BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C14

Length=590
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001274713.1|  leucine-rich repeat receptor-like serine/thr...    207   2e-58   Solanum lycopersicum
dbj|BAK52390.1|  leucine rich repeat receptor protein kinase CLAV...    207   2e-58   Solanum peruvianum [Peruvian tomato]
dbj|BAK52389.1|  leucine rich repeat receptor protein kinase CLAV...    205   1e-57   Solanum pennellii
ref|XP_010271550.1|  PREDICTED: leucine-rich repeat receptor-like...    205   1e-57   Nelumbo nucifera [Indian lotus]
ref|XP_011073654.1|  PREDICTED: leucine-rich repeat receptor-like...    205   1e-57   Sesamum indicum [beniseed]
ref|XP_009613990.1|  PREDICTED: leucine-rich repeat receptor-like...    205   2e-57   Nicotiana tomentosiformis
ref|XP_006357743.1|  PREDICTED: leucine-rich repeat receptor-like...    203   7e-57   Solanum tuberosum [potatoes]
emb|CDP02660.1|  unnamed protein product                                202   3e-56   Coffea canephora [robusta coffee]
ref|XP_011099433.1|  PREDICTED: leucine-rich repeat receptor-like...    201   4e-56   Sesamum indicum [beniseed]
ref|XP_010268646.1|  PREDICTED: leucine-rich repeat receptor-like...    200   1e-55   Nelumbo nucifera [Indian lotus]
ref|XP_009771232.1|  PREDICTED: leucine-rich repeat receptor-like...    199   2e-55   Nicotiana sylvestris
gb|AIT56194.1|  leucine-rich repeat receptor-like serine/threonin...    199   2e-55   Dimocarpus longan [longan]
ref|XP_006364007.1|  PREDICTED: leucine-rich repeat receptor-like...    199   3e-55   Solanum tuberosum [potatoes]
ref|XP_004234641.1|  PREDICTED: leucine-rich repeat receptor-like...    199   3e-55   Solanum lycopersicum
ref|XP_009786199.1|  PREDICTED: leucine-rich repeat receptor-like...    198   4e-55   Nicotiana sylvestris
ref|XP_009605676.1|  PREDICTED: leucine-rich repeat receptor-like...    195   8e-54   Nicotiana tomentosiformis
ref|XP_010105101.1|  Leucine-rich repeat receptor-like serine/thr...    194   2e-53   Morus notabilis
emb|CBI35733.3|  unnamed protein product                                192   3e-53   Vitis vinifera
gb|EYU41357.1|  hypothetical protein MIMGU_mgv1a000718mg                193   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_003635561.1|  PREDICTED: leucine-rich repeat receptor-like...    192   8e-53   Vitis vinifera
ref|XP_009375880.1|  PREDICTED: leucine-rich repeat receptor-like...    191   2e-52   Pyrus x bretschneideri [bai li]
ref|XP_009354585.1|  PREDICTED: leucine-rich repeat receptor-like...    189   1e-51   Pyrus x bretschneideri [bai li]
ref|XP_008344369.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    189   2e-51   
ref|XP_007208421.1|  hypothetical protein PRUPE_ppa000739mg             188   3e-51   Prunus persica
gb|KDO78771.1|  hypothetical protein CISIN_1g001816mg                   187   4e-51   Citrus sinensis [apfelsine]
ref|XP_006426178.1|  hypothetical protein CICLE_v10024796mg             187   4e-51   Citrus clementina [clementine]
ref|XP_006466390.1|  PREDICTED: leucine-rich repeat receptor-like...    187   5e-51   Citrus sinensis [apfelsine]
ref|XP_008393812.1|  PREDICTED: leucine-rich repeat receptor-like...    187   7e-51   
ref|XP_002875982.1|  hypothetical protein ARALYDRAFT_906265             186   8e-51   Arabidopsis lyrata subsp. lyrata
ref|XP_008354741.1|  PREDICTED: leucine-rich repeat receptor-like...    185   3e-50   
ref|NP_001235080.1|  receptor-like protein kinase 3 precursor           184   1e-49   
ref|XP_006404116.1|  hypothetical protein EUTSA_v10010092mg             182   2e-49   
ref|NP_190536.1|  CLAVATA1-related receptor kinase-like protein         181   5e-49   Arabidopsis thaliana [mouse-ear cress]
gb|KFK34238.1|  hypothetical protein AALP_AA5G119100                    180   1e-48   Arabis alpina [alpine rockcress]
ref|XP_006290548.1|  hypothetical protein CARUB_v10016631mg             179   6e-48   Capsella rubella
ref|XP_010028033.1|  PREDICTED: leucine-rich repeat receptor-like...    179   6e-48   Eucalyptus grandis [rose gum]
ref|XP_004511796.1|  PREDICTED: leucine-rich repeat receptor-like...    178   7e-48   
ref|XP_004288299.1|  PREDICTED: leucine-rich repeat receptor-like...    177   1e-47   Fragaria vesca subsp. vesca
ref|XP_002310320.2|  hypothetical protein POPTR_0007s14500g             177   2e-47   Populus trichocarpa [western balsam poplar]
ref|NP_001237715.1|  receptor-like protein kinase 2 precursor           177   2e-47   Glycine max [soybeans]
ref|XP_010484412.1|  PREDICTED: leucine-rich repeat receptor-like...    176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010444585.1|  PREDICTED: leucine-rich repeat receptor-like...    176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010463501.1|  PREDICTED: leucine-rich repeat receptor-like...    176   3e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010426489.1|  PREDICTED: leucine-rich repeat receptor-like...    176   6e-47   Camelina sativa [gold-of-pleasure]
ref|XP_010515326.1|  PREDICTED: leucine-rich repeat receptor-like...    175   9e-47   Camelina sativa [gold-of-pleasure]
ref|XP_011021820.1|  PREDICTED: leucine-rich repeat receptor-like...    175   9e-47   Populus euphratica
ref|NP_201371.1|  leucine-rich repeat receptor-like serine/threon...    175   1e-46   Arabidopsis thaliana [mouse-ear cress]
gb|EPS74129.1|  hypothetical protein M569_00625                         174   1e-46   Genlisea aurea
ref|XP_002864974.1|  hypothetical protein ARALYDRAFT_496807             174   1e-46   
ref|XP_006279943.1|  hypothetical protein CARUB_v10025808mg             174   2e-46   Capsella rubella
ref|XP_010547579.1|  PREDICTED: leucine-rich repeat receptor-like...    174   3e-46   Tarenaya hassleriana [spider flower]
ref|XP_006393995.1|  hypothetical protein EUTSA_v10003584mg             174   3e-46   
ref|XP_004143422.1|  PREDICTED: leucine-rich repeat receptor-like...    173   4e-46   Cucumis sativus [cucumbers]
gb|KDP32143.1|  hypothetical protein JCGZ_12604                         173   4e-46   Jatropha curcas
gb|KJB18115.1|  hypothetical protein B456_003G034500                    173   5e-46   Gossypium raimondii
gb|KJB18113.1|  hypothetical protein B456_003G034400                    173   5e-46   Gossypium raimondii
gb|KJB48795.1|  hypothetical protein B456_008G087500                    172   7e-46   Gossypium raimondii
ref|XP_009150662.1|  PREDICTED: leucine-rich repeat receptor-like...    172   1e-45   Brassica rapa
gb|KHG03710.1|  Leucine-rich repeat receptor-like serine/threonin...    172   1e-45   Gossypium arboreum [tree cotton]
gb|KHG04200.1|  Leucine-rich repeat receptor-like serine/threonin...    171   2e-45   Gossypium arboreum [tree cotton]
ref|XP_007047661.1|  Leucine-rich receptor-like protein kinase fa...    171   2e-45   
ref|NP_001235065.1|  receptor-like protein kinase 1 precursor           171   3e-45   Glycine max [soybeans]
ref|XP_004509039.1|  PREDICTED: leucine-rich repeat receptor-like...    170   4e-45   Cicer arietinum [garbanzo]
ref|XP_010683073.1|  PREDICTED: leucine-rich repeat receptor-like...    170   6e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010503631.1|  PREDICTED: leucine-rich repeat receptor-like...    169   2e-44   Camelina sativa [gold-of-pleasure]
ref|NP_001237688.1|  receptor-like protein kinase precursor             169   2e-44   Glycine max [soybeans]
gb|KFK28239.1|  hypothetical protein AALP_AA8G490400                    168   2e-44   Arabis alpina [alpine rockcress]
ref|XP_007155783.1|  hypothetical protein PHAVU_003G231400g             167   7e-44   Phaseolus vulgaris [French bean]
ref|XP_002531999.1|  Receptor protein kinase CLAVATA1 precursor, ...    166   1e-43   Ricinus communis
ref|XP_009397330.1|  PREDICTED: leucine-rich repeat receptor-like...    160   1e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010518800.1|  PREDICTED: leucine-rich repeat receptor-like...    160   1e-41   Tarenaya hassleriana [spider flower]
ref|XP_009136515.1|  PREDICTED: leucine-rich repeat receptor-like...    160   2e-41   Brassica rapa
ref|XP_009394785.1|  PREDICTED: leucine-rich repeat receptor-like...    160   2e-41   
ref|XP_008787359.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    159   5e-41   
ref|XP_010939309.1|  PREDICTED: leucine-rich repeat receptor-like...    158   7e-41   Elaeis guineensis
ref|XP_008441113.1|  PREDICTED: leucine-rich repeat receptor-like...    158   8e-41   Cucumis melo [Oriental melon]
ref|XP_006852730.1|  hypothetical protein AMTR_s00033p00083200          158   9e-41   
ref|XP_010941985.1|  PREDICTED: leucine-rich repeat receptor-like...    158   1e-40   Elaeis guineensis
gb|AES94465.2|  LRR receptor-like kinase family protein                 155   7e-40   Medicago truncatula
ref|XP_003611507.1|  Receptor-like protein kinase                       155   8e-40   
ref|XP_009394620.1|  PREDICTED: leucine-rich repeat receptor-like...    154   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009408581.1|  PREDICTED: leucine-rich repeat receptor-like...    154   3e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007156674.1|  hypothetical protein PHAVU_002G007600g             152   2e-38   Phaseolus vulgaris [French bean]
emb|CDY08759.1|  BnaA06g24650D                                          149   9e-38   Brassica napus [oilseed rape]
ref|XP_010675918.1|  PREDICTED: leucine-rich repeat receptor-like...    147   6e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003608587.1|  Receptor-like protein kinase                       147   8e-37   Medicago truncatula
gb|ADB85326.1|  putative receptor protein kinase                        139   9e-37   Phyllostachys edulis [kikko-chiku]
ref|XP_008237309.1|  PREDICTED: leucine-rich repeat receptor-like...    147   9e-37   
ref|XP_009395647.1|  PREDICTED: leucine-rich repeat receptor-like...    145   3e-36   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685023.1|  PREDICTED: receptor-like protein 12                143   9e-36   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008790445.1|  PREDICTED: leucine-rich repeat receptor-like...    144   1e-35   Phoenix dactylifera
ref|XP_010936307.1|  PREDICTED: leucine-rich repeat receptor-like...    143   1e-35   
ref|XP_009396449.1|  PREDICTED: leucine-rich repeat receptor-like...    141   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ84911.1|  predicted protein                                      138   9e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008787754.1|  PREDICTED: leucine-rich repeat receptor-like...    136   4e-33   Phoenix dactylifera
ref|XP_008440463.1|  PREDICTED: leucine-rich repeat receptor-like...    136   5e-33   Cucumis melo [Oriental melon]
ref|XP_004160944.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    135   1e-32   
ref|XP_004143533.1|  PREDICTED: leucine-rich repeat receptor-like...    135   1e-32   Cucumis sativus [cucumbers]
ref|XP_009411355.1|  PREDICTED: leucine-rich repeat receptor-like...    134   4e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006650665.1|  PREDICTED: leucine-rich repeat receptor-like...    133   6e-32   Oryza brachyantha
ref|NP_001058840.2|  Os07g0134200                                       131   2e-31   
gb|EAZ02682.1|  hypothetical protein OsI_24796                          131   3e-31   Oryza sativa Indica Group [Indian rice]
dbj|BAC82955.1|  putative OsLRK1(receptor-type protein kinase)          131   3e-31   Oryza sativa Japonica Group [Japonica rice]
tpg|DAA59489.1|  TPA: putative leucine-rich repeat receptor-like ...    129   1e-30   
ref|XP_002985227.1|  hypothetical protein SELMODRAFT_121783             129   2e-30   
ref|XP_004955422.1|  PREDICTED: leucine-rich repeat receptor-like...    128   2e-30   
ref|XP_002466378.1|  hypothetical protein SORBIDRAFT_01g006690          128   4e-30   Sorghum bicolor [broomcorn]
ref|XP_008665503.1|  PREDICTED: leucine-rich repeat receptor-like...    128   4e-30   Zea mays [maize]
gb|AAF73373.1|AF193835_1  LRK1 protein                                  127   5e-30   Oryza sativa [red rice]
emb|CDY02112.1|  BnaA03g40550D                                          127   6e-30   
ref|XP_010260843.1|  PREDICTED: leucine-rich repeat receptor-like...    127   6e-30   Nelumbo nucifera [Indian lotus]
ref|XP_010943209.1|  PREDICTED: LOW QUALITY PROTEIN: leucine-rich...    127   7e-30   
ref|XP_011045060.1|  PREDICTED: receptor protein kinase CLAVATA1-...    127   9e-30   Populus euphratica
gb|AHJ14779.1|  CLAVATA1                                                126   1e-29   Rhododendron ovatum
emb|CDY23037.1|  BnaC07g31500D                                          126   1e-29   Brassica napus [oilseed rape]
ref|XP_010266811.1|  PREDICTED: receptor protein kinase CLAVATA1        126   1e-29   
ref|XP_002307734.1|  receptor protein kinase                            126   2e-29   Populus trichocarpa [western balsam poplar]
ref|XP_002461427.1|  hypothetical protein SORBIDRAFT_02g002450          126   2e-29   Sorghum bicolor [broomcorn]
ref|XP_007017845.1|  Leucine-rich receptor-like protein kinase fa...    125   3e-29   
ref|XP_004981595.1|  PREDICTED: leucine-rich repeat receptor-like...    125   4e-29   Setaria italica
ref|XP_008357152.1|  PREDICTED: receptor protein kinase CLAVATA1-...    124   8e-29   
ref|XP_008364929.1|  PREDICTED: receptor protein kinase CLAVATA1-...    124   1e-28   
emb|CDY45620.1|  BnaCnng13280D                                          122   3e-28   Brassica napus [oilseed rape]
ref|XP_006853709.1|  hypothetical protein AMTR_s00056p00150470          122   3e-28   Amborella trichopoda
ref|XP_004291349.1|  PREDICTED: receptor protein kinase CLAVATA1        122   3e-28   Fragaria vesca subsp. vesca
ref|XP_009405747.1|  PREDICTED: leucine-rich repeat receptor-like...    122   3e-28   
ref|XP_002510557.1|  Receptor protein kinase CLAVATA1 precursor, ...    122   4e-28   
dbj|BAJ89729.1|  predicted protein                                      122   4e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KEH33614.1|  LRR receptor-like kinase family protein                 122   5e-28   Medicago truncatula
ref|XP_004295533.1|  PREDICTED: leucine-rich repeat receptor-like...    121   6e-28   Fragaria vesca subsp. vesca
ref|XP_009334873.1|  PREDICTED: receptor protein kinase CLAVATA1        121   8e-28   Pyrus x bretschneideri [bai li]
emb|CDP04113.1|  unnamed protein product                                121   9e-28   Coffea canephora [robusta coffee]
ref|XP_009418700.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002300697.2|  receptor protein kinase                            120   9e-28   
ref|XP_011004294.1|  PREDICTED: leucine-rich repeat receptor-like...    121   9e-28   Populus euphratica
emb|CBI19895.3|  unnamed protein product                                120   1e-27   Vitis vinifera
ref|XP_002279563.1|  PREDICTED: receptor protein kinase CLAVATA1        120   1e-27   Vitis vinifera
ref|XP_001752668.1|  CLL1B clavata1-like receptor S/T protein kin...    120   1e-27   
ref|XP_008387933.1|  PREDICTED: receptor protein kinase CLAVATA1        120   1e-27   Malus domestica [apple tree]
ref|XP_007214567.1|  hypothetical protein PRUPE_ppa000837mg             120   1e-27   Prunus persica
ref|XP_011004295.1|  PREDICTED: leucine-rich repeat receptor-like...    120   1e-27   Populus euphratica
ref|XP_002264952.1|  PREDICTED: leucine-rich repeat receptor-like...    120   1e-27   Vitis vinifera
gb|ABF99108.1|  Receptor protein kinase CLAVATA1 precursor, putat...    119   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008808401.1|  PREDICTED: leucine-rich repeat receptor-like...    119   3e-27   Phoenix dactylifera
gb|KDO84901.1|  hypothetical protein CISIN_1g002010mg                   119   3e-27   Citrus sinensis [apfelsine]
ref|XP_001754727.1|  CLL1A clavata1-like receptor S/T protein kin...    119   3e-27   
gb|EAY92008.1|  hypothetical protein OsI_13698                          119   3e-27   Oryza sativa Indica Group [Indian rice]
gb|AAP68887.1|  putative receptor-like protein kinase 1                 119   3e-27   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006435205.1|  hypothetical protein CICLE_v10000156mg             119   3e-27   Citrus clementina [clementine]
ref|XP_006856744.1|  hypothetical protein AMTR_s00055p00012250          119   3e-27   
gb|KFK42020.1|  hypothetical protein AALP_AA2G201900                    119   6e-27   Arabis alpina [alpine rockcress]
ref|XP_010471715.1|  PREDICTED: receptor protein kinase CLAVATA1 ...    119   6e-27   
ref|XP_002970036.1|  hypothetical protein SELMODRAFT_146738             119   6e-27   
ref|XP_009108464.1|  PREDICTED: leucine-rich repeat receptor-like...    118   6e-27   Brassica rapa
ref|XP_003558681.1|  PREDICTED: leucine-rich repeat receptor-like...    118   6e-27   Brachypodium distachyon [annual false brome]
ref|XP_009415746.1|  PREDICTED: leucine-rich repeat receptor-like...    118   7e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004238370.1|  PREDICTED: receptor protein kinase CLAVATA1        118   8e-27   Solanum lycopersicum
ref|XP_006473681.1|  PREDICTED: receptor protein kinase CLAVATA1-...    118   8e-27   Citrus sinensis [apfelsine]
ref|XP_007040964.1|  Leucine-rich receptor-like protein kinase fa...    118   9e-27   
gb|KJB29653.1|  hypothetical protein B456_005G112100                    117   1e-26   Gossypium raimondii
ref|XP_010428620.1|  PREDICTED: receptor protein kinase CLAVATA1-...    117   1e-26   Camelina sativa [gold-of-pleasure]
gb|EEE60014.1|  hypothetical protein OsJ_12761                          117   2e-26   Oryza sativa Japonica Group [Japonica rice]
ref|XP_008225951.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   Prunus mume [ume]
ref|XP_010935096.1|  PREDICTED: leucine-rich repeat receptor-like...    117   2e-26   Elaeis guineensis
ref|XP_006300675.1|  hypothetical protein CARUB_v10019714mg             117   2e-26   Capsella rubella
ref|XP_008221401.1|  PREDICTED: receptor protein kinase CLAVATA1        117   2e-26   
ref|XP_007225356.1|  hypothetical protein PRUPE_ppa000916mg             117   2e-26   
ref|XP_009399076.1|  PREDICTED: leucine-rich repeat receptor-like...    117   3e-26   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP36903.1|  hypothetical protein JCGZ_08194                         117   3e-26   Jatropha curcas
ref|XP_011035024.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   3e-26   Populus euphratica
ref|XP_004499483.1|  PREDICTED: leucine-rich repeat receptor-like...    116   3e-26   Cicer arietinum [garbanzo]
emb|CDX73202.1|  BnaC06g36500D                                          116   4e-26   
ref|XP_002304615.1|  leucine-rich repeat transmembrane protein ki...    116   4e-26   Populus trichocarpa [western balsam poplar]
ref|XP_010246813.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   5e-26   Nelumbo nucifera [Indian lotus]
ref|XP_010416487.1|  PREDICTED: receptor protein kinase CLAVATA1-...    116   5e-26   Camelina sativa [gold-of-pleasure]
emb|CDX87661.1|  BnaA07g32120D                                          115   5e-26   
ref|XP_008808621.1|  PREDICTED: leucine-rich repeat receptor-like...    115   8e-26   
ref|XP_009106236.1|  PREDICTED: receptor protein kinase CLAVATA1        115   9e-26   Brassica rapa
gb|KJB59753.1|  hypothetical protein B456_009G269700                    114   9e-26   Gossypium raimondii
ref|XP_002297907.2|  leucine-rich repeat transmembrane protein ki...    115   9e-26   Populus trichocarpa [western balsam poplar]
ref|XP_011022287.1|  PREDICTED: leucine-rich repeat receptor-like...    115   9e-26   Populus euphratica
ref|XP_010690942.1|  PREDICTED: probable LRR receptor-like serine...    114   2e-25   Beta vulgaris subsp. vulgaris [field beet]
gb|AAP49010.1|  CLV1-like receptor kinase                               114   2e-25   Brassica napus [oilseed rape]
ref|XP_009345734.1|  PREDICTED: putative receptor-like protein ki...    114   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_009368577.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-25   Pyrus x bretschneideri [bai li]
ref|XP_011035001.1|  PREDICTED: receptor protein kinase CLAVATA1-...    114   2e-25   Populus euphratica
gb|ADD64789.1|  CLAVATA1                                                114   2e-25   Brassica napus [oilseed rape]
ref|XP_004960969.1|  PREDICTED: leucine-rich repeat receptor-like...    114   2e-25   Setaria italica
ref|XP_006448558.1|  hypothetical protein CICLE_v10014145mg             114   3e-25   Citrus clementina [clementine]
ref|XP_006283067.1|  hypothetical protein CARUB_v10004060mg             114   3e-25   Capsella rubella
gb|KHG24572.1|  Receptor protein kinase CLAVATA1                        113   3e-25   Gossypium arboreum [tree cotton]
ref|XP_011036960.1|  PREDICTED: probable LRR receptor-like serine...    113   4e-25   Populus euphratica
ref|XP_010676066.1|  PREDICTED: LRR receptor-like serine/threonin...    113   4e-25   Beta vulgaris subsp. vulgaris [field beet]
emb|CAN71863.1|  hypothetical protein VITISV_023530                     113   4e-25   Vitis vinifera
ref|XP_008349109.1|  PREDICTED: leucine-rich repeat receptor-like...    113   4e-25   Malus domestica [apple tree]
ref|XP_003557615.1|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-25   Brachypodium distachyon [annual false brome]
emb|CBI29704.3|  unnamed protein product                                113   5e-25   Vitis vinifera
ref|XP_002889046.1|  hypothetical protein ARALYDRAFT_476729             113   5e-25   
ref|XP_002263291.2|  PREDICTED: leucine-rich repeat receptor-like...    113   5e-25   Vitis vinifera
ref|XP_010110004.1|  Receptor protein kinase CLAVATA1                   112   6e-25   
ref|XP_009393965.1|  PREDICTED: leucine-rich repeat receptor-like...    112   6e-25   
gb|KCW58273.1|  hypothetical protein EUGRSUZ_H00964                     112   7e-25   Eucalyptus grandis [rose gum]
ref|XP_010026074.1|  PREDICTED: receptor protein kinase CLAVATA1        112   7e-25   Eucalyptus grandis [rose gum]
ref|XP_006390268.1|  hypothetical protein EUTSA_v10018069mg             112   7e-25   Eutrema salsugineum [saltwater cress]
ref|XP_003530709.1|  PREDICTED: leucine-rich repeat receptor-like...    112   8e-25   Glycine max [soybeans]
ref|XP_008799579.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-24   Phoenix dactylifera
ref|XP_008812886.1|  PREDICTED: probable LRR receptor-like serine...    112   1e-24   Phoenix dactylifera
ref|XP_006413888.1|  hypothetical protein EUTSA_v10024310mg             112   1e-24   Eutrema salsugineum [saltwater cress]
ref|XP_006468612.1|  PREDICTED: leucine-rich repeat receptor-like...    112   1e-24   Citrus sinensis [apfelsine]
ref|XP_006468613.1|  PREDICTED: leucine-rich repeat receptor-like...    111   1e-24   Citrus sinensis [apfelsine]
ref|XP_011019593.1|  PREDICTED: probably inactive leucine-rich re...    111   2e-24   Populus euphratica
ref|XP_002526451.1|  Receptor protein kinase CLAVATA1 precursor, ...    111   2e-24   Ricinus communis
ref|XP_010918071.1|  PREDICTED: leucine-rich repeat receptor-like...    111   2e-24   Elaeis guineensis
gb|AAB58929.1|  CLV1 receptor kinase                                    111   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|NP_177710.1|  receptor protein kinase CLAVATA1                      111   2e-24   Arabidopsis thaliana [mouse-ear cress]
pir||E96787  protein T4O12.5 [imported] - Arabidopsis thaliana          111   2e-24
gb|AAD02501.1|  receptor kinase                                         111   2e-24   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002305057.2|  hypothetical protein POPTR_0004s05880g             111   2e-24   
ref|XP_010539846.1|  PREDICTED: receptor protein kinase CLAVATA1        110   4e-24   Tarenaya hassleriana [spider flower]
emb|CDP18494.1|  unnamed protein product                                110   4e-24   Coffea canephora [robusta coffee]
gb|KCW60108.1|  hypothetical protein EUGRSUZ_H02842                     110   4e-24   Eucalyptus grandis [rose gum]
ref|XP_010026766.1|  PREDICTED: putative receptor-like protein ki...    110   4e-24   
ref|XP_006382632.1|  hypothetical protein POPTR_0005s03970g             110   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_010277679.1|  PREDICTED: LRR receptor-like serine/threonin...    110   5e-24   Nelumbo nucifera [Indian lotus]
gb|KJB58082.1|  hypothetical protein B456_009G193600                    110   5e-24   Gossypium raimondii
ref|XP_011083584.1|  PREDICTED: receptor protein kinase CLAVATA1        110   5e-24   Sesamum indicum [beniseed]
ref|XP_002308597.2|  hypothetical protein POPTR_0006s25380g             109   7e-24   
gb|KHG26020.1|  Receptor protein kinase CLAVATA1                        109   7e-24   Gossypium arboreum [tree cotton]
ref|XP_008793129.1|  PREDICTED: leucine-rich repeat receptor-like...    109   7e-24   
ref|XP_009415213.1|  PREDICTED: leucine-rich repeat receptor-like...    109   7e-24   
ref|XP_008356104.1|  PREDICTED: leucine-rich repeat receptor-like...    109   8e-24   
ref|XP_007131794.1|  hypothetical protein PHAVU_011G042100g             108   8e-24   Phaseolus vulgaris [French bean]
ref|XP_010999778.1|  PREDICTED: probable LRR receptor-like serine...    109   9e-24   Populus euphratica
ref|XP_009415217.1|  PREDICTED: leucine-rich repeat receptor-like...    109   1e-23   
ref|XP_010668145.1|  PREDICTED: receptor protein kinase CLAVATA1-...    108   1e-23   
ref|XP_008791706.1|  PREDICTED: putative receptor-like protein ki...    109   1e-23   
ref|XP_010449207.1|  PREDICTED: leucine-rich repeat receptor-like...    109   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_002971751.1|  hypothetical protein SELMODRAFT_172284             109   1e-23   
ref|XP_002991545.1|  hypothetical protein SELMODRAFT_186143             109   1e-23   
ref|XP_008811184.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    108   1e-23   Phoenix dactylifera
ref|XP_010520745.1|  PREDICTED: putative receptor-like protein ki...    108   1e-23   Tarenaya hassleriana [spider flower]
ref|XP_002532709.1|  Receptor protein kinase CLAVATA1 precursor, ...    108   2e-23   Ricinus communis
ref|XP_010439602.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Camelina sativa [gold-of-pleasure]
ref|XP_011035599.1|  PREDICTED: probable LRR receptor-like serine...    108   2e-23   Populus euphratica
ref|XP_011092305.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Sesamum indicum [beniseed]
gb|KJB32927.1|  hypothetical protein B456_005G268400                    108   2e-23   Gossypium raimondii
ref|XP_010030176.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Eucalyptus grandis [rose gum]
dbj|BAI82122.1|  CLV1-like LRR receptor kinase                          108   2e-23   Silene latifolia
ref|XP_009363288.1|  PREDICTED: leucine-rich repeat receptor-like...    108   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_008647501.1|  PREDICTED: uncharacterized LOC100272700 isof...    108   2e-23   Zea mays [maize]
ref|XP_008647502.1|  PREDICTED: uncharacterized LOC100272700 isof...    108   2e-23   
ref|XP_008647500.1|  PREDICTED: uncharacterized LOC100272700 isof...    108   3e-23   
ref|XP_003545159.1|  PREDICTED: leucine-rich repeat receptor-like...    108   3e-23   Glycine max [soybeans]
ref|XP_008351784.1|  PREDICTED: putative receptor-like protein ki...    108   3e-23   
ref|XP_010905760.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    107   3e-23   Elaeis guineensis
ref|XP_004155230.1|  PREDICTED: leucine-rich repeat receptor-like...    107   4e-23   
ref|XP_006663536.1|  PREDICTED: probable LRR receptor-like serine...    107   4e-23   Oryza brachyantha
ref|XP_009409684.1|  PREDICTED: putative receptor-like protein ki...    107   4e-23   
ref|XP_007131793.1|  hypothetical protein PHAVU_011G042000g             107   5e-23   Phaseolus vulgaris [French bean]
ref|XP_002441645.1|  hypothetical protein SORBIDRAFT_09g030870          107   5e-23   Sorghum bicolor [broomcorn]
gb|KDP23869.1|  hypothetical protein JCGZ_27138                         107   5e-23   Jatropha curcas
ref|XP_010536408.1|  PREDICTED: receptor protein kinase CLAVATA1-...    107   5e-23   Tarenaya hassleriana [spider flower]
ref|XP_007012155.1|  Probably inactive leucine-rich repeat recept...    107   5e-23   
gb|AIT55304.1|  nodulation autoregulation receptor kinase               107   5e-23   Phaseolus vulgaris [French bean]
ref|XP_010269666.1|  PREDICTED: probable LRR receptor-like serine...    107   6e-23   
emb|CDY26403.1|  BnaA02g23670D                                          106   6e-23   Brassica napus [oilseed rape]
gb|EEC79804.1|  hypothetical protein OsI_21242                          107   6e-23   Oryza sativa Indica Group [Indian rice]
ref|XP_007041221.1|  Leucine-rich receptor-like protein kinase fa...    107   6e-23   
ref|NP_001174552.1|  Os05g0595950                                       107   6e-23   
gb|EYU38789.1|  hypothetical protein MIMGU_mgv1a000850mg                107   7e-23   Erythranthe guttata [common monkey flower]
ref|XP_009409686.1|  PREDICTED: putative receptor-like protein ki...    107   7e-23   
ref|XP_006382044.1|  hypothetical protein POPTR_0006s25380g             106   7e-23   
gb|KHG23359.1|  Leucine-rich repeat receptor-like serine/threonin...    106   9e-23   Gossypium arboreum [tree cotton]
ref|XP_010939071.1|  PREDICTED: probable LRR receptor-like serine...    106   1e-22   Elaeis guineensis
ref|XP_010671767.1|  PREDICTED: receptor protein kinase CLAVATA1        106   1e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010257264.1|  PREDICTED: probably inactive leucine-rich re...    106   1e-22   Nelumbo nucifera [Indian lotus]
ref|XP_002526889.1|  serine-threonine protein kinase, plant-type,...    106   1e-22   
ref|XP_006655663.1|  PREDICTED: leucine-rich repeat receptor-like...    106   1e-22   Oryza brachyantha
ref|XP_010026767.1|  PREDICTED: probable LRR receptor-like serine...    106   1e-22   
emb|CDY36706.1|  BnaC02g31270D                                          106   1e-22   
ref|XP_010924539.1|  PREDICTED: leucine-rich repeat receptor-like...    106   1e-22   
ref|XP_004150938.1|  PREDICTED: leucine-rich repeat receptor-like...    105   2e-22   
emb|CAD42335.1|  hypernodulation aberrant root formation protein        105   2e-22   
emb|CAN71566.1|  hypothetical protein VITISV_016304                     102   2e-22   
ref|XP_007146301.1|  hypothetical protein PHAVU_006G029000g             105   2e-22   
ref|XP_009123620.1|  PREDICTED: putative receptor-like protein ki...    105   2e-22   
ref|XP_006279948.1|  hypothetical protein CARUB_v10025818mg             105   2e-22   
ref|XP_010058160.1|  PREDICTED: putative receptor-like protein ki...    105   2e-22   
ref|XP_009377741.1|  PREDICTED: probable LRR receptor-like serine...    105   2e-22   
ref|XP_009407942.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    104   2e-22   
ref|XP_010675938.1|  PREDICTED: LRR receptor-like serine/threonin...    105   2e-22   
gb|KCW71731.1|  hypothetical protein EUGRSUZ_E00238                     105   2e-22   
ref|XP_004230451.1|  PREDICTED: leucine-rich repeat receptor-like...    105   2e-22   
ref|XP_008345324.1|  PREDICTED: putative receptor-like protein ki...    105   2e-22   
gb|EMT21473.1|  Putative LRR receptor-like serine/threonine-prote...    105   3e-22   
ref|XP_009369178.1|  PREDICTED: putative receptor-like protein ki...    105   3e-22   
emb|CDP07377.1|  unnamed protein product                                105   3e-22   
ref|XP_011006423.1|  PREDICTED: probably inactive leucine-rich re...    105   3e-22   
ref|XP_010907375.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-22   
ref|XP_002529272.1|  serine-threonine protein kinase, plant-type,...    105   3e-22   
ref|XP_007021767.1|  Leucine-rich repeat protein kinase family pr...    105   3e-22   
ref|XP_008355553.1|  PREDICTED: probable LRR receptor-like serine...    105   3e-22   
ref|XP_010911433.1|  PREDICTED: putative receptor-like protein ki...    102   3e-22   
gb|EYU26654.1|  hypothetical protein MIMGU_mgv1a001213mg                104   3e-22   
gb|EYU40960.1|  hypothetical protein MIMGU_mgv1a018813mg                104   4e-22   
gb|EYU34890.1|  hypothetical protein MIMGU_mgv1a025800mg                104   5e-22   
gb|EYU30632.1|  hypothetical protein MIMGU_mgv1a022995mg                101   5e-22   
ref|XP_009603651.1|  PREDICTED: leucine-rich repeat receptor-like...    104   5e-22   
ref|XP_002869943.1|  hypothetical protein ARALYDRAFT_492844             104   5e-22   
gb|KHN38370.1|  Leucine-rich repeat receptor-like serine/threonin...    104   5e-22   
ref|XP_004979517.1|  PREDICTED: putative receptor-like protein ki...    104   5e-22   
ref|XP_003518489.2|  PREDICTED: leucine-rich repeat receptor-like...    104   6e-22   
ref|XP_011028346.1|  PREDICTED: leucine-rich repeat receptor-like...    104   6e-22   
ref|XP_004143021.1|  PREDICTED: probable LRR receptor-like serine...    104   6e-22   
ref|XP_008369385.1|  PREDICTED: putative receptor-like protein ki...    104   6e-22   
ref|XP_010064788.1|  PREDICTED: putative receptor-like protein ki...    104   6e-22   
ref|XP_008444584.1|  PREDICTED: probable LRR receptor-like serine...    104   6e-22   
gb|KCW69037.1|  hypothetical protein EUGRSUZ_F02592                     103   7e-22   
gb|KGN62467.1|  hypothetical protein Csa_2G354930                       103   7e-22   
ref|XP_006342066.1|  PREDICTED: receptor protein kinase CLAVATA1-...    103   8e-22   
ref|XP_010910648.1|  PREDICTED: putative receptor-like protein ki...    100   8e-22   
gb|EEC68381.1|  hypothetical protein OsI_36527                          103   8e-22   
ref|XP_002324214.1|  leucine-rich repeat transmembrane protein ki...    103   9e-22   
ref|XP_010257839.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    102   1e-21   
gb|KJB16198.1|  hypothetical protein B456_002G217000                    103   1e-21   
ref|XP_007151443.1|  hypothetical protein PHAVU_004G046800g             102   1e-21   
gb|ACN59341.1|  leucine-rich repeat receptor-like protein kinase        103   1e-21   
ref|XP_011470626.1|  PREDICTED: LRR receptor-like serine/threonin...    100   1e-21   
gb|AAW71475.1|  CLV1-like receptor kinase                               103   1e-21   
ref|XP_008369397.1|  PREDICTED: putative receptor-like protein ki...    102   1e-21   
ref|NP_193760.1|  leucine-rich receptor-like protein kinase BAM3        103   1e-21   
ref|XP_004955796.1|  PREDICTED: probable LRR receptor-like serine...    103   1e-21   
gb|KJB45801.1|  hypothetical protein B456_007G329200                  99.0    1e-21   
ref|NP_001238576.1|  receptor protein kinase-like protein precursor     103   2e-21   
ref|XP_002978264.1|  hypothetical protein SELMODRAFT_108537           97.4    2e-21   
ref|XP_010927978.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    102   2e-21   
gb|ACH59593.1|  LRR receptor-like protein kinase                      95.9    2e-21   
ref|XP_006602289.1|  PREDICTED: leucine-rich repeat receptor-like...    102   2e-21   
ref|XP_010441796.1|  PREDICTED: putative receptor-like protein ki...    102   2e-21   
ref|XP_011074693.1|  PREDICTED: receptor protein kinase CLAVATA1-...    102   2e-21   
ref|XP_008225333.1|  PREDICTED: probable LRR receptor-like serine...    103   2e-21   
ref|NP_001176614.1|  Os11g0568800                                       102   2e-21   
gb|EAZ18778.1|  hypothetical protein OsJ_34305                          102   2e-21   
gb|EYU17827.1|  hypothetical protein MIMGU_mgv1a023554mg                102   2e-21   
ref|XP_008369236.1|  PREDICTED: probable LRR receptor-like serine...    102   2e-21   
ref|XP_010942232.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    102   2e-21   
ref|XP_008233100.1|  PREDICTED: receptor protein kinase CLAVATA1-...    102   2e-21   
ref|XP_002527461.1|  serine-threonine protein kinase, plant-type,...    102   2e-21   
ref|XP_007213538.1|  hypothetical protein PRUPE_ppa019671mg           98.6    2e-21   
ref|XP_007220284.1|  hypothetical protein PRUPE_ppa000681mg             102   2e-21   
gb|KJB16199.1|  hypothetical protein B456_002G217000                    102   2e-21   
ref|XP_008452253.1|  PREDICTED: leucine-rich repeat receptor-like...    102   2e-21   
ref|XP_009391272.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    101   2e-21   
ref|XP_004951350.1|  PREDICTED: probable LRR receptor-like serine...    101   2e-21   
ref|XP_003565662.1|  PREDICTED: probable LRR receptor-like serine...    102   2e-21   
ref|XP_011087678.1|  PREDICTED: leucine-rich repeat receptor-like...    102   3e-21   
ref|XP_003606987.1|  CLV1-like receptor kinase                          101   3e-21   
gb|AAX14781.1|  RLP1 leucine-rich repeat receptor-like protein          101   3e-21   
ref|XP_008803980.1|  PREDICTED: leucine-rich repeat receptor-like...    102   3e-21   
ref|XP_009391273.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    101   3e-21   
ref|XP_002317696.2|  hypothetical protein POPTR_0012s04160g             102   3e-21   
gb|ACH59600.1|  LRR receptor-like protein kinase                      95.5    3e-21   
ref|XP_008234497.1|  PREDICTED: leucine-rich repeat receptor-like...    102   3e-21   
gb|KJB73883.1|  hypothetical protein B456_011G2584002                 98.2    3e-21   
ref|NP_001238004.1|  receptor protein kinase-like protein precursor     102   3e-21   
ref|XP_006385034.1|  hypothetical protein POPTR_0004s23260g             102   3e-21   
gb|KHG17337.1|  Leucine-rich repeat receptor-like serine/threonin...    102   3e-21   
dbj|BAC41332.1|  LRR receptor-like kinase                               102   3e-21   
ref|XP_006338306.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    101   4e-21   
ref|XP_010686227.1|  PREDICTED: probable LRR receptor-like serine...    101   4e-21   
ref|XP_006421471.1|  hypothetical protein CICLE_v10004276mg             101   4e-21   
ref|XP_006423117.1|  hypothetical protein CICLE_v10027688mg             102   4e-21   
gb|AAT64017.1|  putative leucine-rich repeat transmembrane protein      100   4e-21   
ref|XP_006490053.1|  PREDICTED: probably inactive leucine-rich re...    101   4e-21   
gb|KEH43257.1|  LRR receptor-like kinase                                101   4e-21   
ref|XP_011021148.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   4e-21   
ref|XP_011021146.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   4e-21   
emb|CDX92460.1|  BnaA10g14990D                                          101   5e-21   
gb|KEH43256.1|  LRR receptor-like kinase                                101   5e-21   
ref|XP_007214129.1|  hypothetical protein PRUPE_ppa018020mg             101   5e-21   
ref|XP_009417562.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   5e-21   
ref|XP_008369392.1|  PREDICTED: putative receptor-like protein ki...    101   5e-21   
ref|XP_008794419.1|  PREDICTED: putative leucine-rich repeat rece...    101   5e-21   
ref|XP_009417563.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   5e-21   
ref|XP_008364895.1|  PREDICTED: probable LRR receptor-like serine...    100   5e-21   
gb|EEC69970.1|  hypothetical protein OsI_00442                          101   6e-21   
ref|XP_004952135.1|  PREDICTED: leucine-rich repeat receptor-like...    101   6e-21   
ref|XP_010243895.1|  PREDICTED: leucine-rich repeat receptor-like...    101   6e-21   
ref|XP_010256508.1|  PREDICTED: probable LRR receptor-like serine...    101   6e-21   
ref|XP_008224399.1|  PREDICTED: probable LRR receptor-like serine...    101   6e-21   
ref|XP_007213482.1|  hypothetical protein PRUPE_ppa023389mg             101   6e-21   
ref|XP_008223875.1|  PREDICTED: probable LRR receptor-like serine...    101   6e-21   
ref|XP_009396215.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   6e-21   
ref|XP_008385914.1|  PREDICTED: probable LRR receptor-like serine...    101   6e-21   
ref|XP_010243899.1|  PREDICTED: leucine-rich repeat receptor-like...    100   7e-21   
gb|EYU26005.1|  hypothetical protein MIMGU_mgv1a024580mg                100   7e-21   
ref|XP_002269902.1|  PREDICTED: protein NSP-INTERACTING KINASE 1        100   7e-21   
gb|KJB53046.1|  hypothetical protein B456_008G290200                    101   7e-21   
ref|XP_006492589.1|  PREDICTED: leucine-rich repeat receptor-like...    101   7e-21   
ref|XP_008797566.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...    100   7e-21   
ref|XP_010269665.1|  PREDICTED: probable LRR receptor-like serine...    101   7e-21   
gb|KDO44093.1|  hypothetical protein CISIN_1g001922mg                   100   7e-21   
emb|CAH56437.1|  somatic embryogenesis receptor-like kinase 1           100   8e-21   
ref|XP_010050671.1|  PREDICTED: putative receptor-like protein ki...    100   8e-21   
gb|KCW80214.1|  hypothetical protein EUGRSUZ_C01568                     100   8e-21   
ref|XP_006587651.1|  PREDICTED: probable LRR receptor-like serine...    100   8e-21   
ref|XP_010064793.1|  PREDICTED: putative receptor-like protein ki...    100   8e-21   
ref|XP_008369395.1|  PREDICTED: probable LRR receptor-like serine...    100   9e-21   
gb|EYU26470.1|  hypothetical protein MIMGU_mgv1a019834mg                100   9e-21   
emb|CDP14590.1|  unnamed protein product                                100   9e-21   
ref|XP_010058159.1|  PREDICTED: putative receptor-like protein ki...    100   9e-21   
ref|XP_009600411.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   
ref|XP_008357326.1|  PREDICTED: LRR receptor-like serine/threonin...  99.0    1e-20   
ref|XP_009351379.1|  PREDICTED: probable LRR receptor-like serine...  97.4    1e-20   
gb|KCW69044.1|  hypothetical protein EUGRSUZ_F02602                   99.8    1e-20   
ref|XP_007025341.1|  Leucine-rich repeat protein kinase family pr...  99.8    1e-20   
gb|ACD56664.1|  putative leucine-rich repeat transmembrane protein    99.8    1e-20   
ref|XP_007025340.1|  Leucine-rich repeat protein kinase family pr...  99.8    1e-20   
ref|XP_006590881.1|  PREDICTED: receptor protein kinase CLAVATA1-...  99.8    1e-20   
emb|CCF03505.1|  receptor kinase                                        100   1e-20   
gb|KJB62770.1|  hypothetical protein B456_009G435400                    100   1e-20   
ref|XP_009123618.1|  PREDICTED: putative receptor-like protein ki...    100   1e-20   
ref|XP_010667968.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   
ref|XP_002453589.1|  hypothetical protein SORBIDRAFT_04g008570        99.8    1e-20   
gb|KFK34061.1|  hypothetical protein AALP_AA5G097000                    100   1e-20   
ref|XP_007009033.1|  Serine-threonine protein kinase, plant-type,...    100   1e-20   
ref|XP_008223897.1|  PREDICTED: probable LRR receptor-like serine...    100   1e-20   
ref|XP_004501144.1|  PREDICTED: probably inactive leucine-rich re...    100   1e-20   
gb|EPS62062.1|  protein kinase                                          100   1e-20   
ref|XP_010257102.1|  PREDICTED: putative receptor-like protein ki...    100   1e-20   
gb|EEC66712.1|  hypothetical protein OsI_33040                          100   1e-20   
emb|CDY63395.1|  BnaCnng41990D                                        99.0    1e-20   
emb|CCF03508.1|  receptor kinase                                        100   1e-20   
ref|XP_009763204.1|  PREDICTED: leucine-rich repeat receptor-like...    100   1e-20   
gb|KDP42443.1|  hypothetical protein JCGZ_00240                         100   1e-20   
emb|CAN65889.1|  hypothetical protein VITISV_030571                   99.0    2e-20   
ref|XP_010277767.1|  PREDICTED: putative receptor-like protein ki...    100   2e-20   
gb|KJB73885.1|  hypothetical protein B456_011G258600                    100   2e-20   
ref|XP_008346276.1|  PREDICTED: receptor-like protein kinase          99.8    2e-20   
ref|XP_004138566.1|  PREDICTED: probable LRR receptor-like serine...    100   2e-20   
ref|XP_009400102.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  99.4    2e-20   
gb|KHN25406.1|  Receptor protein kinase CLAVATA1                      99.8    2e-20   
ref|XP_009340605.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   
ref|XP_003606988.1|  Receptor protein kinase CLAVATA1                 99.8    2e-20   
ref|XP_004985112.1|  PREDICTED: leucine-rich repeat receptor-like...    100   2e-20   
ref|XP_002278965.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      99.4    2e-20   
emb|CDO97616.1|  unnamed protein product                                100   2e-20   
ref|XP_008347286.1|  PREDICTED: LRR receptor-like serine/threonin...  99.8    2e-20   
ref|XP_006841216.1|  hypothetical protein AMTR_s00135p00046620        95.5    2e-20   
ref|XP_009400110.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  99.0    2e-20   
gb|EEC68365.1|  hypothetical protein OsI_36500                        98.2    2e-20   
ref|XP_004232118.1|  PREDICTED: protein NSP-INTERACTING KINASE 1      99.0    2e-20   
ref|XP_010929457.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  99.0    2e-20   
emb|CBI16897.3|  unnamed protein product                              99.0    2e-20   
ref|XP_010228930.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    2e-20   
ref|XP_006431638.1|  hypothetical protein CICLE_v10000148mg           99.8    2e-20   
ref|XP_009415664.1|  PREDICTED: leucine-rich repeat receptor-like...  99.8    2e-20   
ref|XP_003625388.1|  Receptor-like protein kinase                     99.8    2e-20   
ref|XP_008353615.1|  PREDICTED: LRR receptor-like serine/threonin...  94.7    2e-20   
ref|XP_010655183.1|  PREDICTED: putative receptor-like protein ki...  99.8    2e-20   
gb|KCW62804.1|  hypothetical protein EUGRSUZ_G003951                  95.1    2e-20   
gb|AAC78595.1|  Hcr2-5B                                               99.4    2e-20   
gb|EEC68386.1|  hypothetical protein OsI_36534                        99.4    2e-20   
ref|XP_007028891.1|  Receptor protein kinase CLAVATA1, putative       99.4    2e-20   
gb|EYU21706.1|  hypothetical protein MIMGU_mgv1a023669mg              99.8    2e-20   
ref|XP_008362210.1|  PREDICTED: probable LRR receptor-like serine...  99.8    2e-20   
gb|AAC78593.1|  Hcr2-0B                                               99.4    2e-20   
emb|CAN63733.1|  hypothetical protein VITISV_025883                   98.6    2e-20   
gb|EYU30320.1|  hypothetical protein MIMGU_mgv1a019279mg              97.1    2e-20   
ref|XP_009107554.1|  PREDICTED: probable LRR receptor-like serine...  99.0    3e-20   
ref|XP_006645505.1|  PREDICTED: putative receptor-like protein ki...  99.4    3e-20   
ref|XP_008370076.1|  PREDICTED: probable LRR receptor-like serine...  99.4    3e-20   
ref|XP_003529146.2|  PREDICTED: probable LRR receptor-like serine...  99.4    3e-20   
ref|XP_006583642.1|  PREDICTED: probable LRR receptor-like serine...  99.4    3e-20   
ref|XP_010321824.1|  PREDICTED: LOW QUALITY PROTEIN: probable leu...  99.4    3e-20   
gb|AAC78591.1|  disease resistance protein                            99.4    3e-20   
ref|XP_010910283.1|  PREDICTED: probable LRR receptor-like serine...  99.4    3e-20   
gb|KJB73887.1|  hypothetical protein B456_011G258900                  96.7    3e-20   
gb|AAX19029.1|  Hcr2-p6                                               96.3    3e-20   
ref|XP_003571896.1|  PREDICTED: probable LRR receptor-like serine...  98.6    3e-20   
ref|XP_010919440.1|  PREDICTED: putative receptor-like protein ki...  99.4    3e-20   
ref|XP_006493473.1|  PREDICTED: putative leucine-rich repeat rece...  99.4    3e-20   
ref|XP_004486585.1|  PREDICTED: receptor-like protein kinase-like     99.4    3e-20   
ref|XP_010249537.1|  PREDICTED: probably inactive leucine-rich re...  99.4    3e-20   
dbj|BAJ85417.1|  predicted protein                                    99.4    3e-20   
emb|CCF03506.1|  receptor kinase                                      99.4    3e-20   
gb|AAB82755.1|  receptor kinase-like protein                          99.0    3e-20   
ref|XP_004972876.1|  PREDICTED: probable LRR receptor-like serine...  99.4    3e-20   
dbj|BAJ99137.1|  predicted protein                                    99.0    3e-20   
gb|AAC78596.1|  Hcr2-5D                                               99.0    3e-20   
gb|EYU21721.1|  hypothetical protein MIMGU_mgv1a019783mg              99.0    3e-20   
ref|XP_002865197.1|  flagellin-sensitive 2                            99.4    3e-20   
ref|XP_010249536.1|  PREDICTED: probably inactive leucine-rich re...  99.0    4e-20   
ref|XP_011462028.1|  PREDICTED: LRR receptor-like serine/threonin...  95.5    4e-20   
ref|XP_008783060.1|  PREDICTED: protein NSP-INTERACTING KINASE 1-...  98.2    4e-20   
ref|XP_008339051.1|  PREDICTED: putative receptor-like protein ki...  99.0    4e-20   
ref|XP_004309032.2|  PREDICTED: probable LRR receptor-like serine...  99.4    4e-20   
gb|KJB45779.1|  hypothetical protein B456_007G327400                  96.3    4e-20   
ref|NP_001068120.1|  Os11g0570000                                     97.8    4e-20   
gb|KJB69702.1|  hypothetical protein B456_011G038400                  98.2    4e-20   



