+
Sbjct  130  GDTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDTAEDANRCI  189

Query  453  KHLNQSVLEGRYITVEKS  506
            K+LNQS+LEGRYITVE++
Sbjct  190  KYLNQSILEGRYITVERN  207



>gb|KEH27603.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=213

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 65/77 (84%), Positives = 74/77 (96%), Gaps = 0/77 (0%)
 Frame = +3

Query  273  GDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANRCV  452
            GDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD A+DANRC+
Sbjct  130  GDTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDTAEDANRCI  189

Query  453  KHLNQSVLEGRYITVEK  503
            K+LNQS+LEGRYITVE+
Sbjct  190  KYLNQSILEGRYITVER  206



>ref|XP_010033540.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Eucalyptus 
grandis]
 gb|KCW53228.1| hypothetical protein EUGRSUZ_J02495 [Eucalyptus grandis]
Length=236

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/80 (85%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTERDLEDHFSKEGKV S FLVVEPR+R+SRGFAF+TM+  +DANR
Sbjct  61   NPGNALYVTGLSTRVTERDLEDHFSKEGKVASCFLVVEPRTRISRGFAFITMETVEDANR  120

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  121  CVKYLNQSVLEGRYITVEKS  140



>ref|XP_002530643.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
 gb|EEF31751.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
Length=248

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTER LE+HF+KEGKV S FLVVEPR+R+SRGFAFVTMDN +DANR
Sbjct  71   NPGNTLYVTGLSTRVTERGLEEHFAKEGKVASCFLVVEPRTRISRGFAFVTMDNVEDANR  130

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  131  CVKYLNQSVLEGRYITVEKS  150



>ref|XP_006425349.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38589.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=148

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/79 (84%), Positives = 74/79 (94%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  128  CIKYLNQSVLEGRYITVER  146



>ref|XP_006425346.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 ref|XP_006425347.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38586.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38587.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=166

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE++
Sbjct  128  CIKYLNQSVLEGRYITVERN  147



>ref|NP_001238605.1| uncharacterized protein LOC100527350 [Glycine max]
 gb|ACU16425.1| unknown [Glycine max]
Length=174

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G TLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAF+TMD  +DANR
Sbjct  66   NAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVEDANR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE++
Sbjct  126  CIKYLNQSVLEGRYITVERN  145



>gb|KJB17552.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
 gb|KJB17556.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
Length=175

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  66   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGRYITVE++
Sbjct  126  CIKYLNQSILEGRYITVERN  145



>ref|NP_001237888.1| uncharacterized protein LOC100500170 [Glycine max]
 gb|ACU15118.1| unknown [Glycine max]
Length=238

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTM++A+DA R
Sbjct  68   NPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYIT+E+S
Sbjct  128  CIKYLNQSVLEGRYITIERS  147



>emb|CBI24453.3| unnamed protein product [Vitis vinifera]
Length=260

 Score =   144 bits (364),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTER LEDHFS+EGKV S FLV+EPR+R+SRGFAFVTM+  +DANR
Sbjct  88   NPGNTLYVTGLSTRVTERALEDHFSREGKVASCFLVMEPRTRISRGFAFVTMETVEDANR  147

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  148  CIKHLNQSVLEGRYITVEKS  167



>gb|KHN35554.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=240

 Score =   144 bits (363),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTM++A+DA R
Sbjct  68   NPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYIT+E+S
Sbjct  128  CIKYLNQSVLEGRYITIERS  147



>gb|KJB17554.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
Length=155

 Score =   141 bits (355),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  66   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  125

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQS+LEGRYITVE+
Sbjct  126  CIKYLNQSILEGRYITVER  144



>gb|KDO71363.1| hypothetical protein CISIN_1g026421mg [Citrus sinensis]
Length=187

 Score =   142 bits (357),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  17   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDGVEDAER  76

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  77   CIKYLNQSVLEGRYITVERS  96



>ref|XP_010918157.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Elaeis guineensis]
Length=237

 Score =   143 bits (360),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLE HFSKEGKVK  FLVVEPR+RVSRGFAFVTMD  +DA+R
Sbjct  44   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMDTVEDADR  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  104  CVKYLNQSVLEGRYITVEKS  123



>ref|XP_010918156.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Elaeis guineensis]
Length=246

 Score =   143 bits (361),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLE HFSKEGKVK  FLVVEPR+RVSRGFAFVTMD  +DA+R
Sbjct  53   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMDTVEDADR  112

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  113  CVKYLNQSVLEGRYITVEKS  132



>gb|KJB17555.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
Length=163

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 75/79 (95%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  66   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  125

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQS+LEGRYITVE+
Sbjct  126  CIKYLNQSILEGRYITVER  144



>ref|XP_003612260.1| Scaffold attachment factor B1 [Medicago truncatula]
 gb|AES95218.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=303

 Score =   144 bits (364),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 75/78 (96%), Gaps = 0/78 (0%)
 Frame = +3

Query  273  GDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANRCV  452
            GDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD A+DANRC+
Sbjct  130  GDTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDTAEDANRCI  189

Query  453  KHLNQSVLEGRYITVEKS  506
            K+LNQS+LEGRYITVE+S
Sbjct  190  KYLNQSILEGRYITVERS  207



>gb|KHG21989.1| Scaffold attachment factor B2 [Gossypium arboreum]
Length=175

 Score =   141 bits (355),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  66   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGR+ITVE++
Sbjct  126  CIKYLNQSILEGRFITVERN  145



>gb|AFK45871.1| unknown [Medicago truncatula]
Length=270

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVT+RDLEDHFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  59   NPGNTLYVTGLSSRVTDRDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSHEDAER  118

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  119  CIKHLNQSVLEGRYITVERS  138



>ref|XP_003629227.1| ELAV-like protein [Medicago truncatula]
 gb|AET03703.1| RNA recognition motif [Medicago truncatula]
Length=270

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVT+RDLEDHFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  59   NPGNTLYVTGLSSRVTDRDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSHEDAER  118

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  119  CIKHLNQSVLEGRYITVERS  138



>gb|KJB17557.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
Length=213

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  54   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  113

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGRYITVE+S
Sbjct  114  CIKYLNQSILEGRYITVERS  133



>ref|XP_006425350.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38590.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=236

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>ref|XP_006425348.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
 gb|ESR38588.1| hypothetical protein CICLE_v10026375mg [Citrus clementina]
Length=238

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>gb|KJB17553.1| hypothetical protein B456_003G005400 [Gossypium raimondii]
Length=225

 Score =   142 bits (357),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA+R
Sbjct  66   NPGNTLYVTGLSQRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDASR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGRYITVE+S
Sbjct  126  CIKYLNQSILEGRYITVERS  145



>ref|XP_006467033.1| PREDICTED: transformer-2 protein homolog beta-like [Citrus sinensis]
Length=238

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>gb|KDO71362.1| hypothetical protein CISIN_1g026421mg [Citrus sinensis]
Length=238

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE HFSKEGKV S FLVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  68   NPGNTLYVTGLSTRVTERDLEKHFSKEGKVASCFLVVEPRTRISRGFAFVTMDGVEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>gb|KHN00439.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=310

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 77/80 (96%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTM++A+DA R
Sbjct  117  NPGDTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFVTMESAEDAER  176

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE++
Sbjct  177  CIKYLNQSVLEGRYITVERN  196



>ref|XP_007202500.1| hypothetical protein PRUPE_ppa010685mg [Prunus persica]
 gb|EMJ03699.1| hypothetical protein PRUPE_ppa010685mg [Prunus persica]
Length=240

 Score =   141 bits (356),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  64   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  123

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  124  CIKHLNQSVLEGRYITVERS  143



>ref|XP_007157858.1| hypothetical protein PHAVU_002G104100g [Phaseolus vulgaris]
 gb|ESW29852.1| hypothetical protein PHAVU_002G104100g [Phaseolus vulgaris]
Length=285

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G TLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAF+TMDN +DANR
Sbjct  105  NSGTTLYVTGLSSRVTERDLEEHFSKEGKVSSCFLVVEPRTRISRGFAFITMDNVEDANR  164

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  165  CIKYLNQSVLEGRYITVERS  184



>ref|XP_006409259.1| hypothetical protein EUTSA_v10022831mg [Eutrema salsugineum]
 gb|ESQ50712.1| hypothetical protein EUTSA_v10022831mg [Eutrema salsugineum]
Length=235

 Score =   140 bits (354),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTER+LE HFSKEGKV S FLVVEPR+RVSRGFAFVTMD+ +DA+R
Sbjct  68   NPGNTLYVTGLSTRVTERELETHFSKEGKVASCFLVVEPRTRVSRGFAFVTMDSYEDADR  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>ref|XP_008393698.1| PREDICTED: transformer-2 protein homolog beta isoform X1 [Malus 
domestica]
Length=244

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAFVTMD+ +DA R
Sbjct  67   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDAER  126

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  127  CIKHLNQSVLEGRYITVERS  146



>ref|XP_009344819.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Pyrus x bretschneideri]
Length=246

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAFVTMD+ +DA R
Sbjct  67   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDAER  126

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  127  CIKHLNQSVLEGRYITVERS  146



>ref|XP_008393706.1| PREDICTED: transformer-2 protein homolog beta isoform X2 [Malus 
domestica]
Length=242

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAFVTMD+ +DA R
Sbjct  65   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDAER  124

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  125  CIKHLNQSVLEGRYITVERS  144



>ref|XP_009344818.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Pyrus x bretschneideri]
Length=248

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAFVTMD+ +DA R
Sbjct  69   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFVTMDSVEDAER  128

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  129  CIKHLNQSVLEGRYITVERS  148



>ref|XP_010526825.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Tarenaya 
hassleriana]
Length=226

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/78 (85%), Positives = 74/78 (95%), Gaps = 0/78 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERDLE+HFSKEGKV S FLVVEPR+RVSRGFAFVTM+  +DA+R
Sbjct  66   NPGNTLYVTGLSTRVTERDLEEHFSKEGKVSSCFLVVEPRTRVSRGFAFVTMETYEDADR  125

Query  447  CVKHLNQSVLEGRYITVE  500
            C+K+LNQSVLEGRYITVE
Sbjct  126  CIKYLNQSVLEGRYITVE  143



>ref|XP_004509406.1| PREDICTED: transformer-2 protein homolog alpha-like [Cicer arietinum]
Length=260

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVT+RDLE+HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  58   NPGNTLYVTGLSSRVTDRDLEEHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSPEDAER  117

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  118  CIKYLNQSVLEGRYITVERS  137



>ref|XP_008791954.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=227

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLE HFSKEGKVK  FLVVEPR+RVSRGFAFVTM+  + A+R
Sbjct  49   NPGNTLYVTGLSSRVTERDLEYHFSKEGKVKGCFLVVEPRTRVSRGFAFVTMNTVEGADR  108

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  109  CVKYLNQSVLEGRYITVEKS  128



>gb|AFK46395.1| unknown [Lotus japonicus]
Length=268

 Score =   140 bits (353),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERDLE+HF+KEGKV S FLVVEPR+R+SRGFAF+TMD  +DANR
Sbjct  88   NGGNTLYVTGLSSRVTERDLEEHFAKEGKVASCFLVVEPRTRISRGFAFITMDTVEDANR  147

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVE+S
Sbjct  148  CVKYLNQSVLEGRYITVERS  167