>ref|NP_001274713.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1-like precursor [Solanum lycopersicum]
 dbj|BAK52388.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
 dbj|BAK52391.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
lycopersicum]
Length=1016

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPP
Sbjct  132  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPP  180


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIP  348


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPP  373


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 44/128 (34%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
             SG + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FSGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGKIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  294  MFSGEIPP  301


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN LTG LP  +      + L L GN FSGRIP
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
            E+ +   L ++ L  N  SG IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIP  540



>dbj|BAK52390.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
peruvianum]
Length=1015

 Score =   207 bits (528),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 112/169 (66%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  11   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  70

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP
Sbjct  71   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFP  130

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             QL +L NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+FSGRIPP
Sbjct  131  SQLTRLRNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFSGRIPP  179


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  246  LSGKIPREIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  306  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIP  347


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  269  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  328

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP
Sbjct  329  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPP  372


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  485  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  544

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  545  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  587


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G +  L  L +   N  +G +PP I  +S L   + +N       P ++ +
Sbjct  197  LVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGNLSQLLRFDAANCGLSGKIPREIGK  256

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  N+L+G L  E+  + SL+ L L  N FSG IPP
Sbjct  257  LQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPP  300


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  390  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN LTG LP  +      + L L GN FSGRIP
Sbjct  450  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  491


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  457  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  516

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
            E+ +   L ++ L  N  SG IP
Sbjct  517  EISQCKLLTYVDLSRNQLSGEIP  539



>dbj|BAK52389.1| leucine rich repeat receptor protein kinase CLAVATA1 [Solanum 
pennellii]
Length=1016

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 126/163 (77%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SLD+SG N
Sbjct  18   AGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSLDISGFN  77

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P+VG L FL NLS+A NQ +GPVP EIS I  L +LNLSNNIFG  FP QL +L
Sbjct  78   LTGTLPPEVGNLRFLQNLSVAVNQFTGPVPVEISFIPNLSYLNLSNNIFGMEFPSQLTRL  137

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NLQVLDLYNNN+TG+LPVEVY+MT LRHLHLGGN+F GRIPP
Sbjct  138  RNLQVLDLYNNNMTGELPVEVYQMTKLRHLHLGGNFFGGRIPP  180


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIP  348


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L+ L L  N  +G +PP
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKTLDLSSNKLTGNLPP  373


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N LSGP+ PEIS    L +++LS N      P ++  
Sbjct  486  KFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAPEISQCKLLTYVDLSRNQLSGEIPTEITG  545

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  546  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 60/128 (47%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
              G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNIATLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  294  MFSGEIPP  301


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPHLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN LTG LP  +      + L L GN FSGRIP
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 27/83 (33%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NNL+G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNLSGPIAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
            E+ +   L ++ L  N  SG IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIP  540



>ref|XP_010271550.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1032

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 109/163 (67%), Positives = 130/163 (80%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGKP+ ++E  ALLS+K A + D Q  L +WN STSHCTW  V+CDSL  VVSLDLS +N
Sbjct  23   AGKPVRISENRALLSLKTAISDDPQGFLQNWNFSTSHCTWTGVSCDSLNRVVSLDLSNMN  82