>ref|XP_009408202.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=232

 Score =   139 bits (349),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTER+LEDHFS+EGKV    LVVEPR+RVSRGFAFVTMD A+DA+R
Sbjct  57   NPGNTLYVTGLSSRVTERELEDHFSREGKVVGCHLVVEPRTRVSRGFAFVTMDAAEDADR  116

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGRYITVEKS
Sbjct  117  CIKYLNQSILEGRYITVEKS  136



>ref|XP_006572837.1| PREDICTED: uncharacterized protein LOC100527350 isoform X1 [Glycine 
max]
 gb|ACU18771.1| unknown [Glycine max]
Length=246

 Score =   139 bits (350),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G TLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAF+TMD  +DANR
Sbjct  66   NAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVEDANR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  126  CIKYLNQSVLEGRYITVERS  145



>ref|XP_006282702.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
 gb|EOA15600.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
Length=185

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/79 (81%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+RVSRGFAFVTMD+  DA R
Sbjct  67   NPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKDAER  126

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  127  CIKYLNQSVLEGRYITVER  145



>ref|XP_010935190.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Elaeis guineensis]
Length=192

 Score =   137 bits (345),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLEDHFS+EGKV    LVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  13   NPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNEDAER  72

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  73   CIKYLNQSVLEGRYITVEKS  92



>gb|KHN35992.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=273

 Score =   139 bits (350),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G TLYVTGLS+RVTERDLE+HFSKEGKV S FLVVEPR+R+SRGFAF+TMD  +DANR
Sbjct  93   NAGTTLYVTGLSSRVTERDLEEHFSKEGKVASCFLVVEPRTRISRGFAFITMDTVEDANR  152

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  153  CIKYLNQSVLEGRYITVERS  172



>ref|XP_010696606.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Beta vulgaris 
subsp. vulgaris]
Length=220

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TL+VTGLS+RVTER+LED F+KEGKV SVFLVVEPR+R+SRGFAFVTMD  +DA+R
Sbjct  47   NPGNTLFVTGLSSRVTERELEDFFNKEGKVSSVFLVVEPRTRISRGFAFVTMDTLEDADR  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  107  CIKYLNQSVLEGRYITVEKS  126



>ref|XP_002867054.1| hypothetical protein ARALYDRAFT_912788 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43313.1| hypothetical protein ARALYDRAFT_912788 [Arabidopsis lyrata subsp. 
lyrata]
Length=160

 Score =   135 bits (341),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 72/79 (91%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTMD+  DA R
Sbjct  50   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMDSVKDAER  109

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  110  CIKYLNQSVLEGRYITVER  128



>ref|XP_010266988.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Nelumbo nucifera]
Length=679

 Score =   144 bits (362),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 69/80 (86%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTER+LEDHFSKEGKV S  LVVEPRSR SRGFAFVTMD  +DA+R
Sbjct  51   NPGNTLYVTGLSTRVTERELEDHFSKEGKVISCRLVVEPRSRASRGFAFVTMDTIEDADR  110

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  111  CIKHLNQSVLEGRYITVEKS  130



>ref|XP_006828824.1| hypothetical protein AMTR_s00001p00140760 [Amborella trichopoda]
 gb|ERM96240.1| hypothetical protein AMTR_s00001p00140760 [Amborella trichopoda]
Length=228

 Score =   137 bits (346),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTERD+E+HFS+EGKV S  LVVEPR+R+SRGFAFVTMD  +DA+R
Sbjct  51   NPGNTLYVTGLSTRVTERDVEEHFSREGKVASCRLVVEPRTRISRGFAFVTMDTLEDADR  110

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGRYITVEKS
Sbjct  111  CIKYLNQSILEGRYITVEKS  130



>ref|XP_002270437.3| PREDICTED: uncharacterized protein LOC100241946 [Vitis vinifera]
Length=931

 Score =   145 bits (366),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTER LEDHFS+EGKV S FLV+EPR+R+SRGFAFVTM+  +DANR
Sbjct  56   NPGNTLYVTGLSTRVTERALEDHFSREGKVASCFLVMEPRTRISRGFAFVTMETVEDANR  115

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVEKS
Sbjct  116  CIKHLNQSVLEGRYITVEKS  135



>ref|XP_010437422.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Camelina 
sativa]
Length=235

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+RVSRGFAFVTMD+  DA R
Sbjct  69   NPGTTLYVTGLSTRVTDKDLESHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKDAER  128

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  129  CIKYLNQSVLEGRYITVERS  148



>ref|XP_007046578.1| Ankyrin repeat protein [Theobroma cacao]
 gb|EOX90735.1| Ankyrin repeat protein [Theobroma cacao]
Length=683

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 66/80 (83%), Positives = 76/80 (95%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS RV+ERD+E+HFSKEGKV S FLVVEPR+R+SRGFAFVTMDN +DANR
Sbjct  66   NPGNTLYVTGLSQRVSERDVEEHFSKEGKVVSCFLVVEPRTRISRGFAFVTMDNVEDANR  125

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  126  CIKYLNQSVLEGRYITVERS  145



>emb|CDY20808.1| BnaC07g06570D [Brassica napus]
Length=262

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVTER++E HFSKEGKV S FLVVEPR+R SRGFAFVTMD+ +DA+R
Sbjct  97   NPGSTLYVTGLSTRVTEREIETHFSKEGKVASCFLVVEPRTRASRGFAFVTMDSYEDADR  156

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  157  CIKYLNQSVLEGRYITVERS  176



>ref|XP_010935189.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Elaeis guineensis]
Length=236

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLEDHFS+EGKV    LVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  57   NPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNEDAER  116

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  117  CIKYLNQSVLEGRYITVEKS  136



>ref|XP_004512185.1| PREDICTED: serine/arginine-rich splicing factor 4-like isoform 
X2 [Cicer arietinum]
Length=246

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 73/79 (92%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N GDTLYVTGLS+RVTE+DLE+HFS EGKV S FLVVEPR+R+SRGF FVTM++ +DA+R
Sbjct  136  NAGDTLYVTGLSSRVTEKDLEEHFSTEGKVASCFLVVEPRTRISRGFGFVTMESVEDASR  195

Query  447  CVKHLNQSVLEGRYITVEK  503
            CVK+LNQSVLEGRYITVE+
Sbjct  196  CVKYLNQSVLEGRYITVER  214



>ref|XP_010935188.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Elaeis guineensis]
Length=239

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLEDHFS+EGKV    LVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  60   NPGNTLYVTGLSSRVTERDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTNEDAER  119

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  120  CIKYLNQSVLEGRYITVEKS  139



>ref|XP_006282703.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
 gb|EOA15601.1| hypothetical protein CARUB_v10005648mg [Capsella rubella]
Length=232

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+RVSRGFAFVTMD+  DA R
Sbjct  67   NPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKDAER  126

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  127  CIKYLNQSVLEGRYITVERS  146



>ref|XP_008806158.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Phoenix 
dactylifera]
Length=237

 Score =   136 bits (343),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVT+RDLEDHFS+EGKV    LVVEPR+R+SRGFAFVTMD  +DA R
Sbjct  57   NPGNTLYVTGLSSRVTDRDLEDHFSREGKVVGCRLVVEPRTRISRGFAFVTMDTTEDAER  116

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVEKS
Sbjct  117  CVKYLNQSVLEGRYITVEKS  136



>gb|KFK30200.1| hypothetical protein AALP_AA7G231300 [Arabis alpina]
Length=157

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT+ DLE HFSKEGKV S FLV+EPR+RVSRGF FVTMD+  DA+R
Sbjct  65   NPGTTLYVTGLSTRVTDEDLEAHFSKEGKVASCFLVMEPRTRVSRGFGFVTMDSLKDADR  124

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  125  CIKYLNQSVLEGRYITVER  143



>ref|XP_008242002.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Prunus mume]
Length=677

 Score =   142 bits (358),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ +DA R
Sbjct  64   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEDAER  123

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  124  CIKHLNQSVLEGRYITVERS  143



>ref|XP_009400377.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Musa acuminata 
subsp. malaccensis]
Length=223

 Score =   135 bits (341),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS+RVTERDLE HFS+EGKV   +L+VEPR+RVSRGFAFVTMD  + A+R
Sbjct  50   NPGNTLYVTGLSSRVTERDLESHFSREGKVSECYLIVEPRTRVSRGFAFVTMDTVEGADR  109

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVEKS
Sbjct  110  CIKYLNQSVLEGRYITVEKS  129



>ref|XP_006412060.1| hypothetical protein EUTSA_v10026015mg [Eutrema salsugineum]
 gb|ESQ53513.1| hypothetical protein EUTSA_v10026015mg [Eutrema salsugineum]
Length=260

 Score =   136 bits (342),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+RVSRGFAFVTMD+  DA R
Sbjct  70   NPGTTLYVTGLSTRVTDKDLETHFSKEGKVASCFLVMEPRTRVSRGFAFVTMDSLKDAER  129

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  130  CIKYLNQSVLEGRYITVERS  149



>ref|XP_009150254.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=221

 Score =   135 bits (339),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+R SRGFAFVTMD   DA+R
Sbjct  64   NPGTTLYVTGLSTRVTDKDLESHFSKEGKVASCFLVMEPRTRESRGFAFVTMDTVKDADR  123

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  124  CIKYLNQSVLEGRYITVERS  143



>ref|NP_001154288.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86567.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=207

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  69   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  128

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  129  CIKYLNQSVLEGRYITVER  147



>ref|XP_010113281.1| Ankyrin repeat domain-containing protein [Morus notabilis]
 gb|EXC35288.1| Ankyrin repeat domain-containing protein [Morus notabilis]
Length=683

 Score =   140 bits (354),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/80 (84%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLSTRVTERDLEDHFSKEGKV S FLVVEPR+R+SRGFAFVTMD+ + A+R
Sbjct  77   NQGNTLYVTGLSTRVTERDLEDHFSKEGKVASCFLVVEPRTRISRGFAFVTMDSVEGADR  136

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVE+S
Sbjct  137  CVKYLNQSVLEGRYITVERS  156



>ref|NP_001190929.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86568.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=201

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  83   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  142

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  143  CIKYLNQSVLEGRYITVER  161



>emb|CDX69165.1| BnaC01g02880D [Brassica napus]
Length=268

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+R SRGFAFVTMD+  DA+R
Sbjct  95   NPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRESRGFAFVTMDSVKDADR  154

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  155  CIKYLNQSVLEGRYITVERS  174



>ref|XP_004512184.1| PREDICTED: serine/arginine-rich splicing factor 4-like isoform 
X1 [Cicer arietinum]
Length=310

 Score =   135 bits (341),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 74/80 (93%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N GDTLYVTGLS+RVTE+DLE+HFS EGKV S FLVVEPR+R+SRGF FVTM++ +DA+R
Sbjct  136  NAGDTLYVTGLSSRVTEKDLEEHFSTEGKVASCFLVVEPRTRISRGFGFVTMESVEDASR  195

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LNQSVLEGRYITVE+S
Sbjct  196  CVKYLNQSVLEGRYITVERS  215



>emb|CDX75526.1| BnaA01g01760D [Brassica napus]
Length=285

 Score =   135 bits (339),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/79 (80%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HFSKEGKV S FLV+EPR+R SRGFAFVTMD   DA+R
Sbjct  73   NPGTTLYVTGLSTRVTDKDLEAHFSKEGKVASCFLVMEPRTRESRGFAFVTMDTVKDADR  132