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG+LSPDVGQL  LVNL++AAN + GP+PP IS IS LR LNLSNN+F  TFP QL++L
Sbjct  83   ISGILSPDVGQLRNLVNLTVAANLIYGPIPPGISYISGLRLLNLSNNVFNGTFPSQLSRL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VLDLYNNN+TGDLPVEV  M +LRHLH GGN+FSGRIPP
Sbjct  143  KYLEVLDLYNNNMTGDLPVEVSDMPNLRHLHFGGNFFSGRIPP  185


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N LSG  P   S +  L  LNL  N      P  +  L
Sbjct  276  LSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSELKNLTLLNLFRNKLHGAIPDFIGDL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  336  PELEVLQLWENNFTGSIPQGLGKNGRLQFLDLSSNKLTGNLPP  378


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+    FP   ++L
Sbjct  252  LSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNNMLSGEFPETFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGAIPDFIGDLPELEVLQLWENNFTGSIP  353


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/127 (28%), Positives = 60/127 (47%), Gaps = 25/127 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR--------------------  399
             SG + P+ G+  FL  ++++ N+L+GP+PP I  ++ L+                    
Sbjct  179  FSGRIPPEYGRWEFLEYMALSGNELTGPIPPTIGNLTKLQQLYLGYYNTYESGIPAEMGN  238

Query  400  -----FLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
                  L+++N       PH+L +L  L  L L  N L+G+L  E+ ++ SL+ + L  N
Sbjct  239  LTELVRLDMANCGLSGEIPHELGKLQKLDTLFLQVNGLSGELTPELGQLKSLKSMDLSNN  298

Query  565  YFSGRIP  585
              SG  P
Sbjct  299  MLSGEFP  305


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+LSG +PPEI+ +  L +LNLS N    + P  ++ +
Sbjct  516  FSGSIAPEISQCKLLTFVDLSRNELSGEIPPEITGMRILNYLNLSRNHLVGSIPASISTM  575

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 29/89 (33%), Positives = 45/89 (51%), Gaps = 0/89 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ NQL G +P  I   S ++ L L  N F  + P ++ +L  L  +D  NN  +
Sbjct  458  LGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFS  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            G +  E+ +   L  + L  N  SG IPP
Sbjct  518  GSIAPEISQCKLLTFVDLSRNELSGEIPP  546


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP LV + +  N L G  P   S    L  ++LSNN    + P  +   
Sbjct  420  LNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVAENLGQISLSNNQLMGSLPRSIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ ++  L  +    N FSG I P
Sbjct  480  SGVQKLLLDGNFFSGSIPAEIGRLQQLSKMDFSNNRFSGSIAP  522


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  396  LFGPIPESLGRCESLSRIRMGENFLNGTIPKGLFGLPMLVQVELQDNYLVGGFPETDSVA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L G LP  +   + ++ L L GN+FSG IP
Sbjct  456  ENLGQISLSNNQLMGSLPRSIGNFSGVQKLLLDGNFFSGSIP  497



>ref|XP_011073654.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1015

 Score =   205 bits (522),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 130/170 (76%), Gaps = 4/170 (2%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vv  255
            R+S GA  G+   + E  ALLSIKAA T D QS+L SWN STSHCTW  VTCD     V 
Sbjct  16   RYSTGARPGR---MPEYRALLSIKAAITEDPQSTLASWNASTSHCTWEGVTCDVSGRHVT  72

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            +LD+S L+L+G LSPDVG L FLVNLS+AAN LSGPVPP+IS I  LR+LNLSNN+F  +
Sbjct  73   ALDISNLSLTGTLSPDVGHLRFLVNLSVAANSLSGPVPPQISDIPNLRYLNLSNNVFNLS  132

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            FP QL +L NLQVLDLYNNN+TGD P + Y +TSLRHLHLGGN+FSG IP
Sbjct  133  FPPQLYRLKNLQVLDLYNNNMTGDFPSQAYLLTSLRHLHLGGNFFSGEIP  182


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N L+G + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N LTG +P  + ++  L+ L L  N F+G IP
Sbjct  310  KNMTLLNLFRNKLTGSIPDFIGELPELQVLQLWENNFTGSIP  351


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L+P++G L  L ++ ++ N LSG +PP  + +  +  LNL  N    + P  + +L
Sbjct  274  LTGGLTPELGNLKSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  +    +L  + +  N  +G +PP
Sbjct  334  PELQVLQLWENNFTGSIPQNLGTNGNLHEVDVSSNKLTGNLPP  376


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N LSGP+ PEIS    L F++LS N    + P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSHNNLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  550  RILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNFSGLVP  591


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG ++P++ +   L  + ++ NQLSG VP EI+ +  L +LNLS N    + P  +A 
Sbjct  513  NLSGPIAPEISRCKLLTFVDLSRNQLSGSVPTEITGMRILNYLNLSRNHLVGSIPSSIAS  572

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NN +G +P
Sbjct  573  MQSLTSVDFSYNNFSGLVP  591


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +  ++G L  L  L I   N  SG +P EI  +S L   + +N       P ++  
Sbjct  201  LTGAIPREIGNLTQLKELYIGYYNTFSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGN  260

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  N LTG L  E+  + SL+ + L  N  SG +PP
Sbjct  261  LQNLDTLFLQVNGLTGGLTPELGNLKSLKSMDLSNNMLSGELPP  304


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N LSGP+PP I     ++ L L  N F    P ++ +L  L  +D  +NNL+
Sbjct  456  LGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNNLS  515

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L  + L  N  SG +P
Sbjct  516  GPIAPEISRCKLLTFVDLSRNQLSGSVP  543


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+    FP      
Sbjct  394  LFGPIPESLGQCESLSRVRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGAFPETDRPS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  + L NN+L+G LP  +     ++ L L GN FSGRIP
Sbjct  454  TTLGQISLSNNHLSGPLPPSIGNFVGVQKLLLDGNKFSGRIP  495


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G L  LV    A   LSG +P EI  +  L  L L  N        +L  L
Sbjct  226  FSGGIPKEIGNLSNLVRFDAANCGLSGEIPAEIGNLQNLDTLFLQVNGLTGGLTPELGNL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L+ +DL NN L+G+LP    ++ ++  L+L  N  +G IP
Sbjct  286  KSLKSMDLSNNMLSGELPPSFAELKNMTLLNLFRNKLTGSIP  327



>ref|XP_009613990.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1019

 Score =   205 bits (521),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/165 (64%), Positives = 130/165 (79%), Gaps = 0/165 (0%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg  273
            + A KP  + E  ALLS+K A T D QS+L SWNISTSHCTW+ VTCD   HV SL++S 
Sbjct  19   SAAAKPHFLPEYRALLSLKTAITDDPQSALISWNISTSHCTWKGVTCDKYRHVTSLNISN  78

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP QL 
Sbjct  79   LNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSLISNLRYLNLSNNIFNLSFPQQLT  138

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            QL NL+VLD+YNNNLTG+L V V+ +T+L HLHLGGN+F+GRIPP
Sbjct  139  QLINLEVLDIYNNNLTGELAVGVHNLTNLYHLHLGGNFFTGRIPP  183


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  250  LSGNIPSEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLYGSIPEFIQELPKLEVLQLWENNFTGSIP  351


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  177  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  237  LSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIP  280


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 60/104 (58%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  273  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIQE  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP
Sbjct  333  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPP  376


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  +
Sbjct  490  FSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNCKALTFIDLSRNKLSGEIPTEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  RILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVP  591


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N+ SG +P EI  +  L  ++ S N F    P +++  
Sbjct  466  LTGRLPSSIGSFSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISNC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP
Sbjct  526  KALTFIDLSRNKLSGEIPTEITGMRILNYLNVSRNHLVGSIP  567


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  394  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP
Sbjct  454  ASLGQISLSNNRLTGRLPSSIGSFSGVQKLLLDGNKFSGRIP  495


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  226  FSGGIPPEIGNLSELVRFDAANCGLSGNIPSEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  284

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP
Sbjct  285  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIP  327


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPSSIGSF  477

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPP
Sbjct  478  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPP  520



>ref|XP_006357743.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1017

 Score =   203 bits (517),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 109/169 (64%), Positives = 128/169 (76%), Gaps = 0/169 (0%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsl  261
            H     AGK   + E  ALL++K A T D Q +L SWNISTSHCTW  VTCD+  HV SL
Sbjct  12   HFTDFSAGKQPRLPEYQALLALKTAITDDPQLTLASWNISTSHCTWNGVTCDTHRHVTSL  71

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            D+SG NL+G L P+VG L FL NLS+A NQ +GP+P EIS I  L +LNLSNNIFG  FP
Sbjct  72   DISGFNLTGTLPPEVGNLRFLQNLSVAVNQFTGPIPVEISFIPNLGYLNLSNNIFGMEFP  131

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             QL +L NLQVLDLYNNN+TG+LP+EVY+MT+LRHLHLGGN+F GRIPP
Sbjct  132  PQLTRLRNLQVLDLYNNNMTGELPLEVYQMTNLRHLHLGGNFFGGRIPP  180


 Score = 73.9 bits (180),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+F    P   A+L
Sbjct  247  LSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +++L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  307  KNITLVNLFRNKLYGSIPEFIEDLPELEVLQLWENNFTGSIP  348


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 58/104 (56%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N  SG +PP  + +  +  +NL  N    + P  +  
Sbjct  270  SLSGSLTPEIGYLKSLKSLDLSNNMFSGEIPPTFAELKNITLVNLFRNKLYGSIPEFIED  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L+++ L  N  +G +PP
Sbjct  330  LPELEVLQLWENNFTGSIPQGLGTKSKLKNVDLSSNKLTGNLPP  373


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 43/128 (34%), Positives = 60/128 (47%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL-----------------N  408
              G + P+ G+ P L  L+++ N L G +PPEI  I+TL+ L                 N
Sbjct  174  FGGRIPPEYGRFPSLEYLAVSGNALVGEIPPEIGNITTLQQLYVGYYNTFTGGIPPAIGN  233

Query  409  LS--------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            LS        N       P ++ +L NL  L L  N+L+G L  E+  + SL+ L L  N
Sbjct  234  LSQLLRFDAANCGLSGEIPPEIGKLQNLDTLFLQVNSLSGSLTPEIGYLKSLKSLDLSNN  293

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  294  MFSGEIPP  301


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  +
Sbjct  487  FSGRIPAEIGKLQQLSKIDFSHNNFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITGM  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  547  RILNYLNLSRNHLVGSIPSPISSMQSLTSVDFSYNNFSGLVP  588


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG ++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  ++ 
Sbjct  510  NFSGPMAPEISQCKLLTYVDLSRNQLSGEIPSEITGMRILNYLNLSRNHLVGSIPSPISS  569

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NN +G +P
Sbjct  570  MQSLTSVDFSYNNFSGLVP  588


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L NNI   TFP   ++ 
Sbjct  391  LFGPIPESLGRCESLNRIRMGENYLNGSIPKGLLSLPRLSQVELQNNILTGTFPDISSKS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN LTG LP  +      + L L GN FSGRIP
Sbjct  451  NSLGQIILSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIP  492


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            ++ N+L+GP+PP I   +  + L L  N F    P ++ +L  L  +D  +NN +G +  
Sbjct  458  LSNNRLTGPLPPSIGNFAVAQKLLLDGNKFSGRIPAEIGKLQQLSKIDFSHNNFSGPMAP  517

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
            E+ +   L ++ L  N  SG IP
Sbjct  518  EISQCKLLTYVDLSRNQLSGEIP  540



>emb|CDP02660.1| unnamed protein product [Coffea canephora]
Length=1017

 Score =   202 bits (513),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 105/155 (68%), Positives = 122/155 (79%), Gaps = 1/155 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSP  300
            E  ALLSIK+A TAD QSSL SWN ST+HC+W  VTCDS    V+      LNL+G LSP
Sbjct  26   EYKALLSIKSAITADPQSSLASWNDSTTHCSWSGVTCDSYGRHVTALDISGLNLTGSLSP  85

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            DV  L  L+NLS+AANQ  GPVPPEIS+ISTLR+LNLSNNIF  TFP QL +L NL+VLD
Sbjct  86   DVSHLRLLLNLSVAANQFCGPVPPEISSISTLRYLNLSNNIFNLTFPRQLIRLKNLEVLD  145

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             YNNN++G LPV+VY++T+LRHLHLGGNYFSG IP
Sbjct  146  FYNNNMSGPLPVDVYQLTNLRHLHLGGNYFSGGIP  180


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSGP+  E+  + +L+ ++LSNN+F    P   AQL
Sbjct  248  LSGEVPPELGMLQNLDTLFLQVNALSGPLTSELGYLKSLKSMDLSNNMFTGEIPSSFAQL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  308  KNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIP  349


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +    +  N+ +GP+P EI  +  L  ++ S+N F      ++++ 
Sbjct  464  LSGPLPPSIGNFVGVQKFLLDGNKFTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISEC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP
Sbjct  524  KLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIP  565


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G+L  L  +  + N  SGP+ PEIS    L F++LS N      P ++  +
Sbjct  488  FTGPIPAEIGKLQQLSKIDFSHNSFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  RILNYLNLSRNHLVGSIPSPIASMQSLTSVDFSYNNLSGMVP  589


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  + G  P L  L+++ N+L+G +PPEI+ ++ L+ L +   N F    P Q+  
Sbjct  175  FSGGIPAEYGSFPNLEYLAVSGNELAGRIPPEIANLTKLQHLYIGYFNTFSGGIPPQIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  L+G++P E+  + +L  L L  N  SG
Sbjct  235  LSQLLRFDAANCGLSGEVPPELGMLQNLDTLFLQVNALSG  274


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG ++P++ +   L  + ++ NQL+G +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  SFSGPIAPEISECKLLTFVDLSRNQLAGEIPTEITGMRILNYLNLSRNHLVGSIPSPIAS  570

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGMVP  589


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  NQL G +P  I  +  L  L L +N F  + P  L   
Sbjct  296  FTGEIPSSFAQLKNLTLLNLFRNQLHGSIPDFIGDLPELEVLQLWDNNFTGSIPQGLGTN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ LDL +N LTG+LP  +     L+ L   GN+  G IP
Sbjct  356  GKLQNLDLSSNKLTGNLPPNICTGNKLQTLITLGNFLFGTIP  397


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  L +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  392  LFGTIPESLGQCESLSRLRMGENYLNGSIPKGLLSLPQLTQVELQDNLLTGSFPETDKTS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  + L NN L+G LP  +     ++   L GN F+G IP
Sbjct  452  TALGQISLSNNRLSGPLPPSIGNFVGVQKFLLDGNKFTGPIP  493



>ref|XP_011099433.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Sesamum indicum]
Length=1008

 Score =   201 bits (511),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 107/166 (64%), Positives = 133/166 (80%), Gaps = 1/166 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldls  270
            + A +P  ++E  ALLSIKAA T D QS+L SWN++T+HCTW+ +TCD S  HV SLD+S
Sbjct  16   SAAARPPRMSEYRALLSIKAAITDDPQSALASWNLTTNHCTWKGITCDPSRRHVTSLDIS  75

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
             L+L+G LSPDVGQL FLVNLS+AAN +SGPVPP+IS I  LR+LNLSNN+F  +FP +L
Sbjct  76   NLSLTGTLSPDVGQLRFLVNLSVAANFISGPVPPQISDIPNLRYLNLSNNVFNLSFPPEL  135

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L NLQVLDLYNNN+TGD P + Y + +LRHLHLGGN+FSG IPP
Sbjct  136  YRLRNLQVLDLYNNNMTGDFPSKAYLLANLRHLHLGGNFFSGEIPP  181


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+F    P   A+L
Sbjct  248  LTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N LTG +P  + ++  L  L L  N F+G IP
Sbjct  308  KNMTLLNLFRNKLTGSIPDFIGELPELEVLQLWENNFTGIIP  349


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  SG +PP  + +  +  LNL  N    + P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMFSGEIPPSFAELKNMTLLNLFRNKLTGSIPDFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  +    +L+ + +  N  +G +PP
Sbjct  332  PELEVLQLWENNFTGIIPQSLGTNGNLQEVDVSSNKLTGNLPP  374


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G  P+L  L+++ N+L+G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  175  FSGEIPPEFGSFPYLEYLAVSGNELTGAIPPEIGNLTQLKELYIGYYNAFTGGMPKEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  564
            L+ L  LD  N  LTG++P E+  +                         SL+ + L  N
Sbjct  235  LSQLVRLDAANCGLTGEIPPEIGNLQNLDTLFLQVNGLSGSLTPELGNLKSLKSMDLSNN  294

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  295  MFSGEIPP  302


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G L P +G    +  L +  N+ SG +P EI  +  L  ++ S+N        +++Q
Sbjct  463  HLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQ  522

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  523  CKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIP  565


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 48/78 (62%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+++P++ Q   L  + ++ NQLSG +P EI+ +  L +LNLS N    + P  +A +
Sbjct  512  LTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGMRILNYLNLSRNHLVGSIPSSIASM  571

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  572  QSLTSVDFSYNNLSGLVP  589


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N+L+G + PEIS    L F++LS N      P ++  +
Sbjct  488  FSGRIPAEIGKLQQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIPTEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  RILNYLNLSRNHLVGSIPSSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP      
Sbjct  392  LFGPIPESLGQCKSLTRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLSGTFPETDGLS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L +N+LTG LP  +     ++ L L GN FSGRIP
Sbjct  452  TSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIP  493


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG      G    L  +S++ N L+GP+PP I     ++ L L  N F    P ++ +L
Sbjct  440  LSGTFPETDGLSTSLGQISLSDNHLTGPLPPSIGNFVGVQKLLLDGNKFSGRIPAEIGKL  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N LTG +  E+ +   L  + L  N  SG IP
Sbjct  500  QQLSKMDFSHNELTGLIAPEISQCKLLTFVDLSRNQLSGDIP  541



>ref|XP_010268646.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nelumbo nucifera]
Length=1034

 Score =   200 bits (509),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 107/162 (66%), Positives = 130/162 (80%), Gaps = 0/162 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AG+PL + E  ALLSIK A + D Q+SL +WN+STSHCTW  V+CDS   VVSLDLS +N
Sbjct  20   AGRPLRIPEYRALLSIKTAISDDPQASLPNWNLSTSHCTWTGVSCDSFNRVVSLDLSNMN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG+LSPDVGQL  L+NL+ AAN  SGP+P EIS IS LR LNLSNN+F  +FP + ++L
Sbjct  80   LSGILSPDVGQLRNLINLTAAANFFSGPIPSEISHISGLRLLNLSNNVFNGSFPSEFSRL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VLDLYNNN+TGDLPV+V +M +LRHLHLGGN+FSGRIP
Sbjct  140  KLLEVLDLYNNNMTGDLPVDVSEMPNLRHLHLGGNFFSGRIP  181


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  273  LSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIPDFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  333  PALEVLQLWENNFTGSIPQGLGKNGRLQLLDLSSNKLTGNLPP  375


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   ++L
Sbjct  249  LSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKSLKSMDLSNNMLAGEIPATFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLHGAIPDFIGDLPALEVLQLWENNFTGSIP  350


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSG +PPE S +  L  L L  N        +L QL +
Sbjct  227  GGIPPELGNLTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTPELGQLKS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN L G++P    ++ +L  L+L  N   G IP
Sbjct  287  LKSMDLSNNMLAGEIPATFSELKNLTLLNLFRNKLHGAIP  326


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++G+L  L  +  + N+ SGP+  EIS    L F++LS N      P ++  +  
Sbjct  491  GSIPAEIGRLQQLSKMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRI  550

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+L  N+LTG +P  +  M SL  +    N  SG +P
Sbjct  551  LNYLNLSRNHLTGSIPASIATMQSLTSVDFSYNNLSGLVP  590


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+L G +PPEI  ++ L+ L L   N +    P +L  
Sbjct  176  FSGRIPSEYGRWEFLEYLALSGNELGGTIPPEIGNLTKLQQLYLGYYNSYEGGIPPELGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  LD+ N  L+G++P E  K+  L  L L  N  SG + P
Sbjct  236  LTELVRLDMANCGLSGEIPPEFSKLQKLDTLFLQVNGLSGGLTP  279


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++ ++ Q   L  + ++ N+LSG +PPE++ +  L +LNLS N    + P  +A +
Sbjct  513  FSGPIASEISQCKLLTFVDLSRNELSGVIPPEMTGMRILNYLNLSRNHLTGSIPASIATM  572

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 51/99 (52%), Gaps = 6/99 (6%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            ++ D+GQ+      S++ NQL+G +P  I   S ++ L L  N F  + P ++ +L  L 
Sbjct  451  IAEDLGQI------SLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIPAEIGRLQQLS  504

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +D  NN  +G +  E+ +   L  + L  N  SG IPP
Sbjct  505  KMDFSNNRFSGPIASEISQCKLLTFVDLSRNELSGVIPP  543


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCKSLSRIRMGENFLNGTIPKGLFSLPNLAQVELQDNYLVGGFPQTDSIA  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN LTG LP  +   + ++ L L GN+F G IP
Sbjct  453  EDLGQISLSNNQLTGSLPRSIGNFSGVQKLLLDGNFFFGSIP  494



>ref|XP_009771232.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1019

 Score =   199 bits (507),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 106/163 (65%), Positives = 125/163 (77%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A T D Q +L SWNISTSHCTW+ VTCD   HV SLD+SG N
Sbjct  20   AGKQPRIPEYQALLALKTAITDDPQLALASWNISTSHCTWKGVTCDRYRHVTSLDISGFN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG L FL NLS+  NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  80   VTGTLPPEVGNLRFLQNLSVDLNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPP
Sbjct  140  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPP  182


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  272  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP
Sbjct  332  LPELEVLQLWENNFTGSIPQGLGTNSKLKNLDLSSNKLTGNLPP  375


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  249  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIP  350


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  176  FGGRIPPEYGRFQFLEYLAVSGNELVGEIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+ +L  L L  N  SG + P
Sbjct  236  LSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTP  279


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  488  KFSGRIPAEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  548  MRILNYLNLSRNHLVGSIPAPISSMQSLTSVDFSYNNFSGLVP  590


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  393  LFGPIPESLGQCESLSRIRMGENYLNGSIPKRLLSLPQLSQVELQNNLLTGTFPETKSIS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP
Sbjct  453  TSLGQISLSNNHLTGSLPTSIGNFAGVQKLLLDGNKFSGRIP  494


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  LV    A   LSG +P E+  +  L  L L  N    +   ++  L
Sbjct  225  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTPEIGTL  284

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP
Sbjct  285  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIP  326



>gb|AIT56194.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Dimocarpus longan]
Length=1015

 Score =   199 bits (506),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 105/156 (67%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLSIK+A +ADSQ++L+SWN +TSHCTW  VTCDS  HV SLDL  LNLSG LS
Sbjct  21   VSEYRALLSIKSALSADSQAALSSWNATTSHCTWTGVTCDSRHHVTSLDLRDLNLSGTLS  80

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  L FL NL++AANQ SGP+PPEIS +S LRFLNLSNN+F  +FP QLA+LANL+V+
Sbjct  81   SDVAHLQFLRNLTVAANQFSGPIPPEISQLSALRFLNLSNNVFNGSFPSQLARLANLEVM  140

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            DLYNNN+T +LPV V ++ +L HLHLGGN+FSG IP
Sbjct  141  DLYNNNMTDELPVGVTQLRNLHHLHLGGNFFSGEIP  176


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+F    P   A+L
Sbjct  244  LSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAEL  303

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  304  KNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIP  345


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P+VG L  L  +  + N+ SG + PEIS    L F++LS N      P+++  
Sbjct  483  KFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKCKLLTFVDLSRNELSGVVPNEITG  542

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  543  MKILNYLNLSRNHLVGSIPAAIASMQSLTSVDFSYNNLSGLVP  585


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  +  LNL  N      P  + +L
Sbjct  268  LSGTLARELGNLKSLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGEL  327

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP
Sbjct  328  PKLEVLQLWENNFTGSIPQRLGSNGMLQLLDLSSNKLTGTLPP  370


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +P EI  +  L  L L  N    T   +L  L 
Sbjct  221  TGGLPPEIGNLSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTLARELGNLK  280

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN  TG++P    ++ ++  L+L  N   G IP
Sbjct  281  SLKSMDLSNNMFTGEIPASFAELKNMTLLNLFRNKLHGAIP  321


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ SG +PPE+ ++  L  +  S+N F      ++++ 
Sbjct  460  LSGSLPASIGNFSGVQKLLLDGNKFSGQIPPEVGSLKQLSKMGFSDNRFSGQIAPEISKC  519

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP
Sbjct  520  KLLTFVDLSRNELSGVVPNEITGMKILNYLNLSRNHLVGSIP  561


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G   FL  L+++ N+L G +PPEI  ++TLR L +   N +    P ++  
Sbjct  171  FSGEIPAEYGGWEFLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNTYTGGLPPEIGN  230

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L++L  LD  N  L+G++P E+ K+  L  L L  N  SG +
Sbjct  231  LSSLVRLDAANCALSGEIPGEIGKLQKLDTLFLQVNGLSGTL  272


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  +  L++  N+L G +P  I  +  L  L L  N F  + P +L   
Sbjct  292  FTGEIPASFAELKNMTLLNLFRNKLHGAIPEFIGELPKLEVLQLWENNFTGSIPQRLGSN  351

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP
Sbjct  352  GMLQLLDLSSNKLTGTLPPDMCSGNRLETLITLGNFLFGPIP  393


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  388  LFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTDSIS  447

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  + L NN L+G LP  +   + ++ L L GN FSG+IPP
Sbjct  448  VSLGQITLSNNQLSGSLPASIGNFSGVQKLLLDGNKFSGQIPP  490


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + P  L  
Sbjct  363  KLTGTLPPDMCSGNRLETLITLGNFLFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFG  422

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  ++L +N LTG+ PV      SL  + L  N  SG +P
Sbjct  423  LPKLTQVELQDNYLTGEFPVTDSISVSLGQITLSNNQLSGSLP  465



>ref|XP_006364007.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Solanum tuberosum]
Length=1022

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 125/161 (78%), Gaps = 0/161 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K + T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTSITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  L +LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPIELSFIPNLSYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+VLD+YNNN+TGDLPV VY +T+LRHLHLGGN+FSG IPP
Sbjct  144  LKVLDIYNNNMTGDLPVGVYNLTNLRHLHLGGNFFSGSIPP  184


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLYGSIPEFIEDLPKLEVLQLWENNFTGSIP  352


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGMIPPEIGNITTLRELYIGYYNTFSGGLPAEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTP  281


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  L
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPFTFTELKNLTLLNLFRNKLYGSIPEFIEDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPP  377


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPAELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L++  N L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVP  592


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  S+L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVSSSLGQICLSNNRFTGPLPSSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPP
Sbjct  479  TGVQKLLLDGNKFSGQIPAELGKLQQLSKMDFSGNSFSGLIPP  521


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLFSLPKLSQVELQDNLLTGTFPVTGSVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L  + L NN  TG LP  +   T ++ L L GN FSG+IP
Sbjct  455  SSLGQICLSNNRFTGPLPSSIGNFTGVQKLLLDGNKFSGQIP  496



>ref|XP_004234641.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Solanum lycopersicum]
Length=1022