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  133  CIKYLNQSVLEGRYITVER  151



>ref|XP_004287763.2| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic 
[Fragaria vesca subsp. vesca]
Length=656

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/80 (80%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLS R +E+D+E HFSKEGKV S FLVVEPRSR+SRGFAFVTMD+ +DA R
Sbjct  68   NPGNTLYVTGLSQRASEKDVERHFSKEGKVASCFLVVEPRSRISRGFAFVTMDSNEDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLNQSVLEGRYITVE+S
Sbjct  128  CIKHLNQSVLEGRYITVERS  147



>ref|NP_001190930.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86569.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=244

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  83   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  142

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSVLEGRYITVE+
Sbjct  143  CIKYLNQSVLEGRYITVER  161



>ref|NP_974690.4| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AAZ23933.1| At4g35785 [Arabidopsis thaliana]
 gb|AEE86566.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=239

 Score =   133 bits (335),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  69   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  128

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  129  CIKYLNQSVLEGRYITVERS  148



>ref|NP_680768.5| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
 gb|AEE86565.1| RNA-binding (RRM/RBD/RNP motifs) family protein [Arabidopsis 
thaliana]
Length=238

 Score =   133 bits (335),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 63/80 (79%), Positives = 72/80 (90%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  68   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  127

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  128  CIKYLNQSVLEGRYITVERS  147



>ref|XP_008361349.1| PREDICTED: uncharacterized protein LOC103425049 [Malus domestica]
Length=649

 Score =   138 bits (348),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAF+TMD+ +DA R
Sbjct  65   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFITMDSVEDAER  124

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  125  CIKNLNQSVLEGRYITVERS  144



>ref|XP_009337079.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=680

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAF+TMD+ +DA R
Sbjct  65   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFITMDSVEDAER  124

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  125  CIKNLNQSVLEGRYITVERS  144



>ref|XP_009363438.1| PREDICTED: ankyrin repeat domain-containing protein, chloroplastic-like 
[Pyrus x bretschneideri]
Length=680

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 75/80 (94%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRV+E+D+E HFSKEGKV S FLV+EPR+R+SRGFAF+TMD+ +DA R
Sbjct  65   NPGNTLYVTGLSTRVSEKDVERHFSKEGKVASCFLVMEPRTRISRGFAFITMDSVEDAER  124

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSVLEGRYITVE+S
Sbjct  125  CIKNLNQSVLEGRYITVERS  144



>ref|XP_009387324.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=238

 Score =   131 bits (330),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERDLEDHFS+EGKV    LVVEPR+R SRGFAFVTMD  +DA+R
Sbjct  57   NHGNTLYVTGLSSRVTERDLEDHFSREGKVVGCHLVVEPRTRASRGFAFVTMDTTEDADR  116

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGR ITVEKS
Sbjct  117  CIKYLNQSILEGRCITVEKS  136



>ref|XP_001756218.1| predicted protein [Physcomitrella patens]
 gb|EDQ79084.1| predicted protein, partial [Physcomitrella patens]
Length=158

 Score =   127 bits (319),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE+DL++HFS+EGKV    LVV+PR+R SRGF FVTMDNADDA+R
Sbjct  14   NPGNNLYVTGLSTRVTEKDLDEHFSREGKVVECRLVVDPRTRESRGFGFVTMDNADDADR  73

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+S LEGR ITVEK+
Sbjct  74   CVKYLNRSTLEGRIITVEKA  93



>gb|ADE76245.1| unknown [Picea sitchensis]
 gb|ADE77346.1| unknown [Picea sitchensis]
Length=220

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLSTRVTE+DLE+HFS EGKV    LVVEPR+R+SRGF FVTM + +DA R
Sbjct  39   NPGNTLYVTGLSTRVTEKDLEEHFSGEGKVIDCRLVVEPRTRISRGFGFVTMGSLEDAER  98

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS+LEGR+ITVEKS
Sbjct  99   CIKYLNQSILEGRFITVEKS  118



>gb|KHN06831.1| RNA-binding motif protein, X chromosome [Glycine soja]
Length=144

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 68/79 (86%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDL+ HFSKEGKV S FLVVEP +R+S GFAFVTM +A DA  
Sbjct  60   NPGDTLYVTGLSSRVTERDLKKHFSKEGKVCSCFLVVEPSTRISHGFAFVTMGSAVDAEH  119

Query  447  CVKHLNQSVLEGRYITVEK  503
            C K+LNQSVLEG YI+VE+
Sbjct  120  CNKYLNQSVLEGSYISVEQ  138



>ref|XP_009109272.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=243

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVTE+DLE +FSKEGKV S  LV+EPR+R SRGFAFVTMD+  DA R
Sbjct  70   NPGTTLYVTGLSTRVTEKDLEAYFSKEGKVASCVLVLEPRTRESRGFAFVTMDSVKDAER  129

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN SVLEGRYITVE+S
Sbjct  130  CIKYLNHSVLEGRYITVERS  149



>ref|XP_010521922.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X3 [Tarenaya hassleriana]
Length=128

 Score =   122 bits (307),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVT+RDLEDHFSKEGKV  V LV++P +R SRGF FVTM+N +DANR
Sbjct  41   NPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMEDANR  100

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  101  CIKYLDRSVLEGRIITVEK  119



>ref|NP_001058614.1| Os06g0724600 [Oryza sativa Japonica Group]
 dbj|BAF20528.1| Os06g0724600 [Oryza sativa Japonica Group]
 dbj|BAG93673.1| unnamed protein product [Oryza sativa Japonica Group]
Length=164

 Score =   124 bits (310),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+L+D+FSKEG+V S  +V+EP +RVSRGFAFVTMD  +DA R
Sbjct  62   NHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAER  121

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQSV+EGR ITVEK
Sbjct  122  CIKYLNQSVMEGRNITVEK  140



>gb|ABR46234.1| At4g35785 [Arabidopsis thaliana]
Length=141

 Score =   122 bits (306),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 65/73 (89%), Gaps = 0/73 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVT++DLE HF+KEGKV S FLV+EPR+RVSRGFAFVTM +  DA R
Sbjct  69   NPGTTLYVTGLSTRVTDKDLEAHFAKEGKVASCFLVMEPRTRVSRGFAFVTMSSLKDAER  128

Query  447  CVKHLNQSVLEGR  485
            C+K+LNQSVLEGR
Sbjct  129  CIKYLNQSVLEGR  141



>emb|CDY42653.1| BnaC01g00650D [Brassica napus]
Length=595

 Score =   127 bits (319),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG TLYVTGLSTRVTE+DLE +FSKEGKV S  LV+EPR+R SRGFAFVTMD+  DA R
Sbjct  87   NPGTTLYVTGLSTRVTEKDLEAYFSKEGKVASCVLVLEPRTRESRGFAFVTMDSVKDAER  146

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN SVLEGRYITVE+
Sbjct  147  CIKYLNHSVLEGRYITVER  165


 Score =   115 bits (288),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLST+VT++DLE HFSK+G V S  L+++P +R SRG+AFVTMD+  DA R
Sbjct  333  NPGNTLYVTGLSTKVTDKDLEAHFSKQGNVASCVLMLDPHTRESRGYAFVTMDSLRDAER  392

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+++L+GRYI VEKS
Sbjct  393  CIKYLNKTLLDGRYIKVEKS  412



>gb|EEE66378.1| hypothetical protein OsJ_22698 [Oryza sativa Japonica Group]
Length=284

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+L+D+FSKEG+V S  +V+EP +RVSRGFAFVTMD  +DA R
Sbjct  73   NHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAER  132

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSV+EGR ITVEKS
Sbjct  133  CIKYLNQSVMEGRNITVEKS  152



>gb|EEC81329.1| hypothetical protein OsI_24503 [Oryza sativa Indica Group]
Length=273

 Score =   123 bits (308),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+L+D+FSKEG+V S  +V+EP +RVSRGFAFVTMD  +DA R
Sbjct  62   NHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAER  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSV+EGR ITVEKS
Sbjct  122  CIKYLNQSVMEGRNITVEKS  141



>dbj|BAD61690.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAD62534.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAG95938.1| unnamed protein product [Oryza sativa Japonica Group]
Length=273

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+L+D+FSKEG+V S  +V+EP +RVSRGFAFVTMD  +DA R
Sbjct  62   NHGNTLYVTGLSSRVTERELKDYFSKEGRVTSCHVVLEPHTRVSRGFAFVTMDTVEDAER  121

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSV+EGR ITVEKS
Sbjct  122  CIKYLNQSVMEGRNITVEKS  141



>ref|XP_006657354.1| PREDICTED: transformer-2 protein homolog beta-like [Oryza brachyantha]
Length=342

 Score =   123 bits (309),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+L+D+FSKEG+V S  +V+EP +RVSRGFAFVTMD  +DA R
Sbjct  132  NHGNTLYVTGLSSRVTERELKDYFSKEGRVASCHVVLEPHTRVSRGFAFVTMDTVEDAER  191

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSV+EGR ITVEKS
Sbjct  192  CIKYLNQSVMEGRNITVEKS  211



>gb|ABW81106.1| putRNAbp29 [Cleome spinosa]
Length=338

 Score =   122 bits (307),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVT+RDLEDHFSKEGKV  V LV++P +R SRGF FVTM+N +DANR
Sbjct  41   NPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMEDANR  100

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  101  CIKYLDRSVLEGRIITVEKA  120



>ref|XP_010521921.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Tarenaya hassleriana]
Length=367

 Score =   122 bits (307),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVT+RDLEDHFSKEGKV  V LV++P +R SRGF FVTM+N +DANR
Sbjct  41   NPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMEDANR  100

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  101  CIKYLDRSVLEGRIITVEKA  120



>ref|XP_010521920.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Tarenaya hassleriana]
Length=370

 Score =   122 bits (306),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 58/80 (73%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVT+RDLEDHFSKEGKV  V LV++P +R SRGF FVTM+N +DANR
Sbjct  41   NPGNSLYVTGLSHRVTKRDLEDHFSKEGKVVDVNLVLDPWTRESRGFGFVTMENMEDANR  100

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  101  CIKYLDRSVLEGRIITVEKA  120



>ref|NP_849605.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
 gb|AAK96648.1| At1g07350/F22G5_25 [Arabidopsis thaliana]
 gb|AEE28113.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
Length=129

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHF+KEGKV  V LV++P +R SRGF F++M +  DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEK  503
            C++ L+ SVL+GR ITVEK
Sbjct  102  CIRSLDHSVLQGRVITVEK  120



>ref|XP_009109965.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brassica 
rapa]
Length=269

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+TLYVTGLST+VTE+DLE HFSK+GKV S  L+++P +R SRG+AFVTMD+  DA R
Sbjct  99   NPGNTLYVTGLSTKVTEKDLEAHFSKQGKVASCVLMLDPHTRESRGYAFVTMDSLRDAER  158

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+++L+GRYI VEKS
Sbjct  159  CIKYLNKTLLDGRYIKVEKS  178



>ref|XP_001778182.1| predicted protein [Physcomitrella patens]
 gb|EDQ56964.1| predicted protein, partial [Physcomitrella patens]
Length=172

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV E+DL++HFS+EGKV    LV++PR+R SRGF FVTM++ +DA R
Sbjct  10   NPGNNLYVTGLSTRVNEKDLQEHFSREGKVLECRLVLDPRTRESRGFGFVTMEHLEDAER  69