 Score =   199 bits (506),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 106/161 (66%), Positives = 124/161 (77%), Gaps = 0/161 (0%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLS  285
            KP  V E  ALLS+K A T D QS+L SWNISTSHCTWR VTCD   HV SLD+SG NL+
Sbjct  24   KPPYVPEYRALLSLKTAITDDPQSALLSWNISTSHCTWRGVTCDRYRHVTSLDISGFNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L+P+VG L FL+NLS+A NQ SGP+P E+S I  LR+LNLSNNIF  +FP QL  L  
Sbjct  84   GTLTPEVGHLRFLLNLSVAVNQFSGPIPVELSFIPNLRYLNLSNNIFNLSFPPQLTHLRY  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L VLD+YNNN+TG+LPV  Y +T+LRHLHLGGN+FSG IPP
Sbjct  144  LNVLDIYNNNMTGELPVGFYNLTNLRHLHLGGNFFSGSIPP  184


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG V PE+  + +L+ L+LSNN+     P    +L
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNGLSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLYGSMPEFIEDMPKLEVLQLWENNFTGSIP  352


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N L G +PPEI  I+TLR L +   N F    P ++  
Sbjct  178  FSGSIPPEYGRFPFLEYLAVSGNALVGRIPPEIGNITTLRELYIGYYNTFSGGLPAEIGY  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  238  LSELIRLDAANCGLSGEIPPEIGKLQKLDTLFLQVNGLSGSVTP  281


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L +L ++ N LSG +P   + +  L  LNL  N    + P  +  +
Sbjct  275  LSGSVTPELGNLKSLKSLDLSNNMLSGEIPLTFTELKNLTLLNLFRNKLYGSMPEFIEDM  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K + L ++ +  N  +G +PP
Sbjct  335  PKLEVLQLWENNFTGSIPQGLGKNSKLTNVDISTNKLTGNLPP  377


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SG +PPEIS    L +++LS N      P ++  
Sbjct  490  KFSGQIPGELGKLQQLSKMDFSGNSFSGLIPPEISRCKALTYVDLSRNKLSGEVPTEITG  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L++  N L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNVSRNQLVGSIPAPIAAMQSLTSVDFSYNNLSGLVP  592


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  + LSNN F    P  +   
Sbjct  419  LNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVSASLGQICLSNNRFTGPLPSSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N  +G +P E+ K+  L  +   GN FSG IPP
Sbjct  479  TAVQKLLLDGNKFSGQIPGELGKLQQLSKMDFSGNSFSGLIPP  521


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  395  LFGPIPESLGECQSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNLLTGTFPVTDSVS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A+L  + L NN  TG LP  +   T+++ L L GN FSG+IP
Sbjct  455  ASLGQICLSNNRFTGPLPSSIGNFTAVQKLLLDGNKFSGQIP  496



>ref|XP_009786199.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana sylvestris]
Length=1015

 Score =   198 bits (504),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 105/167 (63%), Positives = 129/167 (77%), Gaps = 2/167 (1%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl  267
            + A KP  + E  ALLS+K A + D QS+L SWN ST  SHCTW+ VTCD   HV SL++
Sbjct  15   SAAAKPHFLPEYRALLSLKTAISDDPQSALISWNSSTTTSHCTWKGVTCDKYRHVTSLNI  74

Query  268  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            S LNL+G L P++GQL +LVNLS+A NQ SGP+P E+S IS LR+LNLSNNIF  +FP Q
Sbjct  75   SNLNLTGTLPPEIGQLRYLVNLSVAVNQFSGPIPVELSVISNLRYLNLSNNIFNLSFPQQ  134

Query  448  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L QL NL+VLD+YNNNLTG LPV V+ +T+L HLHLGGN+F+GRIPP
Sbjct  135  LTQLINLEVLDIYNNNLTGQLPVGVHNLTNLYHLHLGGNFFTGRIPP  181


 Score = 70.9 bits (172),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P  L++L
Sbjct  248  LSGEIPAEIGKLKKLDTLFLQVNSLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLYGSIPEFIEELPKLEVLQLWENNFTGSIP  349


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P+ G+ PFL  L+++ N+L+G +PPEI  I+TL+ L +   N F    P ++  
Sbjct  175  FTGRIPPEFGKFPFLKYLAVSGNELAGDIPPEIGNITTLKELYVGYYNTFSGGIPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  235  LSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIP  278


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 60/104 (58%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P++G L  L +L ++ N LSG +P  +S +  L  LNL  N    + P  + +
Sbjct  271  SLSGSLIPEIGYLKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIPEFIEE  330

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P+ + + + L+ L +  N  +G +PP
Sbjct  331  LPKLEVLQLWENNFTGSIPMGLGQNSKLKTLDISTNKLTGNLPP  374


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SGP+PPEIS    L F++LS N      P ++  +
Sbjct  488  FSGRIPAEIGKLQQLSKMDFSGNGFSGPIPPEISHCKALTFVDLSRNKLSGEIPTEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  RILNYLNVSRNHLVGSIPASISAMQSLTSVDFSYNNLSGLVP  589


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L +N+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A+L  + L NN LTG LP  +   + ++ L L GN FSGRIP
Sbjct  452  ASLGQISLSNNRLTGRLPPSIGNFSGVQKLLLDGNKFSGRIP  493


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 58/103 (56%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N++ GS  P ++  
Sbjct  224  FSGGIPPEIGNLSELVRFDAANCGLSGEIPAEIGKLKKLDTLFLQVNSLSGSLIP-EIGY  282

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ LDL NN L+G++P+ + ++ +L  L+L  N   G IP
Sbjct  283  LKSLKSLDLSNNLLSGEIPLTLSELKNLTLLNLFRNKLYGSIP  325


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPPSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ K+  L  +   GN FSG IPP
Sbjct  476  SGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSGNGFSGPIPP  518


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++ +   L  L    N L GP+P  +    +L  + +  N    + P  L  L
Sbjct  368  LTGNLPPNMCRGNNLETLITLGNFLFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSL  427

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  ++L +N LTG  PV      SL  + L  N  +GR+PP
Sbjct  428  PKLTQVELQDNLLTGTFPVTGSVSASLGQISLSNNRLTGRLPP  470



>ref|XP_009605676.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Nicotiana tomentosiformis]
Length=1017

 Score =   195 bits (495),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 104/163 (64%), Positives = 123/163 (75%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            AGK   + E  ALL++K A   D Q +L SWN STSHCTW+ VTCD   HV SLD+SG N
Sbjct  19   AGKHPRIPEYQALLALKTAIIDDPQLALASWNNSTSHCTWKGVTCDRYRHVTSLDISGFN  78

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G L P+VG   FL NLS+A NQ SGP+P EIS I  L +LNLSNNIF   FP QL +L
Sbjct  79   VTGTLPPEVGNFRFLQNLSVALNQFSGPIPVEISFIPNLHYLNLSNNIFSLGFPPQLTRL  138

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLDLYNNN+TGDLPV+VY+MT+LRHLHLGGN+F GRIPP
Sbjct  139  RNLKVLDLYNNNMTGDLPVDVYQMTNLRHLHLGGNFFGGRIPP  181


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+P++G L  L +L ++ N LSG VPP  + +  L  LNL  N    + P  +  
Sbjct  271  SLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIPEFIGD  330

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  +   + L++L L  N  +G +PP
Sbjct  331  LPELEVLQLWENNFTGSIPHGLGTNSKLKNLDLSSNKLTGSLPP  374


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++ +L  L  L +  N LSG + PEI  + +L+ L+LSNN+     P   A L
Sbjct  248  LSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTLKSLKSLDLSNNMLSGEVPPTFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLHGSIPEFIGDLPELEVLQLWENNFTGSIP  349


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
              G + P+ G+  FL  L+++ N+L G +PPEI  I+TL  L +   N F    P ++  
Sbjct  175  FGGRIPPEYGRFQFLEYLAVSGNELVGVIPPEIGNITTLHELYVGYYNTFSGGIPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+ +L  L L  N  SG + P
Sbjct  235  LSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTP  278


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  
Sbjct  487  KFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAPEISKCKLLTYVDLSRNQLSGEIPTEITG  546

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  547  MRILNYLNLSRNHLVGSIPTPISSMQSLTSVDFSYNNFSGLVP  589


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  + ++  L  + L NN+   TFP   +  
Sbjct  392  LFGPIPESLGQCESLSRIRMGENYLNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSIS  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  + L NN+LTG LP  +     ++ L L GN FSGRIP
Sbjct  452  TSLGQISLSNNHLTGPLPTSIGNFAGVQKLLLDGNKFSGRIP  493


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  LV    A   LSG +P EI  +  L  L L  N    +   ++  L
Sbjct  224  FSGGIPPEIGNLSQLVRFDAANCGLSGEIPAEIEKLQNLDTLFLQVNSLSGSLTPEIGTL  283

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L+ LDL NN L+G++P     + +L  L+L  N   G IP
Sbjct  284  KSLKSLDLSNNMLSGEVPPTFADLKNLTLLNLFRNKLHGSIP  325


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S  ++L  ++LSNN      P  +   
Sbjct  416  LNGSIPKGLLSLPQLSQVELQNNLLTGTFPETKSISTSLGQISLSNNHLTGPLPTSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            A +Q L L  N  +G +PVE+ K+  L  +    N FSG I P
Sbjct  476  AGVQKLLLDGNKFSGRIPVEIGKLQQLSKIDFSHNDFSGPIAP  518



>ref|XP_010105101.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
 gb|EXC03886.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Morus notabilis]
Length=1021

 Score =   194 bits (493),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 107/156 (69%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLS KAA T D QSSL +WN ST HCTW  +TCDS  HV SLDLSGLNLSG LS
Sbjct  26   VPEYKALLSFKAALTDDPQSSLATWNASTLHCTWFGITCDSRRHVTSLDLSGLNLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P++  L FL N+S+A NQ SGP+P EISAIS LR LNLSNN+F  TFP +L+QL NLQ+L
Sbjct  86   PELAYLRFLSNVSLADNQFSGPIPAEISAISGLRLLNLSNNVFNGTFPPELSQLKNLQIL  145

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            DLYNNN+TGDLP++V  + +LRHLHLGGNYFSG IP
Sbjct  146  DLYNNNMTGDLPLDVVDLPNLRHLHLGGNYFSGAIP  181


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++++L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIP  350


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +PP  + +  L  LNL  N      P  + +L
Sbjct  273  LSGSLTPELGSLNSLKSMDLSNNMLSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGEL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  333  PELEVLQLWENNFTGSIPQGLGRNGKLQLLDLSSNKLTGTLPP  375


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++ S+N F      +++Q 
Sbjct  466  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  526  KVLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGNIP  567


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+LSG +PPEI +++ LR L +   N +    P ++  
Sbjct  176  FSGAIPKEYGRWEFLEYLAVSGNELSGKIPPEIGSLTNLRELYIGYYNTYEGGLPAEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  236  LSELVRFDGANCALSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  279


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  +  +  + N+ SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FSGRIPPEIGRLQQVSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIPNEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  550  RILNYLNLSRNHLVGNIPSSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P   +L  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  297  LSGEIPPSFAELKNLTLLNLFRNKLHGAIPEFIGELPELEVLQLWENNFTGSIPQGLGRN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP
Sbjct  357  GKLQLLDLSSNKLTGTLPPDMCSGHRLHTLITLGNFLFGPIP  398


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  393  LFGPIPESLGKCQSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLSGDFPESDGTF  452

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            A NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  453  AANLGQISLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPP  496


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/100 (30%), Positives = 50/100 (50%), Gaps = 6/100 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  + ++GQ+      S++ NQLSG +PP I   S ++ L L  N F    P ++ +L  
Sbjct  450  GTFAANLGQI------SLSNNQLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQ  503

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  504  VSKIDFSHNKFSGLITPEISQCKVLTFVDLSRNELSGEIP  543



>emb|CBI35733.3| unnamed protein product [Vitis vinifera]
Length=948

 Score =   192 bits (489),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  39   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  98

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  99   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  158

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP
Sbjct  159  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPP  201


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  268  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  327

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  328  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIP  369


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  484  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  543

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP
Sbjct  544  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIP  585


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  195  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  254

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L  LD+ N  L+G++P E+ K+ +L  L L  N  SG + P
Sbjct  255  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTP  298


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  507  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  566

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  567  MRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLVP  609


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  412  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  471

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPP
Sbjct  472  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPP  514


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  465  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  524

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D  NN  +G++  E+ +   L  + L  N   G IP
Sbjct  525  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIP  561



>gb|EYU41357.1| hypothetical protein MIMGU_mgv1a000718mg [Erythranthe guttata]
Length=1006

 Score =   193 bits (490),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 126/168 (75%), Gaps = 1/168 (1%)
 Frame = +1

Query  88   AGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsld  264
             G+ A  P  + E  ALLSIKAA T D QS+L SWN +T HCTWR VTCD+    V SLD
Sbjct  16   GGSAAATPPHMPEYRALLSIKAAITDDPQSALASWNATTHHCTWRGVTCDASGRRVASLD  75

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            +S L+L+GVLSPDVG+L FLVN S AAN LSGP+PP+IS I  LR LNLSNN+F  +FP 
Sbjct  76   ISNLSLAGVLSPDVGRLRFLVNFSAAANFLSGPIPPQISDIPNLRHLNLSNNVFNLSFPA  135

Query  445  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +L  L NL+VLD+YNNN+TGD P + Y +T+LRHLHLGGN+F+G  PP
Sbjct  136  ELYHLKNLEVLDVYNNNMTGDFPSQAYLLTNLRHLHLGGNFFTGVFPP  183


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N +SG +PPE+  + +L+ ++LSNNI     P   +QL
Sbjct  250  LSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N  TG +P  +  +  L+ L L  N F+G IP
Sbjct  310  QNITLLNLFRNKFTGSIPDFIGDLPELQVLQLWENNFTGIIP  351


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG L P++G L  L ++ ++ N LSG +PP  S +  +  LNL  N F  + P  +  L
Sbjct  274  ISGGLPPELGNLKSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIPDFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  +    +L  + L  N  +G +PP
Sbjct  334  PELQVLQLWENNFTGIIPQNLGDNGNLEEVDLSSNKLTGNLPP  376


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +GV  P+ G  P L  L+++ N+L+G +PP+I  ++ L+ L +   N F    P ++  
Sbjct  177  FTGVFPPEFGSFPHLEYLAVSGNELTGAIPPQIGNLTHLKELYIGYFNTFTGGIPKEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL   D  N  L+G +P E+  + +L  L L  N  SG +PP
Sbjct  237  LSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPP  280


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N  SG + PEIS    L F++LS+N      P ++  +
Sbjct  491  FSGEIPAEIGKLQQLSKIDFSRNDFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  NNL G++P  +  M SL  +    N FSG +P
Sbjct  551  KILNYLNLSRNNLMGNIPSSISGMQSLTSVDFSYNNFSGLVP  592


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG +SP++ +   L  + ++ N+LSGP+P EI+++  L +LNLS N      P  ++ 
Sbjct  514  DFSGQISPEISRCKLLTFVDLSHNRLSGPIPTEITSMKILNYLNLSRNNLMGNIPSSISG  573

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NN +G +P
Sbjct  574  MQSLTSVDFSYNNFSGLVP  592


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G L  L+    A   LSG +P EI  +  L  L L  N      P +L  L
Sbjct  226  FTGGIPKEIGNLSNLIRFDAANCGLSGQIPAEIGNLQNLDTLFLQVNGISGGLPPELGNL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L+ +DL NN L+G++P    ++ ++  L+L  N F+G IP
Sbjct  286  KSLKSMDLSNNILSGEIPPSFSQLQNITLLNLFRNKFTGSIP  327


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N LSG  P     +ST L  ++LSNN      P  +  
Sbjct  418  LNGSIPKGLLSLPKLTQVELQDNLLSGEFPNTDGILSTTLGQISLSNNHLAGRLPPSIGN  477

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             A +Q L L  N  +G++P E+ K+  L  +    N FSG+I P
Sbjct  478  FAAVQKLLLDGNKFSGEIPAEIGKLQQLSKIDFSRNDFSGQISP  521



>ref|XP_003635561.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Vitis vinifera]
Length=1017

 Score =   192 bits (488),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 103/163 (63%), Positives = 127/163 (78%), Gaps = 0/163 (0%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN  279
            A  P  + E  ALLS++ A + D +S L +WNISTSHCTW  VTCD+  HVV+L+LSGLN
Sbjct  20   AATPPRIPEYRALLSLRTAISYDPESPLAAWNISTSHCTWTGVTCDARRHVVALNLSGLN  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LS D+  L FLVNL++AANQ  GP+PPE+S +S LR LNLSNN+F  TFP QLA+L
Sbjct  80   LSGSLSSDIAHLRFLVNLTLAANQFVGPIPPELSLVSGLRQLNLSNNVFNETFPSQLARL  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VLDLYNNN+TGDLP+ V +M +LRHLHLGGN+F+G IPP
Sbjct  140  KRLEVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFTGIIPP  182


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   A+L
Sbjct  249  LSGEIPPEIGKLQNLDTLFLQVNTLSGPLTPELGNLKSLKSMDLSNNVLAGEIPEAFAEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIP  350


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P VG    L  L +  N+ SG +PPEI  +  L  ++ SNN F      +++Q 
Sbjct  465  LTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L GD+P E+  M  L +L+L  N+  G IP
Sbjct  525  KVLTFVDLSRNELFGDIPTEITGMRILNYLNLSRNHLIGSIP  566


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G++ P  GQ  FL  L+++ N+L GP+PPEI  +++L+ L +   N +    P ++  
Sbjct  176  FTGIIPPAYGQWEFLEYLAVSGNELHGPIPPEIGNLTSLQQLYVGYYNTYDGGIPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L  LD+ N  L+G++P E+ K+ +L  L L  N  SG + P
Sbjct  236  LTSLVRLDMANCLLSGEIPPEIGKLQNLDTLFLQVNTLSGPLTP  279


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G L  L  +  + N+ SG + PEIS    L F++LS N      P ++  
Sbjct  488  KFSGRIPPEIGMLQQLSKMDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIPTEITG  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  MRILNYLNLSRNHLIGSIPASLASMQSLTSVDFSYNNLSGLVP  590


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGRCESLSRIRMGENFLNGSIPKGLFDLPKLTQVELQDNYLTGEFPEIDSTP  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  + L NN LTG LP  V   + L+ L L GN FSGRIPP
Sbjct  453  DSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPP  495


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/97 (31%), Positives = 48/97 (49%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P++   P  L  +S++ NQL+G +PP +   S L+ L L  N F    P ++  L  L  
Sbjct  446  PEIDSTPDSLGQISLSNNQLTGSLPPSVGNFSGLQKLLLDGNKFSGRIPPEIGMLQQLSK  505

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D  NN  +G++  E+ +   L  + L  N   G IP
Sbjct  506  MDFSNNKFSGEITPEISQCKVLTFVDLSRNELFGDIP  542



>ref|XP_009375880.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1015

 Score =   191 bits (485),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 98/160 (61%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPDV  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP QL+ L  L
Sbjct  80   TLSPDVAHLRFLANLTLAENQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPQLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPP
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPP  179


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+NL   D  N NLTG++P EV ++ ++  L L  N  SG +
Sbjct  233  LSNLVRFDAANCNLTGEIPPEVGRLQNVDTLFLQVNALSGSL  274


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P+VG+L  +  L +  N LSG +  E+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEIPPEVGRLQNVDTLFLQVNALSGSLTLELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIP  347


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  +  +    N+  GP+ PEIS    L F++LS N      P ++  +
Sbjct  486  FSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHCKLLTFVDLSRNELSGEIPKEITGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  546  RILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  +  ++  +N F      +++  
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQVSKMDFKHNKFMGPITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  522  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGSIP  563


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  450  GNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGRIPP  492


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIP  419


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  294  FTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKN  353

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP ++    +L+ L    N+  G IP
Sbjct  354  GKLQILDLSSNKLTGTLPPDMCFGNNLQTLITLSNFLFGPIP  395



>ref|XP_009354585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Pyrus x bretschneideri]
Length=1014

 Score =   189 bits (479),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPPQLSNLTRLTV  140

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPP
Sbjct  141  LDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPP  178


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIP  346


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGMPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + P
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTP  275


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTPELGYLKSLKSMDLSNNMFTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPP  371


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  521  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLFGSIP  562


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P+++  +
Sbjct  485  FSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISQCKLLTFVDLSRNELSGEIPNEITGM  544

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  545  RILNYLNLSRNHLFGSIPSSISTMQSLTSVDFSYNNLSGLVP  586


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFSLPKLTQVELQDNLLDGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  491


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 44/88 (50%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P ++ +L  L  +D  +N   
Sbjct  451  LGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFM  510

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L  + L  N  SG IP
Sbjct  511  GSITPEISQCKLLTFVDLSRNELSGEIP  538



>ref|XP_008344369.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Malus domestica]
Length=1015

 Score =   189 bits (479),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 96/160 (60%), Positives = 121/160 (76%), Gaps = 1/160 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPXKLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPP
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPP  179


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + P
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTP  276


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIP  347


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPP  372


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIP  563


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   +
Sbjct  486  FSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  546  RILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  492


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIP  419



>ref|XP_007208421.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
 gb|EMJ09620.1| hypothetical protein PRUPE_ppa000739mg [Prunus persica]
Length=1017

 Score =   188 bits (477),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 120/157 (76%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            +++  ALLS K++ ++D  S L+SW  +TSHCTW  VTCDS  HV SLDLS  +L G LS
Sbjct  22   MSDYRALLSFKSSISSDPNSVLSSWTPTTSHCTWTGVTCDSRRHVTSLDLSSSDLVGTLS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  L FL NL++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ L  L VL
Sbjct  82   SDIAHLRFLSNLTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSNLTRLAVL  141

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPP
Sbjct  142  DLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGRIPP  178


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+I+ N+L G +PPEI  +++L+ L +   NI+    P ++  
Sbjct  172  FSGRIPPEFGRFPLLEYLAISGNELGGSIPPEIGNLTSLKELYIGYYNIYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +
Sbjct  232  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSL  273


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  244  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  304  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIP  346


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPP  371


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP
Sbjct  521  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIP  562


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  +
Sbjct  485  FSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITGM  544

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  545  RILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  586


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCGSLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLAGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  449  VNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  491


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L  L+LS+N    T P  +   
Sbjct  317  LHGAIPEFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFG  376

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L    N L G +P  + +  SL  + +G N+ +G IP
Sbjct  377  NNLQTLITLGNFLFGPIPESLGRCGSLSRIRMGENFLNGSIP  418



>gb|KDO78771.1| hypothetical protein CISIN_1g001816mg [Citrus sinensis]
Length=1010

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPP
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPP  176


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIP  344


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  584


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIP  320


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIP  488


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI P
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAP  513



>ref|XP_006426178.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
 gb|ESR39418.1| hypothetical protein CICLE_v10024796mg [Citrus clementina]
Length=1012

 Score =   187 bits (475),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  22   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  81

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  82   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  141

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPP
Sbjct  142  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPP  178


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  245  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  304

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  305  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIP  346


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  484  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  544  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  586


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  222  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  281

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  282  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIP  322


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  389  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP
Sbjct  449  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIP  490


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  413  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  472

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI P
Sbjct  473  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAP  515



>ref|XP_006466390.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Citrus sinensis]
Length=1010

 Score =   187 bits (475),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 113/157 (72%), Positives = 132/157 (84%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V E  ALLSIK++ T D QSSL +WN +TSHCTW  VTCDS  HV SLDLSGLNLSG LS
Sbjct  20   VPEYKALLSIKSSITDDPQSSLAAWNATTSHCTWPGVTCDSRRHVTSLDLSGLNLSGALS  79

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AANQLSGP+PPEISA+S+LR LNLSNN+F  +FP QL+QLA+LQVL
Sbjct  80   PDVAHLRFLQNLSVAANQLSGPIPPEISALSSLRLLNLSNNVFNGSFPPQLSQLASLQVL  139

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TGDLP+ V ++ +LRHLHLGGN+FSG+IPP
Sbjct  140  DLYNNNMTGDLPLAVTQLRNLRHLHLGGNFFSGQIPP  176


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  L  L +  N LSGP+  E+  + +L+ ++LSNNIF    P   A+L
Sbjct  243  LSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLKSLKSMDLSNNIFTGEIPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  303  KNLTLLNLFRNKLHGAIPEFIGVMPRLEVLQLWENNFTGSIP  344


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+ SG + PEIS    L F++LS N      P+QL  
Sbjct  482  KFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAPEISQCKLLTFVDLSRNELSGEIPNQLTG  541

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  542  MRILNYLNLSRNHLVGSIPASIASMQSLTSVDFSYNNLSGLVP  584


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV    A   LSG +P +I  +  L  L L  N        +L  L 
Sbjct  220  TGGLPPEIGNLSSLVRFDAANCGLSGEIPTDIGRLQNLDTLFLQVNALSGPLTTELGYLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  280  SLKSMDLSNNIFTGEIPASFAELKNLTLLNLFRNKLHGAIP  320


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  + +L  + L +N     FP   +  
Sbjct  387  LFGPIPESLGKCDSLSRMRMGENFLNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSIS  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  + K + ++ L L GN FSG+IP
Sbjct  447  VNLGQICLSNNQLSGSLPASIGKFSGVQKLLLDGNKFSGQIP  488


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N L+G  P   S    L  + LSNN    + P  + + 
Sbjct  411  LNGSIPKGLFGLPSLSQVELQDNYLTGQFPVSDSISVNLGQICLSNNQLSGSLPASIGKF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + +Q L L  N  +G +P E+ K+  L  +    N FSGRI P
Sbjct  471  SGVQKLLLDGNKFSGQIPAEIGKLQQLSKMDFSHNKFSGRIAP  513



>ref|XP_008393812.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1014

 Score =   187 bits (474),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 95/158 (60%), Positives = 120/158 (76%), Gaps = 1/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +++  ALLS+K++ T+D  S+L++W  +TSHCTW  VTCDS    V+      L+L+G L
Sbjct  21   MSDYRALLSLKSSITSDPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTGTL  80

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+  L FL NL++A NQ SGP+PP+ISA+S LR LNLSNN+F +TFP QL+ L  L V
Sbjct  81   SPDLAHLRFLSNLTLAENQFSGPIPPDISALSGLRLLNLSNNVFNTTFPRQLSNLTRLTV  140

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNNLTG LPV V  MTSLRHLHLGGN+FSG+IPP
Sbjct  141  LDLYNNNLTGKLPVSVTHMTSLRHLHLGGNFFSGQIPP  178


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L G +PPEI  ++TL+ L +   N +    P ++  
Sbjct  172  FSGQIPPEFGRFPFLEYLAVSGNELGGSIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + P
Sbjct  232  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGWLTP  275


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN++    P   ++
Sbjct  244  NLTGEVPPELGRLQNVDTLFLQVNALSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSE  303

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  304  LKNLTLLNLFRNRLHGAIPEFIGDLPELQVLQLWENNFTGSIP  346


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  269  LSGWLTPELGYLKSLKSMDLSNNMYTGEIPGSFSELKNLTLLNLFRNRLHGAIPEFIGDL  328

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  329  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPP  371


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  461  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  521  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLXGSIP  562


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P ++  
Sbjct  484  KFSGRIPPEIGRLQQLSKMDFKHNKFMGSITPEISLCKLLTFVDLSRNELSGEIPKEITG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  544  MRILNYLNLSRNHLXGSIPSSISTMQSLTSVDFSYNNLSGLVP  586


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  389  LFGPIPESLGRCDSLSRIRMGDNFLNGSIPKGLFXLPKLTQVELQDNLLDGSFPETDTIS  448

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  449  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  491



>ref|XP_002875982.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH52241.1| hypothetical protein ARALYDRAFT_906265 [Arabidopsis lyrata subsp. 
lyrata]
Length=1001

 Score =   186 bits (473),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 98/158 (62%), Positives = 119/158 (75%), Gaps = 2/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +TE  ALLS+K++FT D  S LTSWN+ST+ C+W  VTCD  L  V+      LNLSG L
Sbjct  25   ITELNALLSLKSSFTIDEHSPLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGTL  84

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +  LR LNLSNN+F  ++P +L+  L NL+
Sbjct  85   SSDVSHLPLLQNLSLAANQISGPIPPEISNLYELRHLNLSNNVFNGSYPDELSSGLVNLR  144

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP
Sbjct  145  VLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFSGKIP  182


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  250  LTGEIPPEIGKLQKLDTLFLQVNAFSGTLTSELGFISSLKSMDLSNNMFTGEIPASFSQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIP  351


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  467  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  527  KLLTFVDLSRNELSGDIPKEITGMRILNYLNLSRNHLVGSIP  568


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG +
Sbjct  237  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSGTL  278


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  491  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPKEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  551  RILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVP  592


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F    PH+L + 
Sbjct  298  FTGEIPASFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGGIPHKLGEN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LDL +N LTG LP  +     L  L   GN+  G IP
Sbjct  358  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIP  399



>ref|XP_008354741.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Malus domestica]
Length=1015

 Score =   185 bits (469),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 120/160 (75%), Gaps = 1/160 (1%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            + ++   ALLS+K++ T+   S+L++W  +TSHCTW  VTCDS    V+      L+L+G
Sbjct  20   IAMSNYRALLSLKSSITSXPNSALSTWTPTTSHCTWSGVTCDSSRRYVTSLDLSGLDLTG  79

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L FL NL++A NQ SGP+PPEISA+S LR LNLSNN+F +TFP +L+ L  L
Sbjct  80   TLSPDLAHLRFLANLTLADNQFSGPIPPEISALSGLRLLNLSNNVFNTTFPPKLSNLTRL  139

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSG+IPP
Sbjct  140  TVLDLYNNNLTGDLPVSVTHMTSLRHLHLGGNFFSGQIPP  179


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+ PFL  L+++ N+L GP+PPEI  ++TL+ L +   N +    P ++  
Sbjct  173  FSGQIPPEFGRFPFLEYLAVSGNELGGPIPPEIGNLTTLKELYIGYFNSYEGGIPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL   D  N NLTG++P E+ ++ ++  L L  N  SG + P
Sbjct  233  LSNLVRFDAANCNLTGEVPPELGRLQNVDTLFLQVNALSGSLTP  276


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++G+L  +  L +  N LSG + PE+  + +L+ ++LSNN+F    P   ++
Sbjct  245  NLTGEVPPELGRLQNVDTLFLQVNALSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSE  304

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  305  LKNLTLLNLFRNRLHGAIPDFIGDLPELQVLQLWENNFTGSIP  347


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTPELGYLKSLKSMDLSNNVFTGEIPGSFSELKNLTLLNLFRNRLHGAIPDFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  330  PELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPP  372


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++  +N F  +   +++  
Sbjct  462  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E   M  L +L+L  N+  G IP
Sbjct  522  KLLTFVDLSRNELSGEIPKEXTGMRILNYLNLSRNHLVGSIP  563


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP   +  
Sbjct  390  LFGPIPESLGRCDSLSRIRMGDNYLNGSIPKGLLSLPKLTQVELQDNLLDGSFPETDSIS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  450  GNLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  492


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +    N+  G + PEIS    L F++LS N      P +   +
Sbjct  486  FSGRIPPEIGRLQQLSKIDFKHNKFMGSITPEISHCKLLTFVDLSRNELSGEIPKEXTGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  546  RILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  587


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    T P  +   
Sbjct  318  LHGAIPDFIGDLPELQVLQLWENNFTGSIPQGLGKNGKLQILDLSSNKLTGTLPPDMCFG  377

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L   +N L G +P  + +  SL  + +G NY +G IP
Sbjct  378  NNLQTLITLSNFLFGPIPESLGRCDSLSRIRMGDNYLNGSIP  419



>ref|NP_001235080.1| receptor-like protein kinase 3 precursor [Glycine max]
 gb|AAF91324.1|AF244890_1 receptor-like protein kinase 3 [Glycine max]
Length=1012

 Score =   184 bits (466),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 98/157 (62%), Positives = 126/157 (80%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++A T  +   LTSWN ST +C+W  VTCD+  HV SLDL+GL+LSG LS
Sbjct  25   ISEYRALLSLRSAITDATPPLLTSWNSSTPYCSWLGVTCDNRRHVTSLDLTGLDLSGPLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+A+N+ SGP+PP +SA+S LRFLNLSNN+F  TFP +L++L NL+VL
Sbjct  85   ADVAHLPFLSNLSLASNKFSGPIPPSLSALSGLRFLNLSNNVFNETFPSELSRLQNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPP
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPP  181


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSGVL P +G    +  L +  N  +G +PP+I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGGIP  565


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPPQIGRLQQLSKIDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  RILNYLNLSRNHLVGGIPSSISSMQSLTSVDFSYNNLSGLVP  589


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P +  +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L G +P  + ++ +L  + L  N F+G IP
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIP  349


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+V+ L+ NN TG +P  + K   L  + L  N  +G +P
Sbjct  332  PALEVVQLWENNFTGSIPEGLGKNGRLNLVDLSSNKLTGTLP  373


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELEGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L++L+ L + Y N  TG +P E+  ++ L  L       SG IP
Sbjct  210  LSSLRELYIGYYNTYTGGIPPEIGNLSELVRLDAAYCGLSGEIP  253


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGSCESLTRIRMGENFLNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   +S++ L L GN F+GRIPP
Sbjct  452  VNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPP  494


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+VG +   L  ++++ NQLSG +PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGVLPPSIGNFSSVQKLILDGNMFTGRIPPQIGRLQQLSK  504

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D   N  +G +  E+ +   L  L L  N  SG IP
Sbjct  505  IDFSGNKFSGPIVPEISQCKLLTFLDLSRNELSGDIP  541


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L  A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDAAYCGLSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP
Sbjct  285  SLKSMDLSNNMLSGEIPARFGELKNITLLNLFRNKLHGAIP  325


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +    G+L  +  L++  N+L G +P  I  +  L  + L  N F  + P  L + 
Sbjct  296  LSGEIPARFGELKNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNFTGSIPEGLGKN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +    +L+ L   GN+  G IP
Sbjct  356  GRLNLVDLSSNKLTGTLPTYLCSGNTLQTLITLGNFLFGPIP  397


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  416  LNGSIPRGLFGLPKLTQVELQDNYLSGEFPEVGSVAVNLGQITLSNNQLSGVLPPSIGNF  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +++Q L L  N  TG +P ++ ++  L  +   GN FSG I P
Sbjct  476  SSVQKLILDGNMFTGRIPPQIGRLQQLSKIDFSGNKFSGPIVP  518



>ref|XP_006404116.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
 gb|ESQ45569.1| hypothetical protein EUTSA_v10010092mg [Eutrema salsugineum]
Length=1009

 Score =   182 bits (462),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 119/167 (71%), Gaps = 7/167 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldls  270
            AG+P  ++E  ALLS+K++ T    D  S LTSW +STS C W  VTCD     V+    
Sbjct  31   AGRP--ISEYHALLSLKSSLTGGENDQHSPLTSWKLSTSFCLWTGVTCDVSRRHVTSLDL  88

Query  271  g-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
              LNLSG LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNNIF  ++P +
Sbjct  89   SGLNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEISNLSELRHLNLSNNIFNGSYPDE  148

Query  448  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L A L NLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+G IP
Sbjct  149  LSAGLVNLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFAGNIP  195


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N  SGP+ PE+  IS+L+ ++LSNN+F    P    QL
Sbjct  263  LTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLKSMDLSNNMFTGEIPASFEQL  322

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  323  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIP  364


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/95 (37%), Positives = 53/95 (56%), Gaps = 1/95 (1%)
 Frame = +1

Query  307  GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDL  483
            G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  L+ L   D 
Sbjct  199  GTWPVLEYLAVSGNELVGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGNLSELVRFDA  258

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             N  LTG++P E++K+  L  L L  N FSG + P
Sbjct  259  ANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTP  293


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N F      +L  +++L+
Sbjct  243  LPPEIGNLSELVRFDAANCGLTGEIPPEIWKLQKLDTLFLQVNAFSGPLTPELGMISSLK  302

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  303  SMDLSNNMFTGEIPASFEQLKNLTLLNLFRNKLYGAIP  340


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  461  VSGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGQIPSEIGRL  514

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LD  +N  +G +  E+     L  + L  N  SG IP
Sbjct  515  QQLSKLDFSHNLFSGRITPEISHCKLLTFVDLSRNELSGEIP  556


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++     L  + ++ N+LSG +P EI+++  L +LN+S N    + P  +A +
Sbjct  527  FSGRITPEISHCKLLTFVDLSRNELSGEIPNEITSMRILNYLNISRNHLVGSIPVTIASM  586

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  587  QSLTSVDFSYNNLSGLVP  604



>ref|NP_190536.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 sp|Q9M2Z1.1|BAME2_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2; AltName: Full=Protein BARELY ANY MERISTEM 
2; Flags: Precursor [Arabidopsis thaliana]
 emb|CAB66905.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAO64138.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 gb|AAP04098.1| putative leucine-rich repeat transmembrane protein kinase [Arabidopsis 
thaliana]
 dbj|BAF00510.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59331.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AEE78574.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1002

 Score =   181 bits (460),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 98/159 (62%), Positives = 119/159 (75%), Gaps = 3/159 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGV  291
            +TE  ALLS+K++FT D  S L TSWN+ST+ C+W  VTCD  L  V+      LNLSG 
Sbjct  25   ITELHALLSLKSSFTIDEHSPLLTSWNLSTTFCSWTGVTCDVSLRHVTSLDLSGLNLSGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            LS DV  LP L NLS+AANQ+SGP+PP+IS +  LR LNLSNN+F  +FP +L+  L NL
Sbjct  85   LSSDVAHLPLLQNLSLAANQISGPIPPQISNLYELRHLNLSNNVFNGSFPDELSSGLVNL  144

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +VLDLYNNNLTGDLPV +  +T LRHLHLGGNYFSG+IP
Sbjct  145  RVLDLYNNNLTGDLPVSLTNLTQLRHLHLGGNYFSGKIP  183


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++LSNN+F    P   +QL
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNAFTGTITQELGLISSLKSMDLSNNMFTGEIPTSFSQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + +M  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIP  352


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G L  +  L +  N+ SG +PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  468  LSGSLPAAIGNLSGVQKLLLDGNKFSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSRNELSGDIPNELTGMKILNYLNLSRNHLVGSIP  569


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P++L  +
Sbjct  492  FSGSIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNELTGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  552  KILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVP  593


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  178  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+ L   D  N  LTG++P E+ K+  L  L L  N F+G I
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFTGTI  279


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPTSFSQLKNLTLLNLFRNKLYGAIPEFIGEMPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LDL +N LTG LP  +     L  L   GN+  G IP
Sbjct  359  GRLVILDLSSNKLTGTLPPNMCSGNRLMTLITLGNFLFGSIP  400



>gb|KFK34238.1| hypothetical protein AALP_AA5G119100 [Arabis alpina]
Length=998

 Score =   180 bits (457),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 109/165 (66%), Positives = 127/165 (77%), Gaps = 5/165 (3%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsg  273
            A +P   TE  ALLS+K + T+  QSS LTSWN+S S C W  VTCD  L  V SLDLS 
Sbjct  17   AARP--TTELHALLSLKTSLTSGEQSSSLTSWNLSKSFCLWAGVTCDVSLRHVTSLDLSS  74

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-  450
            LNLSG LS DV  LP L NLS+AANQ+SGP+PPEI+ +S LR LNLSNN+F  ++P+QL 
Sbjct  75   LNLSGTLSSDVAHLPLLQNLSVAANQISGPIPPEIANLSELRHLNLSNNVFNGSYPNQLS  134

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A+LANLQVLDLYNNNLTGDLPV +  +T LRHLHLGGNYF+GRIP
Sbjct  135  ARLANLQVLDLYNNNLTGDLPVSITNLTQLRHLHLGGNYFTGRIP  179


 Score = 73.9 bits (180),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P    QL
Sbjct  247  LTGEIPPEIGKLQKLDTLFLQVNAFSGPLTSELGVISSLKSMDLSNNMFTGEIPASFEQL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGDLPELEVLQLWENNFTGSIP  348


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L P +G    +  L +  N+  GP+PPEI  +  L  L+ S+N+F      +++Q
Sbjct  463  HLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQ  522

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  523  CKLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLLGSIP  565


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G +    G  P L  L+++ N+L G +PPEI  ++TL+ L +   N F +  P ++ +
Sbjct  174  FTGRIPAVYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLKELYIGYYNAFENGLPPEIGK  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  234  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNAFSG  273


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  L  L  + N   G + PEIS    L F++LS N      P+++  +
Sbjct  488  FGGPIPPEIGRLQQLSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIPNEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  548  RILNYLNLSRNHLLGSIPVTMASMQSLTSVDFSYNNLSGLVP  589


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 6/100 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GV+S ++GQ+      S++ N LSGP+PP I   S ++ L L  N FG   P ++ +L  
Sbjct  448  GVVSVNLGQI------SLSNNHLSGPLPPAIGNFSGVQKLLLDGNKFGGPIPPEIGRLQQ  501

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  LD  +N   G +  E+ +   L  + L  N  SG IP
Sbjct  502  LSKLDFSHNLFPGRIAPEISQCKLLTFVDLSRNELSGEIP  541



>ref|XP_006290548.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
 gb|EOA23446.1| hypothetical protein CARUB_v10016631mg [Capsella rubella]
Length=997

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 93/158 (59%), Positives = 116/158 (73%), Gaps = 2/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +TE  ALLS+K++ T D  S L SWN+ST+ C+W  VTCD     V+      L+LSG L
Sbjct  22   ITELQALLSLKSSLTGDEHSPLNSWNLSTTFCSWTGVTCDVSRRHVTSLDLSGLDLSGTL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
            S DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L NL+
Sbjct  82   SSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRHLNLSNNVFNGSYPDELSSGLVNLR  141

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP
Sbjct  142  VLDLYNNNLTGVLPLSITNLTELRHLHLGGNYFSGKIP  179


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +G +  E+  IS+L+ ++ SNN+F    P   A+L
Sbjct  247  LTGAIPPEIGKLQNLDTLFLQVNAFAGTLTQELGWISSLKSMDFSNNMFTGEIPASFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  307  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIP  348


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  463  LSGPLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  522

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  523  KLLTFVDLSRNELSGDIPNEITGMKILNYLNLSRNHLVGSIP  564


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  487  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  547  KILNYLNLSRNHLVGSIPVTIASMQSLTSVDFSYNNLSGLVP  588


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  +++LR L +   N F    P ++  
Sbjct  174  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTSLRELYIGYYNAFEDGLPPEIGN  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+ L   D  N  LTG +P E+ K+ +L  L L  N F+G +
Sbjct  234  LSELVRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAGTL  275


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L + 
Sbjct  295  FTGEIPASFAELKNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIPQKLGEN  354

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LDL +N LTG LP  +     L  L   GN+  G IP
Sbjct  355  GRLVILDLSSNKLTGTLPPNMCSGNRLVTLITLGNFLFGSIP  396



>ref|XP_010028033.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Eucalyptus grandis]
 gb|KCW54695.1| hypothetical protein EUGRSUZ_I00635 [Eucalyptus grandis]
Length=1023

 Score =   179 bits (453),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 108/178 (61%), Positives = 131/178 (74%), Gaps = 9/178 (5%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTS-------HCTWRRVTCd  237
            R  A A A  P  +TE  ALLSI+AA T D QS+L+SW  + +       HC+W+ VTCD
Sbjct  17   RRGAAASAA-PTRLTEPLALLSIRAAVTGDPQSALSSWTSAAAAAANGSSHCSWQGVTCD  75

Query  238  -sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS  414
                HV +LDLS L L+G LSPDV  L FL++LS+AANQLSGP+PP+ISA++ LR+LNLS
Sbjct  76   PRRRHVTALDLSSLELAGALSPDVAHLRFLISLSVAANQLSGPIPPQISALAALRYLNLS  135

Query  415  NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NN+F  TFP +L  L NL+VLDLYNNN+TGDLPV V +M  LRHLHLGGNYF GRIPP
Sbjct  136  NNVFNGTFPPRLGLLRNLRVLDLYNNNMTGDLPVAVAEMPQLRHLHLGGNYFGGRIPP  193


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++ +L  L  L +  N  +G +P EI  +++L+ L+LSNN+F    P   +QL
Sbjct  260  LSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIPESFSQL  319

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L L+ N L G++P  +  +  L+ L L  N F+G IP
Sbjct  320  KNLTLLHLFRNKLNGEIPEFIADLPELQVLQLWENNFTGSIP  361


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV L  A+  LSG +PPEI+ +  L  L L  N F  + P ++  L +
Sbjct  238  GSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAKLQNLDTLFLQVNGFAGSLPAEIGYLNS  297

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN   G++P    ++ +L  LHL  N  +G IP
Sbjct  298  LKSLDLSNNMFAGEIPESFSQLKNLTLLHLFRNKLNGEIP  337


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G+L  L  +  ++N+ SGP+P +IS    L F++LS N      P+++  
Sbjct  500  NFSGQIPPEIGRLQQLAKIDFSSNRYSGPIPAQISQCKLLTFVDLSGNELSGEIPNEITG  559

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L +NNL+G +P  +  M SL  +    N  SG +P
Sbjct  560  MRILNYLNLSSNNLSGSIPPSISTMQSLTSVDFSYNNLSGLVP  602


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L +   N   G +PPEI  +S L  L+ ++       P ++A+
Sbjct  211  LTGAIPPEIGNLTTLRELYLGYYNSYDGSLPPEIGNLSQLVRLDAASCGLSGEIPPEIAK  270

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL  L L  N   G LP E+  + SL+ L L  N F+G IP
Sbjct  271  LQNLDTLFLQVNGFAGSLPAEIGYLNSLKSLDLSNNMFAGEIP  313


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G +   +  LP L  L +  N  +G +P  +     L+ ++LS+N    T P  L  
Sbjct  331  KLNGEIPEFIADLPELQVLQLWENNFTGSIPQGLGKNGHLQIVDLSSNKLTGTLPPDLCY  390

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               LQ+L   +N L G +P  + K  SL  + +GGNY +G IP
Sbjct  391  GNQLQILIALSNYLLGPIPESLGKCRSLERIRMGGNYLNGSIP  433



>ref|XP_004511796.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1009

 Score =   178 bits (452),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 122/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS++ A T  +   L+SWN ST+HC W  VTCD+  HV +L+L+GLNLSG L+
Sbjct  23   ISEYRALLSLREAITDTNPPILSSWNPSTTHCIWLGVTCDTRRHVTALNLTGLNLSGTLA  82

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+  LPFL NLS+A N+ SG +PP +SA+S LR LNLSNN+F  TFP +L+QL +L+VL
Sbjct  83   ADIAHLPFLSNLSLADNKFSGEIPPSLSAVSGLRLLNLSNNVFNGTFPSELSQLKSLEVL  142

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LP+ V ++ +LRHLHLGGNYF+G+IPP
Sbjct  143  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYFTGQIPP  179


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   +QL
Sbjct  246  LSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGDMPALEVVQLWENNFTGNIP  347


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G+L  L N+  + N+ SGP+  EIS    L F++LS N      P+++  +
Sbjct  486  FTGKIPSQIGRLQQLSNIDFSHNKFSGPIASEISQCKLLTFVDLSRNELSGVIPNEITGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P+ +  M SL  +    N  SG +P
Sbjct  546  RILNYLNLSRNHLVGSIPISISSMQSLTSVDFSYNNLSGLVP  587


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  270  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIPEFIGDM  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+V+ L+ NN TG++P+ +     L  L L  N  +G +PP
Sbjct  330  PALEVVQLWENNFTGNIPMGLGSNGKLTLLDLSSNKLTGTLPP  372


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  223  AGGIPPEIGNLTELVRLDAAYCGLSGEIPAEMGKLQKLDTLFLQVNALSGSLTWELGNLK  282

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  283  SLKSMDLSNNMLTGEIPTSFSQLKNLTLLNLFRNKLHGAIP  323


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N  +G +PPE      L +L +S N    T P  +  
Sbjct  148  NMTGTLPLAVTELPNLRHLHLGGNYFTGQIPPEYGLWQHLEYLAVSGNELDGTIPPGIGN  207

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ L + Y N   G +P E+  +T L  L       SG IP
Sbjct  208  LTSLRELYIGYYNTYAGGIPPEIGNLTELVRLDAAYCGLSGEIP  251


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  390  LFGPIPESLGSCESLNRIRMGDNFLNGSIPKGLFGLPKLTQVELQDNYLSGNFPETHSVS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  +   TS++   L GN F+G+IP
Sbjct  450  VNLGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIP  491


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/88 (31%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSG +PP I   ++++   L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQITLSNNQLSGVLPPSIGNFTSMQKFLLDGNMFTGKIPSQIGRLQQLSNIDFSHNKFS  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L  + L  N  SG IP
Sbjct  512  GPIASEISQCKLLTFVDLSRNELSGVIP  539



>ref|XP_004288299.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Fragaria vesca subsp. vesca]
Length=1023

 Score =   177 bits (450),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            ALLS+K++   D  S L+SW  +TSHCTW  VTCDS  HV SLDLSGLNLSG LSPD+  
Sbjct  38   ALLSLKSSLD-DPDSRLSSWTPNTSHCTWAGVTCDSHNHVTSLDLSGLNLSGYLSPDIAF  96

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L +L NL++A N LSGP+PPEISA+  LR LNLSNN+F  TFP +L+ L NL+VLDLYNN
Sbjct  97   LVYLSNLTLAENNLSGPIPPEISALPALRLLNLSNNVFNRTFPPELSNLTNLRVLDLYNN  156

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NLTG LPV V  MT+LRHLHLGGN+F G IPP
Sbjct  157  NLTGVLPVSVTHMTNLRHLHLGGNFFEGSIPP  188


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+
Sbjct  254  NLSGEIPPELGRLQNVDTLFLQVNALSGSLTSELGSLKSLKSMDLSNNLFSGEIPTSFAE  313

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  314  LKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIP  356


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N+F      ++++ 
Sbjct  471  LSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  531  KVLAYVDLSRNELSGEIPKEITGMRILNYLNLSRNHLVGNIP  572


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  L  +  + N  SGP+ PEIS    L +++LS N      P ++  +
Sbjct  495  FSGRIPPEIGHLEQLSKIDFSHNLFSGPIAPEISRCKVLAYVDLSRNELSGEIPKEITGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  555  RILNYLNLSRNHLVGNIPAPISAMQSLTSVDFSYNNLSGLVP  596


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  399  LFGPIPESLGECKSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNFLNGPFPVSDSVS  458

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            A L  + L NN L+G LP  +   T ++ L L GN FSGRIPP
Sbjct  459  AGLGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPP  501


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +     +L  L  L++  NQL G +P  I  +  L+ L L  N F  + P  L + 
Sbjct  303  FSGEIPTSFAELKNLTLLNLFRNQLHGAIPDFIGDLPELQVLQLWENNFTGSIPQSLGRN  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ++DL +N LTG LP ++    +L+ L   GN+  G IP
Sbjct  363  GKLQLVDLSSNKLTGALPPDMCSGNNLQTLITLGNFLFGPIP  404


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 46/88 (52%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSGP+PP I   + ++ L L  N F    P ++  L  L  +D  +N  +
Sbjct  461  LGQISLSNNRLSGPLPPAIGNFTGVQKLLLDGNKFSGRIPPEIGHLEQLSKIDFSHNLFS  520

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L ++ L  N  SG IP
Sbjct  521  GPIAPEISRCKVLAYVDLSRNELSGEIP  548



>ref|XP_002310320.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
 gb|EEE90770.2| hypothetical protein POPTR_0007s14500g [Populus trichocarpa]
Length=1020

 Score =   177 bits (449),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +T  C+W  +TCD +   V SLDLSGLNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTTPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S DV  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDVAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIP  184


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIP  353


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLVGSIPAPIATMQSLTSVDFSYNNLSGLVP  593


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTPELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN T  +P  + +   L  L L  N  +G +PP
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLEILDLSSNKLTGTLPP  378


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  L L NN LTG LP  V   + ++   L GN FSG IPP
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKFLLDGNKFSGSIPP  498


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L++LDL +N LTG LP  +    +L+ L    N+  G IP
Sbjct  360  GKLEILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIP  401



>ref|NP_001237715.1| receptor-like protein kinase 2 precursor [Glycine max]
 gb|AAF91323.1|AF244889_1 receptor-like protein kinase 2 [Glycine max]
Length=1012

 Score =   177 bits (448),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 123/157 (78%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS+++  T  +   L+SWN S  +C+W  VTCD+  HV +L+L+GL+LSG LS
Sbjct  25   ISEYRALLSLRSVITDATPPVLSSWNASIPYCSWLGVTCDNRRHVTALNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             DV  LPFL NLS+AAN+ SGP+PP +SA+S LR+LNLSNN+F  TFP +L +L +L+VL
Sbjct  85   ADVAHLPFLSNLSLAANKFSGPIPPSLSALSGLRYLNLSNNVFNETFPSELWRLQSLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LP+ V +M +LRHLHLGGN+FSG+IPP
Sbjct  145  DLYNNNMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPP  181


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P     +  +  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+V+ L+ NNLTG +P  + K   L  + L  N  +G +PP
Sbjct  332  PALEVVQLWENNLTGSIPEGLGKNGRLNLVDLSSNKLTGTLPP  374


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP +G    +  L +  N  +G +P +I  +  L  ++ S N F      +++Q 
Sbjct  464  LSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQC  523

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  524  KLLTFLDLSRNELSGDIPNEITGMRILNYLNLSKNHLVGSIP  565


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G+L  L  +  + N+ SGP+ PEIS    L FL+LS N      P+++  +
Sbjct  488  FTGRIPTQIGRLQQLSKIDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIPNEITGM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  RILNYLNLSKNHLVGSIPSSISSMQSLTSVDFSYNNLSGLVP  589


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNMLSGEIPASFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L G +P  + ++ +L  + L  N  +G IP
Sbjct  308  KNITLLNLFRNKLHGAIPEFIGELPALEVVQLWENNLTGSIP  349


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++GVL   V Q+  L +L +  N  SG +PPE      L++L +S N    T P ++  
Sbjct  150  NMTGVLPLAVAQMQNLRHLHLGGNFFSGQIPPEYGRWQRLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ L + Y N  TG +P E+  ++ L  L +     SG IP
Sbjct  210  LTSLRELYIGYYNTYTGGIPPEIGNLSELVRLDVAYCALSGEIP  253


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G L  LV L +A   LSG +P  +  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPEIGNLSELVRLDVAYCALSGEIPAALGKLQKLDTLFLQVNALSGSLTPELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L+G++P    ++ ++  L+L  N   G IP
Sbjct  285  SLKSMDLSNNMLSGEIPASFGELKNITLLNLFRNKLHGAIP  325


 Score = 52.8 bits (125),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/97 (33%), Positives = 50/97 (52%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+VG +   L  ++++ NQLSG + P I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  445  PEVGSVAVNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIPTQIGRLQQLSK  504

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D   N  +G +  E+ +   L  L L  N  SG IP
Sbjct  505  IDFSGNKFSGPIAPEISQCKLLTFLDLSRNELSGDIP  541


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  392  LFGPIPESLGTCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGEFPEVGSVA  451

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G L   +   +S++ L L GN F+GRIP
Sbjct  452  VNLGQITLSNNQLSGALSPSIGNFSSVQKLLLDGNMFTGRIP  493



>ref|XP_010484412.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1005

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPP  185


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIP  353


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  278


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  552  RILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  545


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIP  401


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N   G +P EV K+  L  +    N FSGRI P
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAP  522