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+S LEGR ITVEK+
Sbjct  70   CIKYLNRSTLEGRMITVEKA  89



>gb|EEE68615.1| hypothetical protein OsJ_27155 [Oryza sativa Japonica Group]
Length=271

 Score =   118 bits (296),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKV+S  +V++PR++ SRGFAFVTMD+ DDA R
Sbjct  80   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARR  139

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR +TVEK+
Sbjct  140  CIKYLHRTVLEGRLVTVEKA  159



>ref|NP_001061706.1| Os08g0385900 [Oryza sativa Japonica Group]
 dbj|BAD05420.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAD05836.1| putative transformer-SR ribonucleoprotein [Oryza sativa Japonica 
Group]
 dbj|BAF23620.1| Os08g0385900 [Oryza sativa Japonica Group]
 dbj|BAG92152.1| unnamed protein product [Oryza sativa Japonica Group]
Length=279

 Score =   118 bits (296),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 70/80 (88%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKV+S  +V++PR++ SRGFAFVTMD+ DDA R
Sbjct  88   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDSVDDARR  147

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR +TVEK+
Sbjct  148  CIKYLHRTVLEGRLVTVEKA  167



>ref|XP_002437609.1| hypothetical protein SORBIDRAFT_10g030460 [Sorghum bicolor]
 gb|EER88976.1| hypothetical protein SORBIDRAFT_10g030460 [Sorghum bicolor]
Length=223

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERD++D+FSK GKV    +V+EP +RVSRGFAFVTMD  ++A R
Sbjct  60   NRGNTLYVTGLSSRVTERDVKDYFSKHGKVVGCHVVLEPHTRVSRGFAFVTMDTVEEAER  119

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN SV+EGR ITVEK
Sbjct  120  CIKYLNDSVMEGRNITVEK  138



>ref|XP_006659363.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X1 [Oryza brachyantha]
Length=277

 Score =   118 bits (295),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKV+S  +V++PR++ SRGFAFVTMD  DDA R
Sbjct  86   NPGNNLYVTGLSTRVTEEDLEKFFSKEGKVQSCHVVLDPRTKESRGFAFVTMDTVDDARR  145

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR +TVEK+
Sbjct  146  CIKYLHRTVLEGRLVTVEKA  165



>ref|XP_002304510.1| hypothetical protein POPTR_0003s13030g [Populus trichocarpa]
 gb|EEE79489.1| hypothetical protein POPTR_0003s13030g [Populus trichocarpa]
Length=208

 Score =   116 bits (291),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 57/80 (71%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS EGKV    LV +PR+R SRGFAFVTM+  +DANR
Sbjct  45   NPGNNLYVTGLSTRVTSSDLEKYFSSEGKVLECHLVTDPRTRESRGFAFVTMETVEDANR  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  105  CVKYLNRSVLEGRVITVEKA  124



>ref|XP_001757377.1| predicted protein [Physcomitrella patens]
 gb|EDQ77862.1| predicted protein, partial [Physcomitrella patens]
Length=113

 Score =   114 bits (284),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV E+DL +HFS+EGKV    LV++PR+R SRGF FVTM++ +DA R
Sbjct  35   NPGNNLYVTGLSTRVNEKDLLEHFSQEGKVLECRLVLDPRTRESRGFGFVTMEHLEDAER  94

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+S LEGR ITVEK
Sbjct  95   CIKYLNRSTLEGRIITVEK  113



>ref|XP_003563264.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brachypodium 
distachyon]
Length=272

 Score =   117 bits (294),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 71/80 (89%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS++VT+R+L+D+F+KEGKV S  +V+EP +RVSRGFAF+TMD  +DA R
Sbjct  63   NHGNTLYVTGLSSKVTDRELKDYFNKEGKVVSCHVVLEPHTRVSRGFAFITMDTVEDAER  122

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS L+GR+ITVEKS
Sbjct  123  CIKYLNQSELQGRHITVEKS  142



>ref|XP_006586189.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Glycine max]
 ref|XP_006586190.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X3 [Glycine max]
Length=143

 Score =   114 bits (284),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HFS EGKV  V LVV+P +R SRGF FVTM+  ++A+R
Sbjct  45   NPGNNLYVTGLSPRITKRELEKHFSAEGKVIDVHLVVDPWTRESRGFGFVTMETLEEADR  104

Query  447  CVKHLNQSVLEGRYITVEK  503
            CVK+LN+SVLEGR ITVEK
Sbjct  105  CVKYLNRSVLEGRVITVEK  123



>emb|CDY10270.1| BnaC05g05130D [Brassica napus]
Length=356

 Score =   118 bits (296),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFS+EGKV  V LV++PR+R  RGF F++M+   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSEEGKVTDVHLVLDPRTREPRGFGFISMETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C++HL+ SVL GR ITVEK+
Sbjct  102  CIRHLDHSVLMGRVITVEKA  121



>ref|XP_008779363.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008779371.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008779376.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=203

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FSKEG+V+   +V++PR+R SRGF FVTM+  +DA+R
Sbjct  46   NPGNNLYVTGLSTRVTSSDLEKYFSKEGRVQECHVVMDPRTRESRGFGFVTMETLEDADR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  106  CVKYLNRSVLEGRLITVEKA  125



>ref|XP_011022643.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Populus 
euphratica]
Length=209

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS EGKV    LV +PR+R SRGFAFVTM+  +DANR
Sbjct  45   NPGNNLYVTGLSTRVTSSDLEKYFSSEGKVLECHLVTDPRTRESRGFAFVTMETVEDANR  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR +TVEK+
Sbjct  105  CVKYLNRSVLEGRVVTVEKA  124



>ref|XP_006586014.1| PREDICTED: transformer-2 protein homolog beta-like [Glycine max]
Length=139

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 61/71 (86%), Gaps = 0/71 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPGDTLYVTGLS+RVTERDL+ HFSKEGKV S FLVVEP +R+S GFAFVTM +A DA  
Sbjct  63   NPGDTLYVTGLSSRVTERDLKKHFSKEGKVCSCFLVVEPSTRISHGFAFVTMGSAMDAEH  122

Query  447  CVKHLNQSVLE  479
            C K+LNQSVLE
Sbjct  123  CNKYLNQSVLE  133



>ref|XP_004973345.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X1 [Setaria italica]
 ref|XP_004973346.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X2 [Setaria italica]
 ref|XP_004973347.1| PREDICTED: serine/arginine-rich splicing factor 2-like isoform 
X3 [Setaria italica]
Length=283

 Score =   117 bits (292),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKVK+  +V++PRS+ SRGFAFVTMD  +DA R
Sbjct  86   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRSKESRGFAFVTMDTVEDARR  145

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR +TVEK+
Sbjct  146  CIKYLHRTVLEGRLVTVEKA  165



>ref|XP_002892395.1| hypothetical protein ARALYDRAFT_470756 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68654.1| hypothetical protein ARALYDRAFT_470756 [Arabidopsis lyrata subsp. 
lyrata]
Length=381

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHF+KEGKV  V LV++P +R SRGF F++M++  DANR
Sbjct  71   NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMESVGDANR  130

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL+GR ITVEK+
Sbjct  131  CIRYLDHSVLQGRVITVEKA  150



>gb|KDP25408.1| hypothetical protein JCGZ_20564 [Jatropha curcas]
Length=205

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +F KEGKV    LV +PR+R SRGFAFVTM+  +DA R
Sbjct  45   NPGNNLYVTGLSTRVTTSDLEKYFGKEGKVLECHLVTDPRTRESRGFAFVTMETVEDAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  105  CIKYLNRSVLEGRLITVEKA  124



>ref|XP_002444277.1| hypothetical protein SORBIDRAFT_07g019390 [Sorghum bicolor]
 gb|EES13772.1| hypothetical protein SORBIDRAFT_07g019390 [Sorghum bicolor]
Length=191

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG  LYVTGLSTRVTE DL+  FSKEGKVK+  +V++PR++ SRGFAFVTMD  +DA R
Sbjct  83   NPGTNLYVTGLSTRVTEEDLQKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEDARR  142

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L+++VLEGR +TVEK
Sbjct  143  CIKYLHRTVLEGRLVTVEK  161



>gb|AFK40884.1| unknown [Lotus japonicus]
Length=344

 Score =   117 bits (293),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTMD  +DANR
Sbjct  45   NPGNNLYVTGLSPRITKRELEKHFATEGKVIDVHLVVDPWTRESRGFGFVTMDTLEDANR  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  105  CVKYLNRSVLEGRVITVEKA  124



>ref|XP_009118966.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brassica 
rapa]
 ref|XP_009118967.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Brassica 
rapa]
Length=349

 Score =   117 bits (292),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R  RGF F++M+   DANR
Sbjct  39   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGDANR  98

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C++HL+ SVL GR ITVEK+
Sbjct  99   CIRHLDHSVLLGRVITVEKA  118



>ref|XP_010055674.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Eucalyptus 
grandis]
 gb|KCW72183.1| hypothetical protein EUGRSUZ_E00636 [Eucalyptus grandis]
Length=249

 Score =   115 bits (287),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT RDLE +FSKEGKV    LV +PR++ SRGF FVTM+   DA R
Sbjct  87   NPGNNLYVTGLSTRVTSRDLEKYFSKEGKVLECQLVTDPRTKDSRGFGFVTMETNKDAER  146

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQSV EGR ITVEK+
Sbjct  147  CIKYLNQSVFEGRLITVEKA  166



>gb|AFW69545.1| hypothetical protein ZEAMMB73_512754 [Zea mays]
Length=151

 Score =   112 bits (280),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERD++D+FSK G+V    +V+EP +RVSRGFAFV+MD  ++A R
Sbjct  60   NRGNTLYVTGLSSRVTERDVKDYFSKHGRVVGCHVVLEPHTRVSRGFAFVSMDTVEEAER  119

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN SV+EGR ITVEK
Sbjct  120  CIKYLNGSVMEGRNITVEK  138



>ref|XP_002963380.1| hypothetical protein SELMODRAFT_80254 [Selaginella moellendorffii]
 gb|EFJ35251.1| hypothetical protein SELMODRAFT_80254 [Selaginella moellendorffii]
Length=161

 Score =   112 bits (281),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE+DLED+FSKEGKV    LVV+PRS  SRGF FV +++ DDA R
Sbjct  19   NPGNNLYVTGLSTRVTEKDLEDYFSKEGKVVECRLVVDPRSHESRGFGFVALESLDDAER  78

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K L+ S LEGR ITVEK+
Sbjct  79   CIKRLHHSNLEGRIITVEKA  98



>ref|XP_011082380.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Sesamum 
indicum]
Length=374

 Score =   116 bits (291),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+RDLE HFS EGKV+ V LVV+P +R SRGF FVTM   ++A+R
Sbjct  42   NPGNNLYVTGLSTRVTKRDLEKHFSTEGKVEDVHLVVDPWTRESRGFGFVTMSTLEEADR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  102  CIKYLDRSVLEGRVITVEKA  121



>ref|XP_004966485.1| PREDICTED: RNA-binding motif protein, X chromosome-like isoform 
X1 [Setaria italica]
Length=274

 Score =   115 bits (288),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTER+++D+FSKEG+V    +V+EP +RVSRGFAFVTMD  ++A R
Sbjct  61   NRGNTLYVTGLSSRVTEREIKDYFSKEGRVVGCHVVLEPHTRVSRGFAFVTMDTVEEAER  120

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN SV+EGR ITVEKS
Sbjct  121  CIKYLNNSVMEGRNITVEKS  140



>ref|XP_006417810.1| hypothetical protein EUTSA_v10008061mg [Eutrema salsugineum]
 gb|ESQ36163.1| hypothetical protein EUTSA_v10008061mg [Eutrema salsugineum]
Length=352

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R  RGF F++M+   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL+GR ITVEK+
Sbjct  102  CIRYLDHSVLQGRVITVEKA  121



>ref|XP_002509834.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
 gb|EEF51221.1| Arginine/serine-rich-splicing factor, putative [Ricinus communis]
Length=204

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +F KEGKV    LV +PR+R SRGFAFVTM+  +DA R
Sbjct  44   NPGNNLYVTGLSTRVTTGDLEKYFGKEGKVLECHLVTDPRTRESRGFAFVTMETLEDAER  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  104  CVKYLNRSVLEGRLITVEKA  123



>ref|XP_009624179.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Nicotiana 
tomentosiformis]
Length=391

 Score =   116 bits (291),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV ERD+E HFS EGKV+ V LVV+P +R SRGF FVTM + ++A+R
Sbjct  43   NPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTRESRGFGFVTMSSVEEADR  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  103  CIKYLNRSVLEGRVITVEKA  122



>gb|AFW69542.1| hypothetical protein ZEAMMB73_512754 [Zea mays]
 gb|AFW69543.1| hypothetical protein ZEAMMB73_512754 [Zea mays]
Length=223

 Score =   114 bits (284),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERD++D+FSK G+V    +V+EP +RVSRGFAFV+MD  ++A R
Sbjct  60   NRGNTLYVTGLSSRVTERDVKDYFSKHGRVVGCHVVLEPHTRVSRGFAFVSMDTVEEAER  119

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN SV+EGR ITVEK
Sbjct  120  CIKYLNGSVMEGRNITVEK  138



>gb|AAK92735.1| putative transformer-SR ribonucleoprotein [Arabidopsis thaliana]
Length=352

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHF+KEGKV  V LV++P +R SRGF F++M +  DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C++ L+ SVL+GR ITVEK+
Sbjct  102  CIRSLDHSVLQGRVITVEKA  121



>emb|CBI16010.3| unnamed protein product [Vitis vinifera]
Length=198

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+R+LE HF+ EG V  V LV +P +R SRGF FVTM   ++ANR
Sbjct  46   NPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEEANR  105

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  106  CIKYLDRSVLEGRVITVEK  124



>ref|NP_563787.2| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
 sp|Q84TH4.1|SR45A_ARATH RecName: Full=Serine/arginine-rich splicing factor SR45a; Short=At-SR45A; 
Short=AtSR45a; AltName: Full=Protein TRANSFORMER2-like; 
Short=atTra2 [Arabidopsis thaliana]
 gb|AAO64199.1| putative transformer-SR ribonucleoprotein [Arabidopsis thaliana]
 gb|AEE28112.1| serine/arginine rich-like protein SR45a [Arabidopsis thaliana]
Length=382

 Score =   116 bits (290),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHF+KEGKV  V LV++P +R SRGF F++M +  DANR
Sbjct  72   NPGNSLYVTGLSHRVTERDLEDHFAKEGKVTDVHLVLDPWTRESRGFGFISMKSVGDANR  131

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C++ L+ SVL+GR ITVEK+
Sbjct  132  CIRSLDHSVLQGRVITVEKA  151



>emb|CBI34365.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV   DLE +F+ EGKV    LV +PR+R SRGF FVTM+  +DA+R
Sbjct  51   NPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVEDADR  110

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  111  CIKYLNRSVLEGRLITVEK  129



>dbj|BAK07261.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=159

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 67/79 (85%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLY+TGLS+RVT+++L ++F+KEGKV S  +V+EP +RVSRGFAF+TMD  +DA R
Sbjct  66   NHGNTLYITGLSSRVTDKELREYFNKEGKVVSCHVVLEPHTRVSRGFAFITMDTVEDAER  125

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LNQS L GR ITVEK
Sbjct  126  CIKYLNQSELLGRNITVEK  144



>ref|XP_006827527.1| hypothetical protein AMTR_s00009p00202570 [Amborella trichopoda]
 gb|ERM94943.1| hypothetical protein AMTR_s00009p00202570 [Amborella trichopoda]
Length=300

 Score =   114 bits (286),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/79 (67%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LY+TGLSTRVT R+LE HF  EGKV    LVV+PR+R SRGF FVTM+  +DA+R
Sbjct  36   NPGNNLYITGLSTRVTTRELERHFQSEGKVLECHLVVDPRTRESRGFGFVTMETIEDADR  95

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR I VEK
Sbjct  96   CIKYLNRSVLEGRVIAVEK  114



>emb|CDP09143.1| unnamed protein product [Coffea canephora]
Length=363

 Score =   115 bits (288),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/79 (68%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+RDLE HFS EG V+ V LV++P SR SRGF FVTM +  +A+R
Sbjct  42   NPGNNLYVTGLSTRVTKRDLEKHFSTEGAVEDVHLVIDPWSRESRGFGFVTMASVKEADR  101

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN SVLEGR IT+EK
Sbjct  102  CIKYLNHSVLEGRVITIEK  120



>ref|XP_002974665.1| hypothetical protein SELMODRAFT_102224, partial [Selaginella 
moellendorffii]
 gb|EFJ24185.1| hypothetical protein SELMODRAFT_102224, partial [Selaginella 
moellendorffii]
Length=232

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/80 (69%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE+DLED+FSKEGKV    LVV+PRS  SRGF FV +++ DDA R
Sbjct  48   NPGNNLYVTGLSTRVTEKDLEDYFSKEGKVVECRLVVDPRSHESRGFGFVALESLDDAER  107

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K L+ S LEGR ITVEK+
Sbjct  108  CIKRLHHSNLEGRIITVEKA  127



>gb|EMS64978.1| Scaffold attachment factor B2 [Triticum urartu]
Length=142

 Score =   110 bits (276),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR  E DLE  FSKEGKVK   +V++PR++ SRGFAFVTM+N +DA R
Sbjct  17   NPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRGFAFVTMENVEDARR  76

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L+++VLEGR I+V K
Sbjct  77   CIKYLHRTVLEGRLISVAK  95



>ref|XP_006305290.1| hypothetical protein CARUB_v10009665mg [Capsella rubella]
 gb|EOA38188.1| hypothetical protein CARUB_v10009665mg [Capsella rubella]
Length=337

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++M+   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISMETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_011460914.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X2 [Fragaria vesca subsp. vesca]
Length=147

 Score =   110 bits (275),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N + A+R
Sbjct  49   NPGNNLYVTGLSPRITRRELEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMENVNVADR  108

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  109  CIKYLDRSVLEGRVITVEK  127



>gb|EMT02480.1| Putative RNA-binding protein [Aegilops tauschii]
Length=245

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 69/80 (86%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLY+TGLS+RVT+++L ++F+KEGKV S  +V+EP +RVSRGFAF+TMD  +DA R
Sbjct  33   NHGNTLYITGLSSRVTDKELREYFNKEGKVVSCHVVLEPHTRVSRGFAFITMDTVEDAER  92

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LNQS L+GR ITVEKS
Sbjct  93   CIKYLNQSELQGRNITVEKS  112



>emb|CDY06701.1| BnaA10g04800D [Brassica napus]
Length=349

 Score =   114 bits (286),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R  RGF F++M+   DA+R
Sbjct  39   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTREPRGFGFISMETVGDASR  98

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C++HL+ SVL GR ITVEK+
Sbjct  99   CIRHLDHSVLLGRVITVEKA  118



>ref|XP_009392818.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Musa 
acuminata subsp. malaccensis]
Length=208

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV+  DLE +FSKEGKV    ++V+PR+R SRGF FVTM+  + A R
Sbjct  45   NPGNNLYVTGLSTRVSSSDLEKYFSKEGKVSECHVIVDPRTRESRGFGFVTMETVEGAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITV+K+
Sbjct  105  CVKYLNRSVLEGRLITVQKA  124



>ref|XP_006476526.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X3 [Citrus sinensis]
Length=156

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R SRGFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  107  CIKYLNRSVLEGRLITVEKA  126



>ref|XP_008787412.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
 ref|XP_008787413.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=196

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS EG+V+   +V++PR++ SRGF FVTM+  +DA+R
Sbjct  46   NPGNNLYVTGLSTRVTSSDLEKYFSNEGRVQECHVVMDPRTKESRGFGFVTMETLEDADR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  106  CVKYLNRSVLEGRLITVEKA  125



>gb|EYU38329.1| hypothetical protein MIMGU_mgv1a013947mg [Erythranthe guttata]
Length=205

 Score =   112 bits (279),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DL+ +FS+EGKV    LV +P SR SRGF FVTM+  +D  R
Sbjct  53   NPGNNLYVTGLSTRVTESDLKKYFSREGKVVDCHLVTDPHSRESRGFGFVTMETNEDGER  112

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+KHLN+SVLEGR ITV+++
Sbjct  113  CIKHLNRSVLEGRLITVQQA  132



>ref|XP_009778762.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Nicotiana sylvestris]
Length=399

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV ERD+E HFS EGKV+ V LVV+P ++ SRGF FVTM + ++A+R
Sbjct  44   NPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTQESRGFGFVTMSSVEEADR  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  104  CIKYLNRSVLEGRVITVEKA  123



>ref|XP_009778763.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Nicotiana sylvestris]
Length=398

 Score =   114 bits (286),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV ERD+E HFS EGKV+ V LVV+P ++ SRGF FVTM + ++A+R
Sbjct  43   NPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVHLVVDPWTQESRGFGFVTMSSVEEADR  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  103  CIKYLNRSVLEGRVITVEKA  122



>ref|XP_010033040.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Eucalyptus 
grandis]
Length=130

 Score =   109 bits (273),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM   ++A R
Sbjct  43   NPGNNLYVTGLSPRITKRELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTVEEAER  102

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  103  CIKYLDRSVLEGRVITVEK  121



>ref|XP_011463909.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=220

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  D+E  F+KEGKV    LV +PRSR SRGFAFVTM+  +DA R
Sbjct  44   NPGNNLYVTGLSTRVTSADVEKFFNKEGKVLDCHLVTDPRSRESRGFAFVTMETVEDAER  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR +TVEK+
Sbjct  104  CIKYLNRSVLEGRLVTVEKA  123



>emb|CAN63579.1| hypothetical protein VITISV_029585 [Vitis vinifera]
Length=241

 Score =   112 bits (279),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+R+LE HF+ EG V  V LV +P +R SRGF FVTM   ++ANR
Sbjct  46   NPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEEANR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  106  CIKYLDRSVLEGRVITVEKA  125



>ref|XP_004298819.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=222

 Score =   111 bits (278),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  D+E  F+KEGKV    LV +PRSR SRGFAFVTM+  +DA R
Sbjct  44   NPGNNLYVTGLSTRVTSADVEKFFNKEGKVLDCHLVTDPRSRESRGFAFVTMETVEDAER  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR +TVEK+
Sbjct  104  CIKYLNRSVLEGRLVTVEKA  123



>ref|XP_009337333.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
Length=394

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  36   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  95

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  96   CIKYLDGSVLEGRVITVEKA  115



>ref|XP_009337331.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
Length=396