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + I  N L+G +P  +  +  L  + L +N      P      
Sbjct  396  LFGSIPDSLGKCESLTRIRIGQNFLNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVS  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  +   T ++ L L GN F G+IP
Sbjct  456  VNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIP  497



>ref|XP_010444585.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDQNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISILSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPP  185


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIP  353


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 55/100 (55%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  278


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  552  RILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  545


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIP  401


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 31/92 (34%), Positives = 41/92 (45%), Gaps = 0/92 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP L  + +  N LSG +P        L  ++LSNN      P  +     +Q L L  N
Sbjct  431  LPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGN  490

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
               G +P EV K+  L  +    N FSGRI P
Sbjct  491  KFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAP  522



>ref|XP_010463501.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Camelina sativa]
Length=1006

 Score =   176 bits (447),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 122/163 (75%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGTDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDELSSGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IPP
Sbjct  143  VNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGKIPP  185


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIP  353


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPLYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  278


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGQIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  552  RILNYLNLSRNHLLGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  450  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGQIPSEVGKL  503

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  504  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  545


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 45/103 (44%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  +    N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVEFQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N   G +P EV K+  L  +    N FSGRI P
Sbjct  480  TGVQKLLLDGNKFEGQIPSEVGKLQQLSKIDFSHNLFSGRIAP  522


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPEKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFVFGSIP  401



>ref|XP_010426489.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   176 bits (445),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 117/160 (73%), Gaps = 4/160 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNIS-TSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L TSWN+S T+ C+W  V CD     V+      LNLSG
Sbjct  23   ITELNALLSLKSSLTGDDHSPLLTSWNLSSTTFCSWTGVKCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISKLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIP  182


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  +GP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFAGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIP  351


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIP  567


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  550  RILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L  L   D  N  LTG +P E+ K+ +L  L L  N F+G
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFAG  276



>ref|XP_010515326.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=1000

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 95/160 (59%), Positives = 118/160 (74%), Gaps = 4/160 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  23   ITEFNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  82

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPEIS +S LR LNLSNN+F  ++P +L+  L N
Sbjct  83   TLSSDVSHLPLLQNLSLAANQISGPIPPEISNLSELRLLNLSNNVFNGSYPDELSSGLVN  142

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLDLYNNNLTGDLP+ +  +T LRHLHLGGNYFSG+IP
Sbjct  143  LRVLDLYNNNLTGDLPLSITNLTELRHLHLGGNYFSGKIP  182


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  250  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIP  351


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PP+I  +  L  L+ S+N+F      ++++ 
Sbjct  466  LSGSLPAAIGNFSGVQKLLLDGNKFTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  526  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIP  567


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + PD+G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  490  FTGPIPPDIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  550  RILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  177  FSGKIPATYGTWPVLEYLAVSGNELTGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L  L   D  N  LTG +P E+ K+ +L  L L  N FSG
Sbjct  237  LTELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSG  276



>ref|XP_011021820.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Populus euphratica]
Length=1020

 Score =   175 bits (444),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 115/157 (73%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            V+E  ALLSIK++ T D QS L++WN +   C+W  +TCD     V+      LNLSG L
Sbjct  28   VSEYEALLSIKSSITDDPQSFLSAWNSTAPLCSWTGITCDHTGRRVTSLDLSGLNLSGTL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NLS+A NQ SGP+P  +SA+++LR LNLSNNIF STFP QL+ L NLQV
Sbjct  88   SSDIAHLRYLQNLSLAVNQFSGPIPASLSAVTSLRSLNLSNNIFNSTFPPQLSSLKNLQV  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG LP+ V +M +LRHLHLGGNY+SG+IP
Sbjct  148  LDLYNNNMTGGLPLTVVEMPNLRHLHLGGNYYSGKIP  184


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   A+L
Sbjct  252  LSGQIPPEIGRLQKLDTLFLQVNGLSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L+ L L  N F+  IP
Sbjct  312  KNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIP  353


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  
Sbjct  491  KFSGSIPPEIGRLQQLTKMDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGEIPTEITG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLVGSIPSPIATMQSLTSVDFSYNNLSGLVP  593


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G +P   + +  L  LNL  N      P  +A+L
Sbjct  276  LSGSLTLELGSLKSLKSMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN T  +P  + +   L+ L L  N  +G +PP
Sbjct  336  PELQVLQLWENNFTSTIPQALGQNGKLQILDLSSNKLTGTLPP  378


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +GQ   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  396  LFGPIPESLGQCQSLSRIRMGENFLNGSIPKGLFDLPNLSQVELQDNLLAGEFPVIGTLA  455

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  L L NN LTG LP  V   + ++ L L GN FSG IPP
Sbjct  456  VNLGQLSLSNNRLTGSLPPSVGNFSGVQKLLLDGNKFSGSIPP  498


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I+ +  L+ L L  N F ST P  L Q 
Sbjct  300  FTGEIPTSFAELKNLTLLNLFRNKLYGAIPEFIAELPELQVLQLWENNFTSTIPQALGQN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP  +    +L+ L    N+  G IP
Sbjct  360  GKLQILDLSSNKLTGTLPPNMCLGNNLQTLITLSNFLFGPIP  401



>ref|NP_201371.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 ref|NP_001190624.1| leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Arabidopsis thaliana]
 sp|O49545.1|BAME1_ARATH RecName: Full=Leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1; AltName: Full=Protein BARELY ANY MERISTEM 
1; Flags: Precursor [Arabidopsis thaliana]
 emb|CAA16688.1| receptor protein kinase - like protein [Arabidopsis thaliana]
 dbj|BAB10677.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAM20665.1| receptor protein kinase-like protein [Arabidopsis thaliana]
 gb|AAP68249.1| At5g65700 [Arabidopsis thaliana]
 dbj|BAE98627.1| receptor protein kinase like protein [Arabidopsis thaliana]
 gb|ACN59407.1| leucine-rich repeat receptor-like protein kinase [Arabidopsis 
thaliana]
 gb|AED98091.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
 gb|AED98092.1| CLAVATA1-related receptor kinase-like protein [Arabidopsis thaliana]
Length=1003

 Score =   175 bits (443),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 121/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLS  285
            ++E  ALLS+K + T    D  S L+SW +STS CTW  VTCD     V SLDLSGLNLS
Sbjct  23   ISEFRALLSLKTSLTGAGDDKNSPLSSWKVSTSFCTWIGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A N +SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLAENLISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPP  184


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIP  352


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  527  KLLTFVDLSRNELSGEIPNEITAMKILNYLNLSRNHLVGSIP  568


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  238  LSELVRFDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  277


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FQGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITAM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  551  KILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFQGPIPSEVGKL  502

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  544


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIP  400


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N   G +P EV K+  L  +    N FSGRI P
Sbjct  479  TGVQKLLLDGNKFQGPIPSEVGKLQQLSKIDFSHNLFSGRIAP  521



>gb|EPS74129.1| hypothetical protein M569_00625, partial [Genlisea aurea]
Length=970

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 102/170 (60%), Positives = 127/170 (75%), Gaps = 1/170 (1%)
 Frame = +1

Query  82   HSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvs-  258
            H     A +P  ++E  AL+SIKAA + +++ +L SWN   SHC+WR VTCDSL   V+ 
Sbjct  15   HLQRCAAVRPPRMSEYHALVSIKAAISEEARPALASWNSGASHCSWRGVTCDSLGRHVTG  74

Query  259  ldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTF  438
            LD+S L+LSG LSPDVGQL FLVNLS AAN LSGPVP EI+ I  LR+LNLSNN+F  +F
Sbjct  75   LDISNLSLSGSLSPDVGQLLFLVNLSAAANLLSGPVPAEIADIPNLRYLNLSNNVFNLSF  134

Query  439  PHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P +L +L NLQVLDLYNNN+TGD P   Y + +LRHLHLGGN+F+G +PP
Sbjct  135  PTELYRLKNLQVLDLYNNNMTGDFPSRAYLLANLRHLHLGGNFFTGTMPP  184


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G  P L  L+++ N+LSG +PPE+  ++ L+ L +   N F    P ++  
Sbjct  178  FTGTMPPEFGSFPHLEYLAVSGNELSGTIPPELGNLTQLKELYVGYYNTFSGGLPKEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL  LD  +  L+GD+P E+  + +L  L L  N FSG + P
Sbjct  238  LSNLLRLDAASCGLSGDIPSEIGMLQNLDTLFLQVNGFSGGLTP  281


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N  SG + PE+  +  L+ ++LSNN      P   A+L
Sbjct  251  LSGDIPSEIGMLQNLDTLFLQVNGFSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L+ L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIP  352


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+P++G L  L ++ ++ N LSG +P   + +  L  LNL  N    + P+ + +L
Sbjct  275  FSGGLTPELGNLKNLKSMDLSNNALSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGEL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  +    +L+ + L  N  +G + P
Sbjct  335  PQLQVLQLWENNFTGSIPENLGSNGNLQEVDLSSNKLTGSLSP  377


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = +1

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            VLS ++GQ+      S++ N LSGP+PP I     ++   L  N F  + P ++ +L  L
Sbjct  452  VLSQNLGQI------SLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIPAEIGKLQQL  505

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +D  +N  +G +P E+ +   L  + L  N  +GR+P
Sbjct  506  SKMDFSSNKFSGQIPPELSQCKQLAFVDLSRNQLNGRVP  544


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++ Q   L  + ++ NQL+G VP EISA+  L +LNLS N      P  ++ +
Sbjct  515  FSGQIPPELSQCKQLAFVDLSRNQLNGRVPSEISAMKILNYLNLSRNQLDGNIPSSISSM  574

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NN TG +P
Sbjct  575  QSLTSVDFSYNNFTGLVP  592


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  L +  N +SGP P        L  ++LSNN      P  +   
Sbjct  419  LNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLSQNLGQISLSNNHLSGPLPPSIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q   L  N+ +G +P E+ K+  L  +    N FSG+IPP
Sbjct  479  VAVQKFLLDGNSFSGSIPAEIGKLQQLSKMDFSSNKFSGQIPP  521


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     +L  L  L++  N+L+G +P  I  +  L+ L L  N F  + P  L   
Sbjct  299  LSGEIPSSFAELKNLTLLNLFRNKLNGSIPNFIGELPQLQVLQLWENNFTGSIPENLGSN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ +DL +N LTG L  ++     L  L   GN+ +G IP
Sbjct  359  GNLQEVDLSSNKLTGSLSPKLCHGNQLHTLITLGNFLTGPIP  400


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +G    L  + +  N L+G +P  + ++  L  L L +N+    FP      
Sbjct  395  LTGPIPDSMGHCESLSRVRMGENYLNGHIPKGLLSLPMLTQLELQDNLISGPFPETDVLS  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN+L+G LP  +    +++   L GN FSG IP
Sbjct  455  QNLGQISLSNNHLSGPLPPSIGNFVAVQKFLLDGNSFSGSIP  496



>ref|XP_002864974.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH41233.1| hypothetical protein ARALYDRAFT_496807 [Arabidopsis lyrata subsp. 
lyrata]
Length=1003

 Score =   174 bits (442),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 100/162 (62%), Positives = 122/162 (75%), Gaps = 5/162 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLS  285
            ++E  ALLS+K++ T    D  S L+SW +STS CTW  VTCD     V SLDLSGLNLS
Sbjct  23   ISEFRALLSLKSSLTGAGDDINSPLSSWKVSTSFCTWTGVTCDVSRRHVTSLDLSGLNLS  82

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LA  462
            G LSPDV  L  L NLS+A NQ+SGP+PPEIS++S LR LNLSNN+F  +FP +++  L 
Sbjct  83   GTLSPDVSHLRLLQNLSLADNQISGPIPPEISSLSGLRHLNLSNNVFNGSFPDEISSGLV  142

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+ +IPP
Sbjct  143  NLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAEKIPP  184


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SG +  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIP  352


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F  +   +L  L++L+
Sbjct  231  LPPEIGNLSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSLTWELGTLSSLK  290

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  291  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIP  328


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 1/98 (1%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLANL  468
            + P  G  P +  L+++ N+L G +PPEI  + TLR L +   N F    P ++  L+ L
Sbjct  182  IPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLKTLRELYIGYYNAFEDGLPPEIGNLSEL  241

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
               D  N  LTG++P E+ K+  L  L L  N FSG +
Sbjct  242  VRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGSL  279


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP
Sbjct  527  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNNLVGSIP  568


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  NNL G +P  +  M SL  L    N  SG +P
Sbjct  551  KILNYLNLSRNNLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQ+      S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L
Sbjct  449  VAGGVSVNLGQI------SLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  502

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  503  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  544


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  T P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGTIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  359  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIP  400


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  419  LNGSIPKGLFGLPKLTQVELQDNYLSGELPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N   G +P EV K+  L  +    N FSGRI P
Sbjct  479  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAP  521



>ref|XP_006279943.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
 gb|EOA12841.1| hypothetical protein CARUB_v10025808mg [Capsella rubella]
Length=1004

 Score =   174 bits (441),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 101/163 (62%), Positives = 121/163 (74%), Gaps = 6/163 (4%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNL  282
            ++E  ALLS+K++ T     D  S L+SW +STS CTW  VTCD     V SLDLSGLNL
Sbjct  23   ISEFRALLSLKSSLTGAGSDDKNSPLSSWKVSTSFCTWVGVTCDVSRRHVTSLDLSGLNL  82

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-L  459
            SG LSPDV  L  L NLS+A NQ+SGP+P EIS +S LR LNLSNN+F  +FP +L+  L
Sbjct  83   SGTLSPDVSHLRLLQNLSLAENQISGPIPTEISNLSGLRHLNLSNNVFNGSFPDELSYGL  142

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VLD+YNNNLTGDLPV V  +T LRHLHLGGNYF+G+IPP
Sbjct  143  VNLRVLDVYNNNLTGDLPVSVTNLTQLRHLHLGGNYFAGKIPP  185


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIP  353


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 56/100 (56%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L G +PPEI  ++TLR L +   N F +  P ++  
Sbjct  179  FAGKIPPSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFENGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L  LD  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  239  LSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  278


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSRNELSGEIPNEITGMKILNYLNLSRNHLVGSIP  569


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/98 (37%), Positives = 53/98 (54%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV L  A   L+G +PPEI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRLDGANCGLTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  292  SMDLSNNMFTGEIPASFAELKNLTLLNLFRNKLHGEIP  329


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  552  KILNYLNLSRNHLVGSIPGSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 50/100 (50%), Gaps = 7/100 (7%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GQLP        L  +S++ NQLSGP+PP I   + ++ L L  N F    P ++ +L  
Sbjct  446  GQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQ  505

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  506  LSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  545


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  300  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGVLPELEVLQLWENNFTGSIPQKLGEN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  360  GKLNLVDLSSNKLTGTLPPNMCSGNKLETLITLGNFLFGSIP  401


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P        L  ++LSNN      P  +   
Sbjct  420  LNGSIPKGLFGLPKLTQVELQDNYLSGQLPVAGGVSVNLGQISLSNNQLSGPLPPAIGNF  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +Q L L  N   G +P EV K+  L  +    N FSGRI P
Sbjct  480  TGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAP  522



>ref|XP_010547579.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1015

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/168 (60%), Positives = 126/168 (75%), Gaps = 8/168 (5%)
 Frame = +1

Query  103  GKPLGVTEQAALLSIKAAFTADSQ----SSLTSWNISTSHCTWRRVTCdsllh-vvsldl  267
            G+P  ++E  ALLSIK++ +        S L +WN ST+ C W  VTCD+    V+SLDL
Sbjct  22   GRP--ISEFRALLSIKSSLSGAGDGPNSSPLATWNDSTTFCAWTGVTCDASGRHVISLDL  79

Query  268  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            SGLNLSG LSPD+  L  L NLS+A+NQ+SGP+PPE+S++S LR+LNLSNN+F  +FP +
Sbjct  80   SGLNLSGTLSPDIAHLFLLQNLSVASNQISGPIPPEVSSLSGLRYLNLSNNVFNGSFPDE  139

Query  448  L-AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L A   NL+VLDLYNNNLTGDLPV V  +T LRHLHLGGNYF+GRIPP
Sbjct  140  LSAGAVNLRVLDLYNNNLTGDLPVSVTNLTHLRHLHLGGNYFAGRIPP  187


 Score = 75.5 bits (184),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P+VG+L  L  L +  N LSGP+  E+  +S+L+ ++LSNN+F    P   AQL
Sbjct  254  LTGKIPPEVGKLQKLDTLFLQVNALSGPLTTELGTLSSLKSMDLSNNMFTGEIPASFAQL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  314  KNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIP  355


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              +G + P VG+L  L  + I+ NQLSG + PEIS    L F++LS N      P+++  
Sbjct  493  KFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIPNEITG  552

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  V  M SL  +    N  SG +P
Sbjct  553  MRILNYLNLSRNHLVGPIPASVASMQSLTSVDFSYNNLSGLVP  595


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ +GP+PP++  +  L  +++S+N        +++Q 
Sbjct  470  LSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKLQQLSKMDISHNQLSGRIAPEISQC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  530  KLLTFVDLSRNELSGEIPNEITGMRILNYLNLSRNHLVGPIP  571


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  181  FAGRIPPAYGSWPVLEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  240

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG +P EV K+  L  L L  N  SG
Sbjct  241  LSELVRFDAANCGLTGKIPPEVGKLQKLDTLFLQVNALSG  280


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG ++ ++GQ+      S++ NQLSGP+PP I     ++ L L  N F    P Q+ +L
Sbjct  452  VSGRVAVNLGQI------SLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPPQVGKL  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D+ +N L+G +  E+ +   L  + L  N  SG IP
Sbjct  506  QQLSKMDISHNQLSGRIAPEISQCKLLTFVDLSRNELSGEIP  547


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 56/104 (54%), Gaps = 2/104 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR-FLNLSNNIFGSTFPHQLA  453
            N +G +   +GQ   L  L +++N+L+G +PP + + + L+  + LSN +FGS  P  L 
Sbjct  349  NFTGSIPQKLGQNGKLQFLDLSSNKLTGTLPPNLCSGNKLQTLITLSNFLFGS-IPDSLG  407

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  +L  + +  N L G +P  ++ +  L  + L  NY SG  P
Sbjct  408  ECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFP  451


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N     FP      
Sbjct  398  LFGSIPDSLGECESLTRIRMGENFLNGSIPKGLFGLPKLSQVELQDNYLSGEFPVSGRVA  457

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +     ++ L L GN F+G IPP
Sbjct  458  VNLGQISLSNNQLSGPLPPAIGNFYGVQKLLLDGNKFTGPIPP  500



>ref|XP_006393995.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
 gb|ESQ31281.1| hypothetical protein EUTSA_v10003584mg [Eutrema salsugineum]
Length=1007

 Score =   174 bits (440),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 101/167 (60%), Positives = 124/167 (74%), Gaps = 7/167 (4%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA---DSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldl  267
            AG+P  ++E  AL+S+K++ T    D  S L SW  STS CTW  VTCD     V SLDL
Sbjct  19   AGRP--ISELHALISLKSSLTGAGEDPNSPLASWKSSTSFCTWTGVTCDISRRHVTSLDL  76

Query  268  sglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            SGLNLSG LSPDV +LP L NLS+A NQ+SGP+PPEIS +  LR LNLSNN+F  +FP +
Sbjct  77   SGLNLSGTLSPDVSRLPLLQNLSVADNQISGPIPPEISNLYGLRHLNLSNNVFNGSFPDE  136

Query  448  LAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++  L NL+VLD+YNNNLTGDLP+ V  +T LRHLHLGGNYF+G+IP
Sbjct  137  ISSGLVNLRVLDVYNNNLTGDLPLSVTNLTQLRHLHLGGNYFAGQIP  183


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   A+L
Sbjct  251  LTGEIPPEIGKLQKLDTLFLQVNVFSGPLTWELGTLSSLKSMDLSNNMFTGEIPASFAEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIP  352


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  467  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  527  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGTIP  568


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  178  FAGQIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  238  LSELVRFDAANCGLTGEIPPEIGKLQKLDTLFLQVNVFSG  277


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  491  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  551  RILNYLNLSRNHLVGTIPGSISSMQSLTSLDFSYNNLSGLVP  592


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +     +L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  299  FTGEIPASFAELKNLTLLNLFRNKLHGEIPEFIGELPELEVLQLWENNFTGSIPQKLGEN  358

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +    +L  L   GN+  G IP
Sbjct  359  GKLNLVDLSSNKLTGALPPNMCSGNNLETLITLGNFLFGSIP  400



>ref|XP_004143422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 ref|XP_004163335.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48657.1| hypothetical protein Csa_6G497080 [Cucumis sativus]
Length=1019

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 102/157 (65%), Positives = 124/157 (79%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            V+E  ALLS+K + T D +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LS
Sbjct  26   VSEYRALLSLKTSITGDPKSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLS  85

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            PDV  L FL NLS+AAN+ SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VL
Sbjct  86   PDVAFLRFLTNLSLAANEFSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVL  145

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TGD P+ V +M+ LRHLHLGGN+F+GRIPP
Sbjct  146  DLYNNNMTGDFPIVVTQMSGLRHLHLGGNFFAGRIPP  182


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  249  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP
Sbjct  309  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIP  350


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  
Sbjct  488  KFSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITS  547

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  MRILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVP  590


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  273  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP
Sbjct  333  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPP  375


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 59/104 (57%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+VG++  L  L+++ N+LSG +PPE+  ++ LR L +   N +    P ++  
Sbjct  176  FAGRIPPEVGRMQSLEYLAVSGNELSGSIPPELGNLTNLRELYIGYFNAYDGGLPAEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD  N  L+G +P E+ K+ +L  L L  N  SG + P
Sbjct  236  LSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTP  279


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  227  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP
Sbjct  287  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIP  326


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  393  LFGPIPESLGKCVSLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPP
Sbjct  453  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPP  495



>gb|KDP32143.1| hypothetical protein JCGZ_12604 [Jatropha curcas]
Length=1013

 Score =   173 bits (439),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 123/158 (78%), Gaps = 2/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVL  294
            ++E  ALLS+KAA   D QS+L SWN S S C+W  VTCD S  HV SLDLS LNLSG+L
Sbjct  23   MSEYQALLSVKAAID-DPQSALVSWNSSNSLCSWSGVTCDPSGRHVTSLDLSSLNLSGIL  81

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  L +L NL++AANQLSGP+PP++SAI  LR LNLSNN+F  TFP QL+QL NLQV
Sbjct  82   SSDIAHLRYLQNLTLAANQLSGPIPPQLSAIPGLRSLNLSNNVFNGTFPSQLSQLKNLQV  141

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNN+T  LP+ V  M +LRHLHLGGN+FSG+IPP
Sbjct  142  LDLYNNNMTDVLPLAVTDMPNLRHLHLGGNFFSGKIPP  179


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  ++N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  486  FSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQCKLLTFVDLSRNELSGAIPTEITGM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  +G +P
Sbjct  546  RILNYLNLSRNHLIGSIPSSIATMQSLTSVDFSYNNLTGLVP  587


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      +++Q 
Sbjct  462  LSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFSGPITPEISQC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP
Sbjct  522  KLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLIGSIP  563


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  270  LSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIPEFIGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K  +L  L L  N  +G +PP
Sbjct  330  PKLEVLQLWENNFTGSIPQGLGKNGNLVLLDLSSNKLTGNLPP  372


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   ++L
Sbjct  246  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKSLKSMDLSNNMLTGEIPSSFSEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  306  KNLTLLNLFRNKLYGAIPEFIGDLPKLEVLQLWENNFTGSIP  347


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+  FL  L+I+ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  173  FSGKIPPEYGKWEFLEYLAISGNELVGPIPPEIGNLTRLQQLYIGYYNSYEGGLPPEIGN  232

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +
Sbjct  233  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSL  274


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  224  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLTEELGNLKS  283

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  284  LKSMDLSNNMLTGEIPSSFSELKNLTLLNLFRNKLYGAIP  323


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP      
Sbjct  390  LFGPIPESLGKCESLSRIRMGENFLNGSIPKGLFGLPKLSQVELQDNLLTGEFPVTDTIA  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   + ++ L L GN FSG IPP
Sbjct  450  MNLGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPP  492


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   S ++ L L  N F    P Q+ +L  L  +D  +N  +
Sbjct  452  LGQISLSNNRLSGSLPPSIGNFSGVQKLLLDGNKFSGAIPPQIGRLQQLSKMDFSSNKFS  511

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L  + L  N  SG IP
Sbjct  512  GPITPEISQCKLLTFVDLSRNELSGAIP  539



>gb|KJB18115.1| hypothetical protein B456_003G034500 [Gossypium raimondii]
Length=1014

 Score =   173 bits (439),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE  AL+++K++ T D QS L++WN ST  C++  VTCD    HV S+DL+ + L+G L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNASTPLCSFAGVTCDLTGRHVTSIDLTNVTLAGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAGNDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIP  183


 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGRIPDFIGELPELEVLQLWENNFTGSIP  352


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N      P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSGNELSGRIPTEITSMRILNYLNLSRNHLLGSIP  569


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++G+L  L  +  + N+LSG +PPEI     L F++LS N      P ++  
Sbjct  491  KFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPPEICKCKLLTFVDLSGNELSGRIPTEITS  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLLGSIPSSISTMQSLTSVDFSYNNLSGLVP  593


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ NQLSG +P  +   S ++ L L  N F    P ++ +L  L  +D  +N L+
Sbjct  458  LGQISLSNNQLSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLS  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +P E+ K   L  + L GN  SGRIP
Sbjct  518  GLIPPEICKCKLLTFVDLSGNELSGRIP  545


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G+   L  L+++ N+LSG +PPEI  ++ L+ L +   N F    P ++  
Sbjct  178  FSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  238  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  281


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSISANLGQISLSNNQLSGALPASVGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + +Q L L  N  +G +P E+ K+  L  +    N  SG IPP
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKLSGLIPP  522



>gb|KJB18113.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
 gb|KJB18114.1| hypothetical protein B456_003G034400 [Gossypium raimondii]
Length=1026

 Score =   173 bits (438),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE +AL+++K++ T D QS L++WN +T  C++  V CD    HV S+DL+   LSG L
Sbjct  27   VTELSALIAVKSSITDDPQSYLSNWNANTPLCSFAGVACDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+AAN LSGP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQ+
Sbjct  87   SPSLAHLRFLQNLSVAANDLSGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQI  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIP  183


 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+VG+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEVGKLQRLHTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIP  352


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASVGNFSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G +P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIP  569


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G+   L  L+++ N+LSG +PPEI  ++ L+ L +   N F    P ++  
Sbjct  178  FSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKQLYIGYFNSFEGGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L + D  N  L+G++P EV K+  L  L L  N  SG + P
Sbjct  238  LSELVLFDAANCMLSGEIPPEVGKLQRLHTLFLQVNALSGSLTP  281


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 25/79 (32%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG++ P++ +   L  + ++ N+LSG +P EI+++  L +LNLS N    + P  ++ 
Sbjct  515  KFSGLIPPEICKCKLLTFVDLSRNELSGQIPTEITSMRILNYLNLSRNHLLGSIPSSIST  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  575  MQSLTSVDFSYNNLSGLVP  593


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQDNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASVGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + +Q L L  N  +G +P E+ K+  L  +    N FSG IPP
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGKLQQLSKIDFSHNKFSGLIPP  522



>gb|KJB48795.1| hypothetical protein B456_008G087500 [Gossypium raimondii]
Length=1013

 Score =   172 bits (437),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            V+E  ALL++K++ T D QS L++WN +T  C++  VTCD    HV SL+LS  NLSG L
Sbjct  24   VSEFQALLAVKSSITDDPQSYLSNWNATTPLCSFTGVTCDYTGRHVTSLNLSYFNLSGTL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLQFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG+LP+ V  + +LRHLHLGGN+F+G+IP
Sbjct  144  LDLYNNNMTGELPISVTDLPNLRHLHLGGNFFTGQIP  180


 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGNIP  349


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLESLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPEFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP
Sbjct  332  PELEVLQLWENNFTGNIPQTLGSNRKLQLLDLSSNKLTGILPP  374


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIP  566


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G+   L  L+++ N+L G +PPEI  +  L+ L +   N F    P ++  
Sbjct  175  FTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLKKLKELYIGYYNSFEGGLPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  235  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  278


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTM  572

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590



>ref|XP_009150662.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brassica rapa]
Length=997

 Score =   172 bits (436),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 122/160 (76%), Gaps = 3/160 (2%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGV  291
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTCD     V SLDLS LNLSG 
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTCDVSRRHVTSLDLSSLNLSGT  82

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANL  468
            LSPDV  LP L NLS+A NQ+SGP+PPEIS +S LR LNLSNNIF  +FP ++ A LANL
Sbjct  83   LSPDVSHLPLLQNLSLADNQISGPIPPEISNLSGLRHLNLSNNIFNGSFPGEISAGLANL  142

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP
Sbjct  143  RVLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPP  182


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  249  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIP  350


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  465  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  525  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIP  566


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  229  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  288

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P     + +L  L+L  N   G IP
Sbjct  289  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIP  326


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  273  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP
Sbjct  333  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPP  375


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG
Sbjct  236  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSG  275


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  489  FEGPIPSEVGRLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  549  KILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  590


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  447  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGRL  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  501  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIP  542


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  297  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  357  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIP  398


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  369  LTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGL  428

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  ++L +N LTG+LPV      +L  L L  N  SG++PP
Sbjct  429  PKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPP  471



>gb|KHG03710.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
 gb|KHG03906.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1013

 Score =   172 bits (435),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            V E  ALL++K++ T D QS L++WN +   C++  VTCD    HV SLDLS  NLSG L
Sbjct  24   VLEFQALLAVKSSITGDPQSYLSNWNATIPLCSFTGVTCDYTGRHVTSLDLSYFNLSGTL  83

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP    L FL N S+AANQL GP+P E++A+S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  84   SPSFSHLRFLQNFSLAANQLYGPIPTELAALSALRYLNLSNNVFNGSFPTQLSQLKNLQV  143

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TGDLP+ V  + +LRHLHLGGN+F+G+IP
Sbjct  144  LDLYNNNMTGDLPISVTDLPNLRHLHLGGNFFTGQIP  180


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  248  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLHGQIPGFIGELPELEVLQLWENNFTGSIP  349


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  272  LSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFADLKNLTLLNLFRNKLHGQIPGFIGEL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  +     L+ L L  N  +G +PP
Sbjct  332  PELEVLQLWENNFTGSIPQTLGSNRKLQLLDLSSNKLTGTLPP  374


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   VG    +  L +  N+ SGP+P EI  +  L  ++ S+N F       +++ 
Sbjct  465  LSGPLPATVGNFSGVQKLLLDGNKFSGPIPAEIGNLQQLSKMDFSHNKFSGPVAPGISKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  525  KLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIP  566


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P + +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  ++ +
Sbjct  513  FSGPVAPGISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSISTM  572

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  573  QSLTSVDFSYNNLSGLVP  590


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G+   L  L+++ N+L G +PPEI  +  L+ L +   N F    P ++  
Sbjct  175  FTGQIPASYGRWEHLEYLAVSGNELGGRIPPEIGNLEKLQELYIGYYNSFEGGLPPEIGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  235  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  278



>gb|KHG04200.1| Leucine-rich repeat receptor-like serine/threonine-protein kinase 
BAM1 [Gossypium arboreum]
Length=1014

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            VTE  AL+++K++ T D QS L++WN +T  C++  VTCD    HV S+DL+   LSG L
Sbjct  27   VTELRALIAVKSSITDDPQSYLSNWNATTPLCSFAGVTCDLTGRHVTSIDLTNFTLSGTL  86

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +  L FL NLS+A N L+GP+P E++ +S LR+LNLSNN+F  +FP QL+QL NLQV
Sbjct  87   SPSLAHLRFLQNLSVADNNLTGPIPTELAVLSNLRYLNLSNNVFNGSFPTQLSQLKNLQV  146

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LDLYNNN+TG+LPV V ++ +LRHLHLGGNYFSG+IP
Sbjct  147  LDLYNNNMTGELPVSVTELPNLRHLHLGGNYFSGQIP  183


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  +++L+ ++LSNN+F    P   AQL
Sbjct  251  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLNSLKSMDLSNNMFTGEIPASFAQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLHGQIPDFIGELPELEVLQLWENNFTGSIP  352


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ SGP+P EI  +  L  ++ S+N F    P ++ + 
Sbjct  468  LSGALPASIGNFSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPPEICKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G +P E+  M  L  L+L  N+  G IP
Sbjct  528  ELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIP  569


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G+   L  L+++ N+LSG +PPEI  ++ L+ L +   N F    P ++  
Sbjct  178  FSGQIPSSYGRWEHLEYLAVSGNELSGKIPPEIGNLTKLKELYIGYFNNFEGGLPPEIGN  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  238  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  281


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG++ P++ +   L  + ++ N+LSG +P EI+++  L FLNLS N    + P  ++ +
Sbjct  516  FSGLIPPEICKCELLTFVDLSRNELSGRIPTEITSMRILNFLNLSRNHLLGSIPSSISTM  575

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  576  QSLTSVDFSYNNLSGLVP  593


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN      P  +  
Sbjct  419  LNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSISVNLGQISLSNNQLSGALPASIGN  478

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + +Q L L  N  +G +P E+  +  L  +    N FSG IPP
Sbjct  479  FSGVQKLLLDGNKFSGPIPAEIGTLQQLSKIDFSHNKFSGLIPP  522


 Score = 49.3 bits (116),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN     FP   + +
Sbjct  395  LFGSIPESLGKCESLSRIRMGENYLNGSIPKGLLGLPQLTQVELQNNYLTGEFPVTDSSI  454

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + NL  + L NN L+G LP  +   + ++ L L GN FSG IP
Sbjct  455  SVNLGQISLSNNQLSGALPASIGNFSGVQKLLLDGNKFSGPIP  497



>ref|XP_007047661.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX91818.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=1018

 Score =   171 bits (434),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 91/165 (55%), Positives = 125/165 (76%), Gaps = 3/165 (2%)
 Frame = +1

Query  94   AGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldls  270
            + A +P  V+E  ALL++K++FT D +S L++WN +T  C++  V CD     V S+DLS
Sbjct  17   SSAARP--VSEFRALLAVKSSFTDDPESYLSNWNATTRFCSFTGVACDYTGRHVTSIDLS  74

Query  271  glNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
              NLSG LSP    L FL +LS+AANQ+SGP+P E++A+S+LR+ NLSNN+F  +FP QL
Sbjct  75   NFNLSGTLSPSFSHLRFLQSLSLAANQISGPIPTELAALSSLRYFNLSNNVFNGSFPSQL  134

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +QL NLQVLDLYNNN+TG+LP+ V ++ +L HLHLGGN+FSG+IP
Sbjct  135  SQLKNLQVLDLYNNNMTGELPISVTELPNLLHLHLGGNFFSGQIP  179


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A L
Sbjct  247  LSGEIPPEIGKLQKLDTLFLQVNALSGSLTPELGTLKSLKSMDLSNNMLAGEIPESFANL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  307  KNLTLLNLFRNKLHGQIPEFIGELPELEVLQLWENNFTGSIP  348


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G+  FL  L+++ N+L G +PPEI  ++ L+ L +   N F    P ++  
Sbjct  174  FSGQIPSSYGRWEFLEYLAVSGNELDGKIPPEIGNLTKLQQLYIGYYNSFEGGLPPEIGN  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  L+G++P E+ K+  L  L L  N  SG + P
Sbjct  234  LSELVRFDAANCMLSGEIPPEIGKLQKLDTLFLQVNALSGSLTP  277


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG ++P++ +   L  + ++ N+LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  511  KFSGTIAPEISKCKLLTFVDLSRNELSGEIPTEITGMRILNYLNLSRNHLIGSIPSSIAT  570

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  571  MQSLTSVDFSYNNLSGLVP  589


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  + +  N L+G  P   S+IS  L  ++LSNN    T P  +  
Sbjct  415  LNGSIPKGLFGLPKLTQVELQDNYLTGEFPVTESSISANLGQISLSNNKLSGTLPASVGN  474

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + +Q L L  N  +G +P E+ K+  L  +    N FSG I P
Sbjct  475  FSGVQKLLLDGNKFSGRIPAEIGKLQQLSKMDFSHNKFSGTIAP  518



>ref|NP_001235065.1| receptor-like protein kinase 1 precursor [Glycine max]
 gb|AAF91322.1|AF244888_1 receptor-like protein kinase 1 [Glycine max]
Length=1008

 Score =   171 bits (432),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 121/158 (77%), Gaps = 1/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  +TCDS  HV SL+L+ L+LSG L
Sbjct  19   ISEYRALLSFKASSLTDDPTHALSSWNSSTPFCSWFGLTCDSRRHVTSLNLTSLSLSGTL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            S D+  LPFL +LS+A N+ SGP+P   SA+S LRFLNLSNN+F +TFP QL +LANL+V
Sbjct  79   SDDLSHLPFLSHLSLADNKFSGPIPASFSALSALRFLNLSNNVFNATFPSQLNRLANLEV  138

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNN+TG+LP+ V  M  LRHLHLGGN+FSG+IPP
Sbjct  139  LDLYNNNMTGELPLSVAAMPLLRHLHLGGNFFSGQIPP  176


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG + PE+ ++ +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIP  344


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +G L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  483  FTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKCKLLTFIDLSGNELSGEIPNKITSM  542

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  543  RILNYLNLSRNHLDGSIPGNIASMQSLTSVDFSYNNFSGLVP  584


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  267  LSGSLTPELGSLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGEL  326

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  +     L  + L  N  +G +PP
Sbjct  327  PALEVLQLWENNFTGSIPQNLGNNGRLTLVDLSSNKITGTLPP  369


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +G +PP+I  +  L  ++ S+N F      ++++ 
Sbjct  459  LSGSLPSTIGNFTSMQKLLLNGNEFTGRIPPQIGMLQQLSKIDFSHNKFSGPIAPEISKC  518

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P ++  M  L +L+L  N+  G IP
Sbjct  519  KLLTFIDLSGNELSGEIPNKITSMRILNYLNLSRNHLDGSIP  560


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEDGSIA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  + L NN L+G LP  +   TS++ L L GN F+GRIPP
Sbjct  447  TDLGQISLSNNQLSGSLPSTIGNFTSMQKLLLNGNEFTGRIPP  489


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTPELGSLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIP  320


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G    L  L+++ N+L+G + PE+  +S+LR L +   N +    P ++  
Sbjct  170  FSGQIPPEYGTWQHLQYLALSGNELAGTIAPELGNLSSLRELYIGYYNTYSGGIPPEIGN  229

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL  LD     L+G++P E+ K+ +L  L L  N  SG + P
Sbjct  230  LSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNALSGSLTP  273



>ref|XP_004509039.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cicer arietinum]
Length=1005

 Score =   170 bits (431),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 90/159 (57%), Positives = 117/159 (74%), Gaps = 2/159 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCds-llhvvsldlsglNLSGV  291
            ++E   LLS K++  T D   SL SWN ST+HC+W  +TC     HV S+DLS L L+  
Sbjct  22   ISEHKTLLSFKSSSITDDPTHSLISWNSSTTHCSWHGITCTGPHRHVTSIDLSSLTLTAT  81

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS  +  LPFL NLS+A N+ SGP+PP  S++ +LRFLNLSNN+F  TFP QL++L+NL 
Sbjct  82   LSDHLSNLPFLSNLSLADNKFSGPIPPSFSSLYSLRFLNLSNNVFNGTFPSQLSRLSNLH  141

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNN+TG LP+ V +M +LRHLHLGGN+F+G+IPP
Sbjct  142  VLDLYNNNMTGTLPLSVTRMQNLRHLHLGGNFFTGKIPP  180


 Score = 70.9 bits (172),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG + PE+  + +L+ ++LSNN F    P   A+L
Sbjct  247  LTGEIPPELGKLQNLDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + +M +L  L +  N F+G IP
Sbjct  307  KNLTLLNLFRNKLHGAIPEFIGEMPALEVLQIWENNFTGSIP  348


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N   G VP   + +  L  LNL  N      P  + ++
Sbjct  271  LSGSLTPELGNLKSLKSMDLSNNAFDGEVPASFAELKNLTLLNLFRNKLHGAIPEFIGEM  330

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL ++ NN TG +P  + K   L  + +  N  +G +PP
Sbjct  331  PALEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPP  373


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  487  FTGKIPSEIGKLQQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPNEITGM  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  +G +P
Sbjct  547  RILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVP  588


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  391  LFGPIPDSLGKCESLSRIRMGENFLNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMS  450

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  +   TS++ L L GN F+G+IP
Sbjct  451  PNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIP  492


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG     V   P L  ++++ N+LSGP+P  I   ++++ L L  N F    P ++ +L
Sbjct  439  LSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNFTSVQKLLLDGNQFTGKIPSEIGKL  498

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+     L  + L  N  SG IP
Sbjct  499  QQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIP  540


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 47/103 (46%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  415  LNGSIPKGLFGLPQLTQVELQDNLLSGEFPQPVSMSPNLGQVTLSNNKLSGPLPSSIGNF  474

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             ++Q L L  N  TG +P E+ K+  L  +    N FSG I P
Sbjct  475  TSVQKLLLDGNQFTGKIPSEIGKLQQLSKIDFSHNKFSGPIAP  517



>ref|XP_010683073.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=1009

 Score =   170 bits (431),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 108/160 (68%), Gaps = 6/160 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsgl------NLS  285
            EQ ALL IK+A T D QSSL+SWN ST HCTW  + C S   +              NL+
Sbjct  24   EQKALLGIKSAITDDPQSSLSSWNTSTHHCTWDFIKCSSSSSLNHHQSVVSLNISGLNLT  83

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LSPD+G L  L NLS+A N  SGP+P  +S +S L  LNLSNNIF STFP  L+ L N
Sbjct  84   GILSPDIGFLTNLQNLSVAGNSFSGPIPSSLSLLSNLYHLNLSNNIFNSTFPSSLSPLQN  143

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LQ+LD+YNNNLTG LP+ V  M+ LRHLHLGGNYFSG IP
Sbjct  144  LQILDVYNNNLTGPLPLSVVNMSELRHLHLGGNYFSGEIP  183


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N+ SG +P EIS    L F++LS N F    P ++  +
Sbjct  492  FSGSIPPEIGRLQQLSKIDFSSNKFSGEIPSEISKCKLLTFVDLSRNQFSGEIPKEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L+G +P  +  M SL  +    N FSG IP
Sbjct  552  RILNYLNISRNHLSGSIPGSISSMQSLTSVDFSYNNFSGLIP  593


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/127 (30%), Positives = 59/127 (46%), Gaps = 24/127 (19%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ----  447
            LSG +  ++G+L  L  L +  N LSG +P E   +S+L+ ++LSNN+F    P      
Sbjct  251  LSGEIPAELGKLKKLDTLFLQVNTLSGYLPSEFGYLSSLKSMDLSNNLFSGEIPESFSLL  310

Query  448  --------------------LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  567
                                +  L  L+VL L+ NN TG +P ++     L+ L L  N 
Sbjct  311  KNLTLLNLFRNKLHGGIPEFIGDLPQLEVLQLWENNFTGSIPEKLGFNGRLQLLDLSSNK  370

Query  568  FSGRIPP  588
             +G +PP
Sbjct  371  LTGTLPP  377


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N+    FP  +  +
Sbjct  395  LLGPIPESLGSCKSLSRVRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGGFPVTVDSI  454

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            A NL  + L NN LTG+LP  +   + ++ L L GN FSG IPP
Sbjct  455  AVNLGQISLSNNQLTGELPSSIGNFSGVQKLLLDGNKFSGSIPP  498



>ref|XP_010503631.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Camelina sativa]
Length=999

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 92/160 (58%), Positives = 115/160 (72%), Gaps = 4/160 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSL-TSWNISTS-HCTWRRVTCdsllhvvsldlsg-lNLSG  288
            +TE  ALLS+K++ T D  S L +SWN+ST+  C+W  VTCD     V+      LNLSG
Sbjct  22   ITELNALLSLKSSLTGDDHSPLLSSWNLSTTTFCSWTGVTCDVSRRHVTSLDLSGLNLSG  81

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LAN  465
             LS DV  LP L NLS+AANQ+SGP+PPE S +  LR LNLSNN+F  ++P +L+  L N
Sbjct  82   TLSSDVSHLPLLQNLSLAANQISGPIPPEFSNLYELRLLNLSNNVFNGSYPDELSSGLVN  141

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLDLYNNNLTG LP+ +  +T LRHLHLGGNYFSG+IP
Sbjct  142  LRVLDLYNNNLTGHLPLSITNLTQLRHLHLGGNYFSGKIP  181


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  IS+L+ ++LSNN+F    P   ++L
Sbjct  249  LTGAIPPEIGKLQNLDTLFLQVNAFSGPLTSELGLISSLKSMDLSNNMFTGEIPTSFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  309  KNLTLLNLFRNKLYGAIPEFIGELPELEVLQLWENNFTGGIP  350


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    +  L +  N+ +GP+PPEI  +  L  L+ S+N+F      ++++ 
Sbjct  465  LSGSLPAAIGNFSGVQKLLLDGNKFAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  525  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGSIP  566


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L  L  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  489  FAGPIPPEIGRLQQLSKLDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGDIPNEITGM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  549  RILNYLNLSRNHLVGSIPVSIASMQSLTSVDFSYNNLSGLVP  590


 Score = 59.7 bits (143),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G  P L  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  176  FSGKIPATYGTWPVLEYLAVSGNELIGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG +P E+ K+ +L  L L  N FSG
Sbjct  236  LSELLRFDAANCGLTGAIPPEIGKLQNLDTLFLQVNAFSG  275



>ref|NP_001237688.1| receptor-like protein kinase precursor [Glycine max]
 gb|ACM89563.1| receptor-like protein kinase [Glycine max]
Length=1010

 Score =   169 bits (427),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 94/158 (59%), Positives = 116/158 (73%), Gaps = 1/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D   +L+SWN ST  C+W  VTCDS  HV  L+L+ L+LS  L
Sbjct  19   ISEYRALLSFKASSITNDPTHALSSWNSSTPFCSWFGVTCDSRRHVTGLNLTSLSLSATL  78

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL +LS+A NQ SGP+P   SA+S LRFLNLSNN+F  TFP QLA+L+NL+V
Sbjct  79   YDHLSHLPFLSHLSLADNQFSGPIPVSFSALSALRFLNLSNNVFNQTFPSQLARLSNLEV  138

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPP
Sbjct  139  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPP  176


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  483  FSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIPNQITSM  542

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N FSG +P
Sbjct  543  RILNYLNLSRNHLDGSIPGSIASMQSLTSVDFSYNNFSGLVP  584


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   A+L
Sbjct  243  LSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP
Sbjct  303  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIP  344


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L+ ++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +
Sbjct  266  SLSGSLTSELGNLKSLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGE  325

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VL L+ NN TG +P  + K   L  + L  N  +G +PP
Sbjct  326  LPALEVLQLWENNFTGSIPQSLGKNGRLTLVDLSSNKITGTLPP  369


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             LSG L   +G    +  L +  N+ SG +PP+I  +  L  ++ S+N F      ++++
Sbjct  458  KLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQLSKIDFSHNKFSGPIAPEISR  517

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  +DL  N L+G++P ++  M  L +L+L  N+  G IP
Sbjct  518  CKLLTFIDLSGNELSGEIPNQITSMRILNYLNLSRNHLDGSIP  560


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP   +  
Sbjct  387  LFGPIPDSLGKCESLNRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLTGQFPEYGSIA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  + L NN L+G LP  +   TS++ L L GN FSGRIPP
Sbjct  447  TDLGQISLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPP  489


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 53/100 (53%), Gaps = 6/100 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G ++ D+GQ+      S++ N+LSGP+P  I   ++++ L L  N F    P Q+ +L  
Sbjct  443  GSIATDLGQI------SLSNNKLSGPLPSTIGNFTSMQKLLLDGNEFSGRIPPQIGRLQQ  496

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  +D  +N  +G +  E+ +   L  + L GN  SG IP
Sbjct  497  LSKIDFSHNKFSGPIAPEISRCKLLTFIDLSGNELSGEIP  536


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV L  A   LSG +P E+  +  L  L L  N    +   +L  L 
Sbjct  220  SGGIPPEIGNLSNLVRLDAAYCGLSGEIPAELGKLQNLDTLFLQVNSLSGSLTSELGNLK  279

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP
Sbjct  280  SLKSMDLSNNMLSGEVPASFAELKNLTLLNLFRNKLHGAIP  320


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V  +P L +L +  N  SG +PPE      LR+L LS N        +L  
Sbjct  145  NMTGPLPLAVASMPLLRHLHLGGNFFSGQIPPEYGTWQHLRYLALSGNELAGYIAPELGN  204

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ L+ L + Y N  +G +P E+  +++L  L       SG IP
Sbjct  205  LSALRELYIGYYNTYSGGIPPEIGNLSNLVRLDAAYCGLSGEIP  248


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     +L  L  L++  N+L G +P  +  +  L  L L  N F  + P  L + 
Sbjct  291  LSGEVPASFAELKNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIPQSLGKN  350

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N +TG LP  +     L+ L   GNY  G IP
Sbjct  351  GRLTLVDLSSNKITGTLPPYMCYGNRLQTLITLGNYLFGPIP  392



>gb|KFK28239.1| hypothetical protein AALP_AA8G490400 [Arabis alpina]
Length=1002

 Score =   168 bits (426),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 91/168 (54%), Positives = 117/168 (70%), Gaps = 8/168 (5%)
 Frame = +1

Query  100  AGKPLGVTEQAALLSIKAAFTA----DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldl  267
             GKP  ++E  ALLS+K++ T     D  S L+SW ++TS CTW  VTCD     V+   
Sbjct  19   TGKP--ISEPRALLSLKSSLTVTGDDDKNSPLSSWKLTTSFCTWTGVTCDVSRRHVTSLD  76

Query  268  sg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
               LNL G LSP++  L  L NLS+A NQ+SG +PP+IS +S LR+LNLSNN+F  TFP 
Sbjct  77   LSGLNLPGTLSPEISHLRLLQNLSLAENQISGQIPPQISNLSGLRYLNLSNNVFNGTFPD  136

Query  445  QLAQ-LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +++  L NL++LD+YNNNLTGDLP+ V  +T LRHLHLGGNYFSG IP
Sbjct  137  EISSGLVNLRILDVYNNNLTGDLPISVTNLTQLRHLHLGGNYFSGSIP  184


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L  L +  N  SGP+  E+ ++S+L+ ++LSNN+F    P   A+L
Sbjct  252  LTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLKSMDLSNNMFTGEIPTSFAEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  +  +  L  L L  N F+G IP
Sbjct  312  KNLTLLNLFRNKLHGEIPEFIGDLPELEVLQLWENNFTGSIP  353


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      +++  
Sbjct  468  LSGPLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSRNELSGDIPNEITGMRILNYLNLSRNHLVGAIP  569


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 53/100 (53%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +    G  P +  L+++ N+L G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FSGSIPSSYGSWPVIEYLAVSGNELVGKIPPEIGNLTTLRELYIGYYNAFEDGLPPEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  LTG++P E+ K+  L  L L  N FSG
Sbjct  239  LSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSG  278


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/98 (35%), Positives = 51/98 (52%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +P EI  +  L  L L  N+F      +L  L++L+
Sbjct  232  LPPEIGNLSELVRFDGANCGLTGEIPSEIGKLKKLDTLFLQVNVFSGPLTWELGSLSSLK  291

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  292  SMDLSNNMFTGEIPTSFAELKNLTLLNLFRNKLHGEIP  329


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P+++  +
Sbjct  492  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISHCKLLTFVDLSRNELSGDIPNEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  552  RILNYLNLSRNHLVGAIPSSISSMQSLTSLDFSYNNLSGLVP  593


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P ++     L  ++LS+N    T P  +   
Sbjct  324  LHGEIPEFIGDLPELEVLQLWENNFTGSIPQKLGENGKLHLVDLSSNKLTGTLPPNMCSG  383

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+ L    N L G +P  + K  SL  + +G N+ +G IP
Sbjct  384  NNLETLITLGNFLFGSIPDSLGKCESLTRIRMGENFLNGSIP  425



>ref|XP_007155783.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
 gb|ESW27777.1| hypothetical protein PHAVU_003G231400g [Phaseolus vulgaris]
Length=1018

 Score =   167 bits (423),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 92/158 (58%), Positives = 118/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAA-FTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS KA+  T D  ++L+SWN ST++C+W  +TCDS LHV +L+L+  +LSG L
Sbjct  26   ISEYRALLSFKASSITDDPTNALSSWNSSTTYCSWLGITCDSRLHVTTLNLTSSSLSGTL  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
               +  LPFL  LS+A NQ SGP+P   S++S LR LNLSNN F +TFP  L++LANLQV
Sbjct  86   YDHLSHLPFLSYLSLADNQFSGPIPASFSSLSALRHLNLSNNAFNATFPSNLSRLANLQV  145

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LDLYNNN+TG LP+ V  M  LRHLHLGGN+FSG+IPP
Sbjct  146  LDLYNNNMTGPLPLAVASMPLLRHLHLGGNFFSGQIPP  183


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  D+G+L  +  L +  N LSG + PE+  + +L+ ++LSNNI     P    +L
Sbjct  250  LSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V ++ +L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLHGAIPEFVGELPALEVLQLWENNFTGSIP  351


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG VP   + +  L  LNL  N      P  + +L
Sbjct  274  LSGSLTPELGNLKSLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIPEFVGEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L  + L  N  +G +PP
Sbjct  334  PALEVLQLWENNFTGSIPQSLGRNGKLTVVDLSSNKLTGMLPP  376


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+Q+  +
Sbjct  490  FSGQIPSQIGRLQQLSKIDFSRNEFSGPIAPEISRCKLLTFIDLSRNELSGEIPNQITAM  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  RILNYLNLSRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  591


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L NN+    FP   +  
Sbjct  394  LFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFGLPKLTQVELQNNLLTGQFPEGGSIA  453

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP
Sbjct  454  VNLGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIP  495


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G L  LV    A   LSG +P ++  +  +  L L  N    +   +L  L 
Sbjct  227  SGGIPPEIGNLSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTPELGNLK  286

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L+G++P    ++ +L  L+L  N   G IP
Sbjct  287  SLKSMDLSNNILSGEVPASFTELKNLTLLNLFRNKLHGAIP  327


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G    L  L+++ N+LSG +PPE+  ++ LR L +   N +    P ++  
Sbjct  177  FSGQIPPEYGTWQHLQYLAVSGNELSGNIPPELGNLTALRELYIGYYNAYSGGIPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D     L+G++P ++ ++ ++  L L  N  SG + P
Sbjct  237  LSQLVRFDAAYCGLSGEIPADLGRLQNMDTLFLQVNALSGSLTP  280


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 45/88 (51%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  +S++ N+LSG +PP I   ++++ L L  N F    P Q+ +L  L  +D   N  +
Sbjct  456  LGQISLSNNKLSGSLPPTIGNFTSMQKLLLDGNKFSGQIPSQIGRLQQLSKIDFSRNEFS  515

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ +   L  + L  N  SG IP
Sbjct  516  GPIAPEISRCKLLTFIDLSRNELSGEIP  543