 Score =   114 bits (285),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  38   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  97

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  98   CIKYLDGSVLEGRVITVEKA  117



>ref|XP_008238932.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Prunus mume]
Length=206

 Score =   111 bits (277),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+KEGKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  44   NPGNNLYVTGLSTRVTSSDLEKFFNKEGKVLECHLVTDPRTRESRGFGFVTMETVEDAER  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR +TVEK+
Sbjct  104  CVKYLNRSVLEGRLVTVEKA  123



>ref|XP_008785439.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Phoenix 
dactylifera]
Length=365

 Score =   114 bits (284),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS+R+T+ DLE HF+ EGKV  V LVV+P +R SRGF FVTMD  ++ANR
Sbjct  46   NPGNNLYVTGLSSRLTKNDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMDTVEEANR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  106  CIKYLDRSVLEGRVITVEKA  125



>ref|XP_007209603.1| hypothetical protein PRUPE_ppa011480mg [Prunus persica]
 ref|XP_008238931.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Prunus mume]
 gb|EMJ10802.1| hypothetical protein PRUPE_ppa011480mg [Prunus persica]
Length=208

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+KEGKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  44   NPGNNLYVTGLSTRVTSSDLEKFFNKEGKVLECHLVTDPRTRESRGFGFVTMETVEDAER  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR +TVEK+
Sbjct  104  CVKYLNRSVLEGRLVTVEKA  123



>ref|XP_009337332.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
Length=396

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  38   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  97

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  98   CIKYLDGSVLEGRVITVEKA  117



>ref|XP_008384864.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X2 [Malus domestica]
Length=400

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  38   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  97

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  98   CIKYLDGSVLEGRVITVEKA  117



>ref|XP_009337328.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009337329.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
Length=398

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  40   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  99

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  100  CIKYLDGSVLEGRVITVEKA  119



>ref|XP_008220282.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Prunus 
mume]
Length=391

 Score =   114 bits (284),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A+R
Sbjct  40   NPGNNLYVTGLSPRITKRELEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMENVDEADR  99

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVE++
Sbjct  100  CIKYLDRSVLEGRVITVERA  119



>ref|NP_001149397.1| transformer-2 protein [Zea mays]
 gb|ACF85225.1| unknown [Zea mays]
 gb|ACG35307.1| transformer-2 protein [Zea mays]
 gb|AFW69544.1| Transformer-2 protein [Zea mays]
Length=280

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERD++D+FSK G+V    +V+EP +RVSRGFAFV+MD  ++A R
Sbjct  60   NRGNTLYVTGLSSRVTERDVKDYFSKHGRVVGCHVVLEPHTRVSRGFAFVSMDTVEEAER  119

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN SV+EGR ITVEKS
Sbjct  120  CIKYLNGSVMEGRNITVEKS  139



>gb|AFW69546.1| hypothetical protein ZEAMMB73_512754 [Zea mays]
Length=283

 Score =   112 bits (280),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            N G+TLYVTGLS+RVTERD++D+FSK G+V    +V+EP +RVSRGFAFV+MD  ++A R
Sbjct  63   NRGNTLYVTGLSSRVTERDVKDYFSKHGRVVGCHVVLEPHTRVSRGFAFVSMDTVEEAER  122

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN SV+EGR ITVEKS
Sbjct  123  CIKYLNGSVMEGRNITVEKS  142



>ref|XP_001752273.1| predicted protein [Physcomitrella patens]
 gb|EDQ83006.1| predicted protein, partial [Physcomitrella patens]
Length=80

 Score =   107 bits (267),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/73 (66%), Positives = 62/73 (85%), Gaps = 0/73 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV E+DL++HFS+EGKV    LV++PR+R SRGF FVTM++ +DA R
Sbjct  8    NPGNNLYVTGLSTRVNEKDLQEHFSREGKVLECRLVLDPRTRESRGFGFVTMEHLEDAER  67

Query  447  CVKHLNQSVLEGR  485
            C+K+LN+S LEGR
Sbjct  68   CIKYLNRSTLEGR  80



>ref|XP_010940583.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
 ref|XP_010940585.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=203

 Score =   110 bits (276),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  +LE +FSKEG+V+   +V++PR+R SRGF FVTM+  + A+R
Sbjct  46   NPGNNLYVTGLSTRVTSSELEKYFSKEGRVQECHVVMDPRTRESRGFGFVTMETLEGADR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  106  CIKYLNRSVLEGRLITVEKA  125



>ref|XP_009375026.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
 ref|XP_009375036.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X4 [Pyrus x bretschneideri]
Length=147

 Score =   109 bits (272),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+K+GKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  45   NPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVEDAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  105  CIKYLDRSVLEGRLITVEKA  124



>ref|XP_008384865.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X3 [Malus domestica]
Length=400

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  38   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  97

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  98   CIKYLDGSVLEGRVITVEKA  117



>ref|XP_008384862.1| PREDICTED: pre-mRNA-splicing factor cwc22 isoform X1 [Malus domestica]
Length=402

 Score =   113 bits (283),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N D+A R
Sbjct  40   NPGNNLYVTGLSPRVTKRELEKHFAAEGKVTDVHLVVDPWTRESRGFGFVTMENVDEAER  99

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ SVLEGR ITVEK+
Sbjct  100  CIKYLDGSVLEGRVITVEKA  119



>gb|AFK47423.1| unknown [Medicago truncatula]
 gb|KEH34153.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=340

 Score =   113 bits (282),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HFS +GKV  V LVV+P +R SRGF FVTMD  ++A+R
Sbjct  42   NPGNNLYVTGLSPRITKRELEKHFSAKGKVVDVHLVVDPWTRESRGFGFVTMDTLEEADR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  102  CVKYLNRSVLEGRVITVEKA  121



>ref|XP_010475492.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=330

 Score =   112 bits (281),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_007016195.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 ref|XP_007016196.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY33814.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY33815.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=131

 Score =   108 bits (270),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EG V  V LVV+P +R SRGF FVTM   ++A R
Sbjct  43   NPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEEAER  102

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  103  CIKYLNRSVLEGRVITVEK  121



>ref|XP_010475491.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=332

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_010239167.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Brachypodium distachyon]
Length=196

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 65/79 (82%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR +  DLE  FSKEGKVK   +V++PR++ SRGFAFVTMDN +DA R
Sbjct  107  NPGNNLYVTGLSTRTSGDDLEKFFSKEGKVKDCHVVMDPRTKESRGFAFVTMDNIEDARR  166

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L+++VLEGR I+V K
Sbjct  167  CIKYLHRTVLEGRLISVAK  185



>ref|XP_010457908.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=352

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_006350816.1| PREDICTED: serine/arginine repetitive matrix protein 2-like [Solanum 
tuberosum]
Length=385

 Score =   113 bits (282),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV ERD+E HFS EGKV+ V LV +P +R SRGF FVTM + ++A+R
Sbjct  43   NPGNNLYVTGLSTRVKERDVEKHFSAEGKVEDVRLVFDPWTRESRGFGFVTMSSVEEADR  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K LN+SVLEGR ITVEK+
Sbjct  103  CIKSLNRSVLEGRVITVEKA  122



>ref|XP_010255285.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Nelumbo 
nucifera]
Length=206

 Score =   110 bits (275),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS+EGKV    LV +PR+R SRGF FVTM+  +DA+R
Sbjct  46   NPGNNLYVTGLSTRVTTNDLEKYFSREGKVVECHLVTDPRTRESRGFGFVTMETLEDADR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITV+K+
Sbjct  106  CIKYLDRSVLEGRLITVQKA  125



>gb|EMT21403.1| Putative RNA-binding protein [Aegilops tauschii]
Length=247

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR  E DLE  FSKEGKVK   +V++PR++ SRGFAFVTM+N +DA R
Sbjct  88   NPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRGFAFVTMENVEDARR  147

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR I+V K+
Sbjct  148  CIKYLHRTVLEGRLISVAKA  167



>ref|XP_006649804.1| PREDICTED: scaffold attachment factor B2-like isoform X2 [Oryza 
brachyantha]
Length=126

 Score =   108 bits (269),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/79 (63%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+RDLE HFS EG+V    +V++P +R SRGF FVTM   ++A R
Sbjct  41   NPGNNLYVTGLSARVTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMATVEEAGR  100

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L+ SVLEGR ITVEK
Sbjct  101  CIKYLDHSVLEGRVITVEK  119



>gb|AFW62088.1| hypothetical protein ZEAMMB73_489339 [Zea mays]
Length=159

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKVK+  +V++PR++ SRGFAFVTMD  + A R
Sbjct  78   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  137

Query  447  CVKHLNQSVLEGRYITVEK  503
             +K+L+++VLEGR +TVEK
Sbjct  138  SIKYLHRTVLEGRLVTVEK  156



>ref|XP_010457907.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=354

 Score =   112 bits (281),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   DANR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDANR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_002992560.1| hypothetical protein SELMODRAFT_49595, partial [Selaginella moellendorffii]
 gb|EFJ06366.1| hypothetical protein SELMODRAFT_49595, partial [Selaginella moellendorffii]
Length=79

 Score =   106 bits (265),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE  LE++F+KEGKV    LV +P +R SRGF FVTMD  +DA+R
Sbjct  1    NPGNNLYVTGLSTRVTESWLEEYFAKEGKVIECCLVTDPLTRESRGFGFVTMDTVEDADR  60

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++S L+GR ITVEK
Sbjct  61   CIKYLHRSNLDGRSITVEK  79



>ref|XP_002280779.2| PREDICTED: serine/arginine-rich splicing factor SR45a [Vitis 
vinifera]
Length=330

 Score =   112 bits (280),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+R+LE HF+ EG V  V LV +P +R SRGF FVTM   ++ANR
Sbjct  46   NPGNNLYVTGLSTRVTKRELEKHFASEGSVADVHLVTDPWTRESRGFGFVTMSTVEEANR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  106  CIKYLDRSVLEGRVITVEKA  125



>gb|ADE75667.1| unknown [Picea sitchensis]
Length=216

 Score =   110 bits (274),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RV E DLE+ FS+EGKV    +VV+PRSR SRGF FVTMD  ++A+R
Sbjct  60   NPGNNLYVTGLSARVVEADLEELFSQEGKVVDCRIVVDPRSRESRGFGFVTMDTLENADR  119

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+S LEGR ITVEK+
Sbjct  120  CVKYLNRSTLEGRIITVEKA  139



>ref|XP_009375025.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
 ref|XP_009375035.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X3 [Pyrus x bretschneideri]
Length=178

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+K+GKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  45   NPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVEDAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  105  CIKYLDRSVLEGRLITVEKA  124



>ref|XP_010685629.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Beta 
vulgaris subsp. vulgaris]
Length=375

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT+R+LE HFS EGKV+ V LV +P ++ SRGF FVTM +  +A+R
Sbjct  45   NPGNNLYVTGLSTRVTKRELEKHFSSEGKVEDVHLVTDPWTKESRGFGFVTMSSLQEADR  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  105  CIKYLDRSVLEGRVITVEKA  124



>emb|CDP12048.1| unnamed protein product [Coffea canephora]
Length=289

 Score =   111 bits (278),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F++EGKV    LV +PR++ SRGFAFVTM+  +DA+R
Sbjct  128  NPGNNLYVTGLSTRVTSSDLEKFFNREGKVTECHLVTDPRTKESRGFAFVTMETNEDADR  187

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SV+EGR ITVEK+
Sbjct  188  CIKYLNRSVMEGRLITVEKA  207



>ref|XP_003530834.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Glycine max]
 gb|KHN01785.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=362

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 54/80 (68%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HFS EGKV  V LVV+P +R SRGF FVTM+  ++A+R
Sbjct  45   NPGNNLYVTGLSPRITKRELEKHFSAEGKVIDVHLVVDPWTRESRGFGFVTMETLEEADR  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  105  CVKYLNRSVLEGRVITVEKA  124



>ref|XP_002279684.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Vitis 
vinifera]
Length=211

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV   DLE +F+ EGKV    LV +PR+R SRGF FVTM+  +DA+R
Sbjct  51   NPGNNLYVTGLSTRVNASDLEKYFNSEGKVVECHLVTDPRTRESRGFGFVTMETVEDADR  110

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  111  CIKYLNRSVLEGRLITVEKA  130



>ref|XP_006476525.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X2 [Citrus sinensis]
Length=201

 Score =   109 bits (273),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R SRGFAFVTM+  + A+R
Sbjct  35   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEGADR  94

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  95   CIKYLNRSVLEGRLITVEKA  114



>ref|XP_007146720.1| hypothetical protein PHAVU_006G064000g [Phaseolus vulgaris]
 gb|ESW18714.1| hypothetical protein PHAVU_006G064000g [Phaseolus vulgaris]
Length=369

 Score =   112 bits (280),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV+ V LVV+P +R SRGF FVTM+  + A+R
Sbjct  49   NPGNNLYVTGLSPRITKRELEKHFAAEGKVRDVHLVVDPWTRESRGFGFVTMETVEVADR  108

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  109  CVKYLNRSVLEGRVITVEKA  128



>ref|XP_007040292.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY24793.1| RNA-binding family protein [Theobroma cacao]
Length=200

 Score =   109 bits (272),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +F  EGKV    LV +PR+R SRGFAFVTM+  + A R
Sbjct  40   NPGNNLYVTGLSTRVTTADLEKYFGNEGKVVECHLVTDPRTRESRGFAFVTMETVEGAER  99

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  100  CIKYLNRSVLEGRLITVEKA  119



>gb|AFW62092.1| hypothetical protein ZEAMMB73_489339 [Zea mays]
Length=191

 Score =   108 bits (271),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKVK+  +V++PR++ SRGFAFVTMD  + A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  447  CVKHLNQSVLEGRYITVEK  503
             +K+L+++VLEGR +TVEK
Sbjct  143  SIKYLHRTVLEGRLVTVEK  161



>ref|XP_006476524.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Citrus sinensis]
Length=213

 Score =   109 bits (273),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R SRGFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESRGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  107  CIKYLNRSVLEGRLITVEKA  126



>ref|XP_002972503.1| hypothetical protein SELMODRAFT_26372, partial [Selaginella moellendorffii]
 gb|EFJ26589.1| hypothetical protein SELMODRAFT_26372, partial [Selaginella moellendorffii]
Length=107

 Score =   106 bits (264),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE  LE++F+KEGKV    LV +P +R SRGF FVTMD  +DA+R
Sbjct  8    NPGNNLYVTGLSTRVTESWLEEYFAKEGKVIECCLVTDPLTRESRGFGFVTMDTVEDADR  67

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++S L+GR ITVEK+
Sbjct  68   CIKYLHRSNLDGRSITVEKA  87



>ref|XP_010235085.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brachypodium 
distachyon]
 ref|XP_010235086.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Brachypodium 
distachyon]
Length=314

 Score =   110 bits (276),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE +LE  FS EGKVK+  +V++PR++ SRGFAFV+MD  +DA R
Sbjct  85   NPGNNLYVTGLSTRVTEAELEKFFSTEGKVKNCHVVLDPRTKESRGFAFVSMDTVEDARR  144

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K L+++VLEGR +TVEK+
Sbjct  145  CIKRLHRTVLEGRLVTVEKA  164



>gb|EYU45746.1| hypothetical protein MIMGU_mgv1a008547mg [Erythranthe guttata]
Length=370

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 68/80 (85%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGL +RVT+RD+E HFS EGKV++V LV++PR+R SRGF FVTM   ++A+R
Sbjct  42   NPGNNLYVTGLPSRVTKRDIEKHFSTEGKVENVHLVIDPRTRESRGFGFVTMSTLEEADR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++V EGR ITVEK+
Sbjct  102  CIKYLDRTVFEGRVITVEKA  121



>ref|XP_003563207.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Brachypodium distachyon]
Length=241

 Score =   109 bits (273),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR +  DLE  FSKEGKVK   +V++PR++ SRGFAFVTMDN +DA R
Sbjct  107  NPGNNLYVTGLSTRTSGDDLEKFFSKEGKVKDCHVVMDPRTKESRGFAFVTMDNIEDARR  166

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR I+V K+
Sbjct  167  CIKYLHRTVLEGRLISVAKA  186



>ref|XP_002520437.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus 
communis]
 gb|EEF41850.1| FUS-interacting serine-arginine-rich protein 1, putative [Ricinus 
communis]
Length=399

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+RDLE HF+ EGKV  V LVV+P +R SRGF FVTM    +A+R
Sbjct  44   NPGNNLYVTGLSPRITKRDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMSTLVEADR  103

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  104  CIKYLNRSVLEGRVITVEKA  123



>ref|XP_003551321.1| PREDICTED: pre-mRNA-splicing factor cwc22-like [Glycine max]
Length=364

 Score =   111 bits (277),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+  ++A R
Sbjct  47   NPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMETLEEAER  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  107  CVKYLNRSVLEGRVITVEKA  126



>ref|XP_004241182.1| PREDICTED: serine/arginine-rich splicing factor SR45a [Solanum 
lycopersicum]
Length=386

 Score =   111 bits (278),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV ERD+E HFS EGKV+ V LV++P +  SRGF FVTM + ++A+R
Sbjct  43   NPGNNLYVTGLSTRVKERDIEKHFSAEGKVEDVRLVLDPWTHESRGFGFVTMSSVEEADR  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K LN+S+LEGR ITVEK+
Sbjct  103  CIKSLNRSILEGRVITVEKA  122



>gb|KJB21247.1| hypothetical protein B456_003G125000 [Gossypium raimondii]
Length=388

 Score =   111 bits (277),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HFS EGKV  V LVV+P +R SRGF FVTM   ++A R
Sbjct  39   NPGNNLYVTGLSHRITKRELEKHFSSEGKVVDVHLVVDPWTRESRGFGFVTMSTIEEAER  98

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  99   CIKYLNRSVLEGRVITVEKA  118



>gb|KHN06265.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=366

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+  ++A R
Sbjct  49   NPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMETLEEAER  108

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+LN+SVLEGR ITVEK+
Sbjct  109  CVKYLNRSVLEGRVITVEKA  128



>ref|XP_002972807.1| hypothetical protein SELMODRAFT_59634, partial [Selaginella moellendorffii]
 gb|EFJ26028.1| hypothetical protein SELMODRAFT_59634, partial [Selaginella moellendorffii]
Length=82

 Score =   105 bits (261),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/79 (59%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRV E+ L +H S+EGKV    +VV+PR++ SRGF FVTM + +DA R
Sbjct  4    NPGNNLYVTGLSTRVAEKQLLEHLSREGKVLECRIVVDPRTKESRGFGFVTMASTEDAER  63

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+ ++N+S LEGR IT+EK
Sbjct  64   CINYMNRSTLEGRIITIEK  82



>ref|XP_010487367.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Camelina sativa]
Length=358

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   D NR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDVNR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>dbj|BAJ89187.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=126

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ L+VTGLS+R+T+RDLE HFS EG+V    +V++P +R SRGF FVTM N  +A R
Sbjct  41   NPGNNLFVTGLSSRLTDRDLEKHFSTEGEVIDASIVLDPWTRESRGFGFVTMANLKEAER  100

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L+ SVLEGR ITVEK
Sbjct  101  CIKYLDSSVLEGRVITVEK  119



>ref|XP_010487375.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Camelina sativa]
Length=356

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG++LYVTGLS RVTERDLEDHFSKEGKV  V LV++P +R SRGF F++++   D NR
Sbjct  42   NPGNSLYVTGLSHRVTERDLEDHFSKEGKVTDVHLVLDPWTRESRGFGFISLETVGDVNR  101

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+++L+ SVL GR I VEK+
Sbjct  102  CIRYLDHSVLLGRVIKVEKA  121



>ref|XP_004294256.1| PREDICTED: serine/arginine-rich splicing factor SR45a isoform 
X1 [Fragaria vesca subsp. vesca]
Length=363

 Score =   110 bits (275),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+N + A+R
Sbjct  49   NPGNNLYVTGLSPRITRRELEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMENVNVADR  108

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  109  CIKYLDRSVLEGRVITVEKA  128



>ref|XP_009375024.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
 ref|XP_009375034.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X2 [Pyrus x bretschneideri]
Length=215

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+K+GKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  45   NPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVEDAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  105  CIKYLDRSVLEGRLITVEKA  124



>gb|AAF79558.1|AC022464_16 F22G5.31 [Arabidopsis thaliana]
Length=415

 Score =   110 bits (276),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 67/83 (81%), Gaps = 3/83 (4%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKV---KSVFLVVEPRSRVSRGFAFVTMDNADD  437
            NPG++LYVTGLS RVTERDLEDHF+KEGKV     V LV++P +R SRGF F++M +  D
Sbjct  104  NPGNSLYVTGLSHRVTERDLEDHFAKEGKVVDVTDVHLVLDPWTRESRGFGFISMKSVGD  163

Query  438  ANRCVKHLNQSVLEGRYITVEKS  506
            ANRC++ L+ SVL+GR ITVEK+
Sbjct  164  ANRCIRSLDHSVLQGRVITVEKA  186



>ref|XP_009375022.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375023.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375031.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
 ref|XP_009375032.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like isoform 
X1 [Pyrus x bretschneideri]
Length=217

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F+K+GKV    LV +PR+R SRGF FVTM+  +DA R
Sbjct  45   NPGNNLYVTGLSTRVTSTDLEKFFNKQGKVLDCHLVTDPRTRESRGFGFVTMETVEDAER  104

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  105  CIKYLDRSVLEGRLITVEKA  124



>ref|XP_010923140.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=363

 Score =   110 bits (275),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 53/80 (66%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS+R+T+ DLE HF+ EGKV  V LVV+P +R SRGF FVTMD   +ANR
Sbjct  46   NPGNNLYVTGLSSRLTKDDLEKHFASEGKVIDVHLVVDPWTRESRGFGFVTMDTVKEANR  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K L++SVLEGR ITVEK+
Sbjct  106  CIKCLDRSVLEGRVITVEKA  125



>ref|XP_006439504.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 ref|XP_006439509.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52744.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52749.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=202

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  35   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  94

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  95   CIKYLNRSVLEGRLITVEK  113



>ref|XP_006439508.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52748.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=218

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  35   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  94

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  95   CIKYLNRSVLEGRLITVEK  113



>gb|KDP46559.1| hypothetical protein JCGZ_08531 [Jatropha curcas]
Length=372

 Score =   110 bits (274),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+RDLE HF+ EG V  V LVV+P +R SRGF FVTM +  +A+R
Sbjct  49   NPGNNLYVTGLSPRITKRDLEKHFASEGTVVDVHLVVDPWTRESRGFGFVTMSSVGEADR  108

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  109  CIKYLNRSVLEGRVITVEKA  128



>ref|XP_006439510.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52750.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=230

 Score =   107 bits (268),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  107  CIKYLNRSVLEGRLITVEK  125



>ref|XP_006439505.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 ref|XP_006439506.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52745.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52746.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=214

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  107  CIKYLNRSVLEGRLITVEK  125



>gb|ACF82503.1| unknown [Zea mays]
 gb|ACL54810.1| unknown [Zea mays]
 gb|AFW62089.1| arginine/serine-rich splicing factor 10 isoform 1 [Zea mays]
 gb|AFW62090.1| arginine/serine-rich splicing factor 10 isoform 2 [Zea mays]
 gb|AFW62091.1| arginine/serine-rich splicing factor 10 isoform 3 [Zea mays]
Length=295

 Score =   108 bits (270),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKVK+  +V++PR++ SRGFAFVTMD  + A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  447  CVKHLNQSVLEGRYITVEKS  506
             +K+L+++VLEGR +TVEK+
Sbjct  143  SIKYLHRTVLEGRLVTVEKA  162



>gb|AAY84876.1| alternative splicing regulator [Triticum aestivum]
Length=250

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR  E DLE  FSKEGKVK   +V++PR++ SR FAFVTM+N +DA R
Sbjct  112  NPGNNLYVTGLSTRTQETDLEKFFSKEGKVKDCRVVIDPRTKESRDFAFVTMENVEDARR  171

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+++VLEGR I+V K+
Sbjct  172  CIKYLHRTVLEGRLISVAKA  191



>ref|NP_001148693.1| LOC100282309 [Zea mays]
 gb|ACG32556.1| arginine/serine-rich splicing factor 10 [Zea mays]
Length=295

 Score =   108 bits (270),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVTE DLE  FSKEGKVK+  +V++PR++ SRGFAFVTMD  + A R
Sbjct  83   NPGNNLYVTGLSTRVTEDDLEKFFSKEGKVKNCHVVLDPRTKESRGFAFVTMDTLEGARR  142

Query  447  CVKHLNQSVLEGRYITVEKS  506
             +K+L+++VLEGR +TVEK+
Sbjct  143  SIKYLHRTVLEGRLVTVEKA  162



>gb|KHG02619.1| Scaffold attachment factor B2 [Gossypium arboreum]
Length=234

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 61/80 (76%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +F  EGKV    LV +P ++ SRGFAFVTM+  + A R
Sbjct  37   NPGNNLYVTGLSTRVTAGDLEKYFGNEGKVLECHLVTDPHTKESRGFAFVTMETVEGAER  96

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK 
Sbjct  97   CIKYLNRSVLEGRLITVEKG  116



>ref|XP_010089074.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXB37321.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=314

 Score =   108 bits (271),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F KEGKV +  LV +P ++ SRGF FVTM+  +DA+R
Sbjct  154  NPGNNLYVTGLSTRVTTSDLEKFFGKEGKVVACHLVTDPHTKESRGFGFVTMETVEDADR  213

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K LN+SVLEGR +TVEK+
Sbjct  214  CIKQLNRSVLEGRLVTVEKA  233



>ref|NP_001049650.1| Os03g0265600 [Oryza sativa Japonica Group]
 dbj|BAF11564.1| Os03g0265600 [Oryza sativa Japonica Group]
Length=125

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT+RDLE HFS EG+V    +V++P +R SRGF FVTM    +A+ 
Sbjct  40   NPGNNLYVTGLSARVTDRDLEKHFSAEGEVIDASIVLDPWTRESRGFGFVTMATVKEADL  99

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  100  CIKYLDRSVLEGRVITVEK  118



>dbj|BAJ99477.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ86812.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93566.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=247

 Score =   107 bits (267),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R  E DLE  FSKEGKVK   +V +PR++ SRGFAFVTM+N +DA R
Sbjct  105  NPGNNLYVTGLSIRTQETDLEKFFSKEGKVKDCRVVTDPRTKESRGFAFVTMENVEDARR  164

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L+ +VLEGR I+V K+
Sbjct  165  CIKYLHHTVLEGRLISVAKA  184



>gb|KJB52108.1| hypothetical protein B456_008G248300 [Gossypium raimondii]
Length=191

 Score =   106 bits (264),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS EGKV    LV +P ++ SRGFAFVTM+  + A R
Sbjct  37   NPGNNLYVTGLSTRVTAVDLEKYFSNEGKVLECHLVTDPHTKESRGFAFVTMETVEGAER  96

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  97   CIKYLNRSVLEGRLITVEKA  116



>gb|KCW52572.1| hypothetical protein EUGRSUZ_J01947 [Eucalyptus grandis]
Length=338

 Score =   108 bits (270),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM   ++A R
Sbjct  43   NPGNNLYVTGLSPRITKRELEKHFASEGKVVDVHLVVDPWTRESRGFGFVTMSTVEEAER  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  103  CIKYLDRSVLEGRVITVEKA  122



>ref|XP_004500218.1| PREDICTED: pre-mRNA-splicing factor cwc22-like [Cicer arietinum]
Length=359

 Score =   108 bits (271),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM+  ++A+R
Sbjct  47   NPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRASRGFGFVTMETLEEADR  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            CVK+L++SVLEGR I VEK+
Sbjct  107  CVKYLDRSVLEGRVIMVEKA  126



>ref|XP_006439507.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52747.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=274

 Score =   107 bits (268),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  35   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  94

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  95   CIKYLNRSVLEGRLITVEK  113



>ref|XP_004984684.1| PREDICTED: serine/arginine repetitive matrix protein 2-like isoform 
X3 [Setaria italica]
Length=122

 Score =   103 bits (258),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/79 (62%), Positives = 62/79 (78%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT++DLE HFS EG+V    +V +P +R SRGF FVTM    +A+R
Sbjct  37   NPGNNLYVTGLSARVTDQDLEKHFSTEGEVIDASIVHDPWTRESRGFGFVTMATVKEADR  96

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+L++SVLEGR ITVEK
Sbjct  97   CIKYLDRSVLEGRVITVEK  115



>ref|XP_010935769.1| PREDICTED: serine/arginine-rich splicing factor SR45a-like [Elaeis 
guineensis]
Length=203

 Score =   106 bits (264),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS RVT  DLE +FSKEG+V+   +V +PR++ SRGF FVTM+   DA+ 
Sbjct  46   NPGNNLYVTGLSARVTSSDLEKYFSKEGRVQECHVVKDPRTKESRGFGFVTMETVGDADC  105

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN SVLEGR ITVEK+
Sbjct  106  CIKYLNHSVLEGRLITVEKA  125



>ref|XP_006848090.1| hypothetical protein AMTR_s00029p00209460 [Amborella trichopoda]
 gb|ERN09671.1| hypothetical protein AMTR_s00029p00209460 [Amborella trichopoda]
Length=382

 Score =   108 bits (270),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS+R T RDLE HF+ EG V    LVV+PR+R SRGF FVTM   ++A+R
Sbjct  41   NPGNNLYVTGLSSRATSRDLEKHFASEGTVTDCHLVVDPRTRESRGFGFVTMSTVEEADR  100

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVEK+
Sbjct  101  CLKYLDRSVLEGRVITVEKA  120



>ref|XP_006439511.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
 gb|ESR52751.1| hypothetical protein CICLE_v10021507mg [Citrus clementina]
Length=286

 Score =   107 bits (268),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/79 (66%), Positives = 61/79 (77%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  107  CIKYLNRSVLEGRLITVEK  125



>gb|KJB52106.1| hypothetical protein B456_008G248300 [Gossypium raimondii]
 gb|KJB52107.1| hypothetical protein B456_008G248300 [Gossypium raimondii]
 gb|KJB52109.1| hypothetical protein B456_008G248300 [Gossypium raimondii]
Length=197

 Score =   105 bits (263),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE +FS EGKV    LV +P ++ SRGFAFVTM+  + A R
Sbjct  37   NPGNNLYVTGLSTRVTAVDLEKYFSNEGKVLECHLVTDPHTKESRGFAFVTMETVEGAER  96

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  97   CIKYLNRSVLEGRLITVEKA  116



>gb|KDO76279.1| hypothetical protein CISIN_1g028130mg [Citrus sinensis]
Length=201

 Score =   105 bits (262),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  35   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  94

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  95   CIKYLNRSVLEGRLITVEKA  114



>gb|KDO76280.1| hypothetical protein CISIN_1g028130mg [Citrus sinensis]
Length=213

 Score =   105 bits (262),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/80 (65%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTRVT  DLE  F  EGKV    LV +PR+R S GFAFVTM+  + A+R
Sbjct  47   NPGNNLYVTGLSTRVTNADLEKFFGGEGKVTECHLVTDPRTRESCGFAFVTMETVEGADR  106

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  107  CIKYLNRSVLEGRLITVEKA  126



>gb|KDO66764.1| hypothetical protein CISIN_1g016540mg [Citrus sinensis]
Length=387

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 66/80 (83%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EGKV  V LVV+P +R SRGF FVTM   ++A+R
Sbjct  41   NPGNNLYVTGLSPRITKRELEKHFAAEGKVIDVHLVVDPWTRESRGFGFVTMATVEEADR  100

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+L++SVLEGR ITVE++
Sbjct  101  CIKYLDRSVLEGRIITVERA  120



>ref|XP_003536651.1| PREDICTED: uncharacterized RNA-binding protein C25G10.01-like 
isoform X1 [Glycine max]
 gb|KHN06726.1| Putative RNA-binding protein C25G10.01 [Glycine soja]
Length=191

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/80 (63%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLSTR+T+ DL  +FSKEGKV    LV +P ++ SRGF FVTM+  DDA  
Sbjct  43   NPGNNLYVTGLSTRITDSDLHKYFSKEGKVVDCHLVKDPHTKESRGFGFVTMETNDDAEC  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SV EGR ITVEK+
Sbjct  103  CIKYLNRSVFEGRLITVEKA  122



>ref|XP_007016194.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY33813.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=390

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/79 (65%), Positives = 63/79 (80%), Gaps = 0/79 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EG V  V LVV+P +R SRGF FVTM   ++A R
Sbjct  43   NPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEEAER  102

Query  447  CVKHLNQSVLEGRYITVEK  503
            C+K+LN+SVLEGR ITVEK
Sbjct  103  CIKYLNRSVLEGRVITVEK  121



>ref|XP_007016197.1| RNA-binding family protein isoform 4 [Theobroma cacao]
 gb|EOY33816.1| RNA-binding family protein isoform 4 [Theobroma cacao]
Length=385

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 51/80 (64%), Positives = 64/80 (80%), Gaps = 0/80 (0%)
 Frame = +3

Query  267  NPGDTLYVTGLSTRVTERDLEDHFSKEGKVKSVFLVVEPRSRVSRGFAFVTMDNADDANR  446
            NPG+ LYVTGLS R+T+R+LE HF+ EG V  V LVV+P +R SRGF FVTM   ++A R
Sbjct  43   NPGNNLYVTGLSPRITKRELEKHFASEGNVIDVHLVVDPWTRESRGFGFVTMATNEEAER  102

Query  447  CVKHLNQSVLEGRYITVEKS  506
            C+K+LN+SVLEGR ITVEK+
Sbjct  103  CIKYLNRSVLEGRVITVEKA  122



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559877061510