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 46/103 (45%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G+L PD+     L  L    N L GP+P  I    +L  + +  N    + P  L  L
Sbjct  370  LTGMLPPDMCYGNRLQTLITLGNYLFGPIPDSIGKCESLNRIRMGENFLNGSIPIGLFGL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  ++L NN LTG  P       +L  + L  N  SG +PP
Sbjct  430  PKLTQVELQNNLLTGQFPEGGSIAVNLGQISLSNNKLSGSLPP  472



>ref|XP_002531999.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF30398.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=1021

 Score =   166 bits (421),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 97/159 (61%), Positives = 121/159 (76%), Gaps = 4/159 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllh-vvsldlsglNLSG  288
            ++E  ALLS+K+A   D Q +L SWN +  +  CTW  VTCD     + SLDLS LNLSG
Sbjct  25   ISEYQALLSLKSAID-DPQGALASWNSTNKNNLCTWSFVTCDYNNRHITSLDLSSLNLSG  83

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
             LSPD+  L +L NL++AANQ+SGP+P ++SAIS LR LNLSNN+F  +FP QL+QL NL
Sbjct  84   TLSPDIAHLRYLQNLTLAANQISGPIPIQLSAISGLRCLNLSNNVFNGSFPTQLSQLKNL  143

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            QVLDLYNNN+TGDLP+ V +M +LRHLHLGGN+FSG IP
Sbjct  144  QVLDLYNNNMTGDLPLAVTEMPNLRHLHLGGNFFSGAIP  182


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P   AQL
Sbjct  250  LSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  310  SNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIP  351


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G L   +G+   +  L +  N+ SGP+PPEI  +  L  ++ S+N F      +++Q
Sbjct  466  HLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQ  525

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  +DL  N L+G +P E+  M  L +L+L  N+  G IP
Sbjct  526  CKLLTFVDLSRNELSGAIPTEITGMRILNYLNLSRNHLVGSIP  568


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++  +
Sbjct  491  FSGPIPPEIGKLQQLSKVDFSHNKFSGPIAPEISQCKLLTFVDLSRNELSGAIPTEITGM  550

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  +G +P
Sbjct  551  RILNYLNLSRNHLVGSIPASIATMQSLTSVDFSYNNLTGLVP  592


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  L ++ ++ N LSG +P   + +S L  LNL  N      P  +  L
Sbjct  274  LSGSLIEELGNLKSLKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K  +L  + L  N  +G +PP
Sbjct  334  PQLEVLQLWENNFTGSIPQGLGKNGNLVLVDLSSNKLTGNLPP  376


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 56/102 (55%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG +  + G+  FL  L+++ N+L GP+PPEI  ++ L+ L +   N +    P ++  
Sbjct  177  FSGAIPREYGKWEFLEYLAVSGNELEGPIPPEIGNLTKLQQLYIGYYNTYEGGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L++L   D  N  L+G++P E+ K+  L  L L  N  SG +
Sbjct  237  LSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSL  278


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  LV    A   LSG +P EI  +  L  L L  N    +   +L  L +
Sbjct  228  GGLPPEIGNLSDLVRFDAANCMLSGEIPKEIGKLQKLDTLFLQVNGLSGSLIEELGNLKS  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN L+G++P    ++++L  L+L  N   G IP
Sbjct  288  LKSMDLSNNMLSGEIPTSFAQLSNLTLLNLFRNKLHGAIP  327


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP    ++
Sbjct  394  LFGPIPESLGKCQSLSRIRMGENFLNGSLPKGLFGLPKLTQVELQDNLLTGEFPVTDDKI  453

Query  460  A-NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            A NL  + L NN+LTG LP  + K + ++ L L GN FSG IPP
Sbjct  454  AVNLGQISLSNNHLTGSLPSSIGKFSGVQKLLLDGNKFSGPIPP  497


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +     QL  L  L++  N+L G +P  I  +  L  L L  N F  + P  L + 
Sbjct  298  LSGEIPTSFAQLSNLTLLNLFRNKLHGAIPEFIGDLPQLEVLQLWENNFTGSIPQGLGKN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL ++DL +N LTG+LP ++     L+ L    N+  G IP
Sbjct  358  GNLVLVDLSSNKLTGNLPPDMCSGDRLQTLITLSNFLFGPIP  399



>ref|XP_009397330.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1023

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 95/168 (57%), Positives = 118/168 (70%), Gaps = 4/168 (2%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsld  264
            +A  GAG      E  ALLS+KA  + D  ++L  W+ +T HC+W  VTCD    VVSLD
Sbjct  20   AADDGAGY---AEEHRALLSLKAQLS-DPGAALGPWDATTDHCSWPGVTCDDAGAVVSLD  75

Query  265  lsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH  444
            LSG NLSG+L P VG+L  L+ LS AAN  SGP+P E++ +  LR LNLSNNIF  +FP 
Sbjct  76   LSGRNLSGLLPPAVGRLRSLLRLSAAANSFSGPIPSELALLPALRHLNLSNNIFNGSFPA  135

Query  445  QLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             LA+LA+L+VLDLYNNNLTG LP E+  +  LRH+HLGGN+FSG IPP
Sbjct  136  PLARLADLRVLDLYNNNLTGPLPRELAALPQLRHIHLGGNFFSGSIPP  183


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G +PPE+S + +L+ ++LSNN      P   A L
Sbjct  250  LSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAAL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP
Sbjct  310  SNLTLLNLFRNKLFGAIPEFVGDLPELEVLQVWENNFTGSIP  351


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P+VG+L  L  L +++N+ SGP+ PE+S    L F++LS N      P  +A 
Sbjct  491  SFTGKIPPEVGRLQQLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVPADVAA  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +PV +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLEGPIPVAISTMQSLTAVDFSYNNLSGVVP  593


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++ +L  L ++ ++ N L+G +PP  +A+S L  LNL  N      P  +  L
Sbjct  274  LGGEIPPELSRLRSLKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIPEFVGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP
Sbjct  334  PELEVLQVWENNFTGSIPRRLGTNGRLQLLDLSSNKLTGSLPP  376


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+ +N       P ++  
Sbjct  201  LGGPIPPEIGNLSALRELYIGYYNSYDGGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGN  260

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  N L G++P E+ ++ SL+ + L  N  +G IPP
Sbjct  261  LRNLDTLFLQVNGLGGEIPPELSRLRSLKSMDLSNNALTGEIPP  304


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/100 (38%), Positives = 56/100 (56%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N  G   P +L++L +
Sbjct  228  GGLPPEIGNLSTLLRLDAANCGLSGRIPPEMGNLRNLDTLFLQVNGLGGEIPPELSRLRS  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN LTG++P     +++L  L+L  N   G IP
Sbjct  288  LKSMDLSNNALTGEIPPSFAALSNLTLLNLFRNKLFGAIP  327


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 54/101 (53%), Gaps = 6/101 (6%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            S  +SP++GQ+       ++ N+L+GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  451  SSSISPNLGQV------CLSNNRLAGPLPPSIGNYSGLQKLLLNQNSFTGKIPPEVGRLQ  504

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L  LDL +N  +G +  EV K   L  + L  N  SG +P
Sbjct  505  QLSKLDLSSNRFSGPITPEVSKCKLLTFVDLSRNELSGDVP  545



>ref|XP_010518800.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Tarenaya hassleriana]
Length=1011

 Score =   160 bits (406),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 91/143 (64%), Positives = 109/143 (76%), Gaps = 2/143 (1%)
 Frame = +1

Query  163  ADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSPDVGQLPFLVNLSI  339
            A   S+L +W  STS C W  VTCD+    V+SLDLSGLNLSG LS D+  L  L N S+
Sbjct  40   AGDDSALATWTDSTSFCGWAGVTCDASRRHVISLDLSGLNLSGTLSSDIAHLRLLQNFSV  99

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPV  516
            +ANQ+SGP+PPEIS++  LR+LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV
Sbjct  100  SANQISGPIPPEISSLFGLRYLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPV  159

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
             V  +T LRHLHLGGNYF+GRIP
Sbjct  160  SVTNLTQLRHLHLGGNYFAGRIP  182


 Score = 74.3 bits (181),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSGP+ PE+  +  L  ++LSNN+F    P   AQL
Sbjct  250  LTGQIPPEIGKLQKLDTLFLQVNGLSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLHGAIPEFIGDLPELEVLQLWENNFTGSIP  351


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G LP L ++ ++ N   G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGPLTPELGTLPILESMDLSNNMFVGEIPASFAQLKNLTLLNLFRNKLHGAIPEFIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +PP
Sbjct  334  PELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPP  376


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             +G +    G  P +  L+++ N+L G +PPEI  +STLR L +   N F    P ++  
Sbjct  177  FAGRIPAAYGSWPVIEYLAVSGNELVGKIPPEIGNLSTLRELYIGYYNAFEDGLPPEIGN  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L   D  N  LTG +P E+ K+  L  L L  N  SG + P
Sbjct  237  LSELVRFDAANCGLTGQIPPEIGKLQKLDTLFLQVNGLSGPLTP  280


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P  G++ F L  +S++ NQLSGP+PP I   S ++ L L  N F    P Q+ +L  L  
Sbjct  447  PVTGRVAFNLGQISLSNNQLSGPLPPTIGNFSGVQKLLLDGNKFTGLIPQQIGKLQQLSK  506

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D  +N  +G +  E+ +   L  + L  N  +G IP
Sbjct  507  MDFSHNRFSGRIAPEISQCKLLTFVDLSRNELAGEIP  543


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P ++     L+ L+LS+N    T P  +   
Sbjct  322  LHGAIPEFIGDLPELEVLQLWENNFTGSIPRKLGENGKLQLLDLSSNKLTGTLPPNMCSG  381

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L   +N L G +P  + +  SL  + +G N+ +G IP
Sbjct  382  NNLQTLITLSNFLFGPIPDSLGECESLTRIRMGENFLNGSIP  423


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/78 (32%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ Q   L  + ++ N+L+G +P EI+ +  L +LNLS N      P  ++ +
Sbjct  514  FSGRIAPEISQCKLLTFVDLSRNELAGEIPNEITGMRILNYLNLSRNHLVGPIPASISSM  573

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  574  QSLTSVDFSYNNLSGLVP  591



>ref|XP_009136515.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM2 [Brassica rapa]
Length=993

 Score =   160 bits (405),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 103/141 (73%), Gaps = 2/141 (1%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSIAAN  348
             S L SW++STS C W  VTCD+ L  V       LNLSG L   V  LP L NLS+AAN
Sbjct  45   HSPLASWDLSTSFCLWTGVTCDASLRHVISLDLSGLNLSGTLPSSVAHLPLLRNLSLAAN  104

Query  349  QLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVY  525
            Q+SG +PPE++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV + 
Sbjct  105  QISGHIPPEMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSIT  164

Query  526  KMTSLRHLHLGGNYFSGRIPP  588
             +T LRHLHLGGNYF+GRIPP
Sbjct  165  NLTELRHLHLGGNYFAGRIPP  185


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P +  QL
Sbjct  252  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPRFEQL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  312  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIP  353


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  452  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP
Sbjct  506  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIP  547


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  +
Sbjct  494  FSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGEIPNEITSM  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L G +PV +  M SL  +    N  SG +P
Sbjct  554  RILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVP  595


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 61/128 (48%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  179  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPAEIGN  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKM------------------------TSLRHLHLGGN  564
            L+ L  LD  N  L G++P E+ ++                        +SL+ + L  N
Sbjct  239  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNN  298

Query  565  YFSGRIPP  588
             F+G IPP
Sbjct  299  MFTGEIPP  306


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L  ++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  228  FDGGLPAEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  287

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  288  SSLKSMDLSNNMFTGEIPPRFEQLRNLTLLNLFRNKLYGAIP  329



>ref|XP_009394785.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   160 bits (404),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 118/159 (74%), Gaps = 3/159 (2%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGV  291
            ++  ALLS+KA F+  + + L++WN S    HC+W  V+CD     VVSLDL+GLNLSG 
Sbjct  30   SDVEALLSLKADFSDATSAVLSAWNSSADDDHCSWPGVSCDPLQGFVVSLDLTGLNLSGT  89

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  LA+L NL 
Sbjct  90   LSPAVGRLRHLLNLSAASNSLSGPIPAELSRLSDLRHLNLSNNLFNGSFPSALARLKNLL  149

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP EV ++  LRHLHLGGN+F+G IPP
Sbjct  150  VLDLYNNNLTGPLPTEVAELPELRHLHLGGNFFTGVIPP  188


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 62/104 (60%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++TLR L L   N F    P ++  
Sbjct  182  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGKLTTLRQLYLGYFNSFEGRIPPEIGG  241

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LA L  LD+ N  L+G++P E+  + +L  + L  N  +G +PP
Sbjct  242  LAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPP  285


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  + +  N L+G +PPE+  +  L+ ++LSNN      P   A L
Sbjct  255  LSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  + +L  L L  N F+G IP
Sbjct  315  QNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIP  356


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P VG    +  L +  NQ SG +PPEI  +  L  ++ S N F      +++Q 
Sbjct  473  LSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQC  532

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N   G IP
Sbjct  533  KLLTFVDLSRNELSGEIPSEITGMRILNYLNLSRNQLEGNIP  574


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +A L
Sbjct  279  LTGDLPPEMGRLRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L  L L  N  +G +PP
Sbjct  339  PTLEVLQLWENNFTGGIPRRLGQSGQLELLDLSSNKLTGNLPP  381


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L +
Sbjct  157  NLTGPLPTEVAELPELRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGK  216

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+ L L Y N+  G +P E+  + +L  L +     SG IPP
Sbjct  217  LTTLRQLYLGYFNSFEGRIPPEIGGLAALVRLDMANCGLSGEIPP  261


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + NQ SG + PEIS    L F++LS N      P ++  +
Sbjct  497  FSGRIPPEIGRLQQLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIPSEITGM  556

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G++P  +  M SL  +    N  SG +P
Sbjct  557  RILNYLNLSRNQLEGNIPSSIATMQSLTAIDFSYNNLSGLVP  598


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G L  LV L +A   LSG +PPE+  +  L  + L  N      P ++ +
Sbjct  230  SFEGRIPPEIGGLAALVRLDMANCGLSGEIPPELGNLQNLDTIFLQVNGLTGDLPPEMGR  289

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+ +DL NN L G++P     + +L  L+L  N   G IP
Sbjct  290  LRNLKSMDLSNNALAGEIPATFADLQNLTLLNLFRNKLHGSIP  332


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  I+ + TL  L L  N F    P +L Q 
Sbjct  303  LAGEIPATFADLQNLTLLNLFRNKLHGSIPEFIADLPTLEVLQLWENNFTGGIPRRLGQS  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L++LDL +N LTG+LP ++     L+ L + GN+  G IP
Sbjct  363  GQLELLDLSSNKLTGNLPPDLCSGNRLQTLIVLGNFLFGPIP  404


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 54/101 (53%), Gaps = 6/101 (6%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            + ++SPD+GQ+      S++ N+LSGP+PP +   S ++ L L+ N F    P ++ +L 
Sbjct  456  AALISPDLGQI------SLSNNRLSGPLPPSVGNFSGVQKLLLNQNQFSGRIPPEIGRLQ  509

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L  +D   N  +G +  E+ +   L  + L  N  SG IP
Sbjct  510  QLSKVDFSGNQFSGLISPEISQCKLLTFVDLSRNELSGEIP  550



>ref|XP_008787359.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1, partial [Phoenix 
dactylifera]
Length=1004

 Score =   159 bits (402),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 94/169 (56%), Positives = 117/169 (69%), Gaps = 5/169 (3%)
 Frame = +1

Query  85   SAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvvsl  261
            +A +G G+   V E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VVSL
Sbjct  19   AAASGRGR---VVEHRALLDLKAAL-GDPSGALAGWDATADHCQAWSGVACDAAGRVVSL  74

Query  262  dlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP  441
            ++S LNLSG L   V +L  L++LS AAN+LSGP+PPE+S +S LRFLNLSNN F  T P
Sbjct  75   NISXLNLSGPLPRAVSRLRSLLHLSAAANELSGPIPPELSLLSGLRFLNLSNNAFNRTLP  134

Query  442  HQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L++L NL VLDLYNNNLTG LPV+V  + +LRHLHLGGN+FSG IPP
Sbjct  135  SALSRLKNLHVLDLYNNNLTGVLPVQVADLPALRHLHLGGNFFSGAIPP  183


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN+     P   A+L
Sbjct  250  LSGEIPPEIGNLQNLDTLFLQVNGLSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNKLHGAIPDLIGDLPRLEVLQLWENNFTGEIP  351


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G+   +  L +  NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  NN +G++P E+  M  L +L+L  N+  G+IP
Sbjct  528  KLLTFVDLSRNNFSGEIPAEITGMRILNYLNLSRNHLEGKIP  569


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N F    P ++  +
Sbjct  492  FSGRIPPEIGRLQQLSKMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIPAEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  552  RILNYLNLSRNHLEGKIPASISTMQSLTAVDFSYNNLSGLVP  593


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGEITPELGKLRSLKSMDLSNNVLTGEIPRTFAELKNLTLLNLFRNKLHGAIPDLIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPP  376


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL   V  LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPVQVADLPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAISGNELGGPIPPELGN  211

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +  L+ L + Y N+  G LP  +  +T+L  L       SG IPP
Sbjct  212  VTTLRELYIGYFNSFQGGLPAAIGNITALVRLDAANCGLSGEIPP  256


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L  
Sbjct  321  KLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCS  380

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               LQVL    N L G +P    +  SL  + +G NY +G +P
Sbjct  381  GDQLQVLIALGNFLFGSIPESFGRCKSLSRIRMGENYLNGSVP  423


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/98 (33%), Positives = 50/98 (51%), Gaps = 6/98 (6%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SP +GQ+       ++ N+LSG +PP I   S ++ L L+ N F    P ++ +L  L 
Sbjct  454  ISPTLGQI------ILSNNRLSGALPPSIGKFSGVQKLLLNQNQFSGRIPPEIGRLQQLS  507

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +D   N  +G +  E+ K   L  + L  N FSG IP
Sbjct  508  KMDFSGNRFSGPITPEISKCKLLTFVDLSRNNFSGEIP  545



>ref|XP_010939309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1020

 Score =   158 bits (400),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 94/171 (55%), Positives = 116/171 (68%), Gaps = 7/171 (4%)
 Frame = +1

Query  94   AGAGKPLG---VTEQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsllhvvs  258
            AGA  P G     +QA LLS+K+A + D  ++L  WN + +  HC W  V CD+ L  V 
Sbjct  25   AGAPPPDGEASADDQATLLSLKSALS-DPGAALAGWNATAAPDHCAWHGVACDATLRRVV  83

Query  259  ldlsg-lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                  LNLSG L   VG L  L+NLS A N LSGP+PPE+S +S LR LNLSNN+F  +
Sbjct  84   SLDLSGLNLSGSLPTAVGHLRHLLNLSAATNFLSGPIPPELSFLSDLRHLNLSNNLFNGS  143

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            FP  L +L NL+VLDLYNNNLTG LPVEV ++++LRHLHLGGN+FSG IPP
Sbjct  144  FPSALRRLKNLEVLDLYNNNLTGLLPVEVAELSNLRHLHLGGNFFSGVIPP  194


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +PPE+  + +L+ L+LSNN      P   A L
Sbjct  261  LSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADL  320

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  321  WNLTLLNLFRNKLDGTVPDFIGDLPELEVLQLWDNNFTGIIP  362


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L  L ++ NQ SG +PPEI  +  L  ++ S N F      ++++ 
Sbjct  479  LSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKC  538

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  +DL  NNL+G++P E+  +  L +L++  N+  G IPP
Sbjct  539  KLLTFVDLSRNNLSGEIPAEIAGIRILNYLNVSRNHLEGSIPP  581


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++G+L  L +L ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  285  LAGELPPELGRLRSLKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVPDFIGDL  344

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P  + +   L+ L L  N  +G +P
Sbjct  345  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLP  386


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L +   N   G +PPEI  +S L   + +N     + P +L +
Sbjct  212  LVGAIPPEIGNLSRLRQLYVGYFNSYDGGIPPEIGNLSALVRFDAANCGLSGSIPPELGR  271

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  N L G+LP E+ ++ SL+ L L  N  +G IPP
Sbjct  272  LENLDTLFLQVNGLAGELPPELGRLRSLKSLDLSNNALTGEIPP  315


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ SG + PEIS    L F++LS N      P ++A +
Sbjct  503  FSGRIPPEIGRLQQLSKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIPAEIAGI  562

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L G +P  +  M SL  +    N  SG +P
Sbjct  563  RILNYLNVSRNHLEGSIPPSIATMQSLTAVDFSYNNLSGLVP  604


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  239  GGIPPEIGNLSALVRFDAANCGLSGSIPPELGRLENLDTLFLQVNGLAGELPPELGRLRS  298

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN LTG++P     + +L  L+L  N   G +P
Sbjct  299  LKSLDLSNNALTGEIPPSFADLWNLTLLNLFRNKLDGTVP  338


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/99 (35%), Positives = 50/99 (51%), Gaps = 3/99 (3%)
 Frame = +1

Query  298  PDVGQLPF---LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G  P    L  +S++ N+LSGP+P  I   S L+ L LS N F    P ++ +L  L
Sbjct  458  PDTGDAPISSSLGQISLSNNRLSGPLPLSIGNFSGLQKLLLSQNQFSGRIPPEIGRLQQL  517

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +D   N  +G++  E+ K   L  + L  N  SG IP
Sbjct  518  SKVDFSGNRFSGEIAPEISKCKLLTFVDLSRNNLSGEIP  556



>ref|XP_008441113.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1, partial [Cucumis melo]
Length=977

 Score =   158 bits (400),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 94/139 (68%), Positives = 113/139 (81%), Gaps = 0/139 (0%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
            +SSL SWN STSHCTW  VTCD   HV +LDL+ L LSG LSPDV  L FL NLS+AAN+
Sbjct  2    KSSLASWNASTSHCTWFGVTCDLRRHVTALDLTALGLSGSLSPDVAFLRFLTNLSLAANE  61

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  531
             SGP+PPE+S+IS+LR LNLSNN+F  +FP + +QL NL VLDLYNNN+TGD P+ V +M
Sbjct  62   FSGPIPPELSSISSLRLLNLSNNVFDGSFPSRFSQLQNLHVLDLYNNNMTGDFPIVVTEM  121

Query  532  TSLRHLHLGGNYFSGRIPP  588
            +SLRHLHLGGN+F+GRIPP
Sbjct  122  SSLRHLHLGGNFFAGRIPP  140


 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSGP+ PEI  +++L+ L+LSNN+     P   AQL
Sbjct  207  LSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQL  266

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+  IP
Sbjct  267  KNLTLLNLFRNKLHGAIPSFIGDLPKLEVLQLWENNFTEAIP  308


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N LSGP+ PEIS    L F++LS N      P+++  +
Sbjct  447  FSGQIPPEIGRLQQLSKIDFSSNMLSGPIAPEISQCKLLTFVDLSRNQLSGEIPNEITSM  506

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  507  RILNYLNLSKNHLVGGIPATIASMQSLTSVDFSYNNLSGLVP  548


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++GQL  L +L ++ N L G +P   + +  L  LNL  N      P  +  L
Sbjct  231  LSGPLTPEIGQLNSLKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIPSFIGDL  290

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN T  +P  + K   L+ L L  N  +G +PP
Sbjct  291  PKLEVLQLWENNFTEAIPQNLGKNGMLQILDLSSNKLTGTLPP  333


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 60/104 (58%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+VG++  L  L+++ N+LSGP+PPE+  ++ LR L +   N +    P ++  
Sbjct  134  FAGRIPPEVGRMQSLEYLAVSGNELSGPIPPELGNLTNLRELYIGYFNAYDGGLPAEIGN  193

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD  N  L+G +P E+ K+ +L  L L  N  SG + P
Sbjct  194  LSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTP  237


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L  ++G L  LV L  A   LSG +PPE+  +  L  L L  N        ++ QL +
Sbjct  185  GGLPAEIGNLSQLVRLDAANCGLSGRIPPELGKLQNLDTLFLQVNALSGPLTPEIGQLNS  244

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN L G++PV   ++ +L  L+L  N   G IP
Sbjct  245  LKSLDLSNNMLVGEIPVSFAQLKNLTLLNLFRNKLHGAIP  284


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N     FP   +  
Sbjct  351  LFGPIPESLGKCASLNRIRMGENFLNGSIPKGLLSLPKLSQVELQDNFLSGEFPITDSIS  410

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN LTG +P  +   + ++ L L GN FSG+IPP
Sbjct  411  LNLGQISLSNNRLTGSIPPTIGNFSGVQKLLLDGNKFSGQIPP  453



>ref|XP_006852730.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
 gb|ERN14197.1| hypothetical protein AMTR_s00033p00083200 [Amborella trichopoda]
Length=1017

 Score =   158 bits (400),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 115/156 (74%), Gaps = 2/156 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllh-vvsldlsglNLSGVLSP  300
            E   LLS+KAA   D  +SL SWN ST +C+W  V CD+  + VVSLDLS  NL+G L+P
Sbjct  28   EYRYLLSLKAAII-DPDNSLQSWNSSTDYCSWSGVACDASSNHVVSLDLSARNLNGTLAP  86

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            ++G+L  LVN+++A NQ +G +P EIS I+ L+ LNLSNN F + FP   + L NL+VLD
Sbjct  87   EIGRLRSLVNITVAENQFAGGIPLEISQINGLKLLNLSNNYFSANFPANFSGLKNLEVLD  146

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LYNNNLTG LP+EV +M +LRHLHLGGN+F+G IPP
Sbjct  147  LYNNNLTGPLPLEVTEMEALRHLHLGGNFFTGTIPP  182


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P+  +L  L  L +  N LSGP+ PE+ ++ +L+ ++LSNN+     P + ++L
Sbjct  249  LSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L+ L L  N F+G +P
Sbjct  309  KNLTLLNLFRNRLHGSIPGFIGDLPELQVLQLWENNFTGSVP  350


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+   L  L +  N  SG +PP+I  +  L  L+ S+N F      ++   
Sbjct  465  LSGQLPASIGKFSSLQKLLLDGNGFSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L V+DL  N L G +P E+ KM  L +L+L  N+  G IPP
Sbjct  525  KLLTVVDLSGNELNGTIPSEITKMRILNYLNLSRNHLMGGIPP  567


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L ++ ++ N L G +P E S +  L  LNL  N    + P  +  L
Sbjct  273  LSGPITPELGSLKSLKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIPGFIGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P ++    +L  L +  N  +G +PP
Sbjct  333  PELQVLQLWENNFTGSVPQQLGMNGNLILLDISSNKLTGSVPP  375


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + PD+G+L  L  L  + N+ SG + PEI+    L  ++LS N    T P ++ ++
Sbjct  489  FSGQIPPDIGKLQQLSKLDFSDNKFSGEISPEITNCKLLTVVDLSGNELNGTIPSEITKM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  549  RILNYLNLSRNHLMGGIPPSIQTMQSLTSVDFSYNNLSGLVP  590


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSG +PPE   +  L  L L  N        +L  L +
Sbjct  227  GGIPPELGNLSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITPELGSLKS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN L G +PVE  ++ +L  L+L  N   G IP
Sbjct  287  LKSMDLSNNMLDGQIPVEFSELKNLTLLNLFRNRLHGSIP  326


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G+  F+  L+++ N+L+G +P E+  ++ L+ L L   NI+    P +L  
Sbjct  176  FTGTIPPEYGKWGFIEYLAVSGNELTGKIPGELGNLTKLQQLYLGYYNIYEGGIPPELGN  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD+ N  L+G +P E  K+  L  L L  N  SG I P
Sbjct  236  LSALVRLDMANCALSGSIPPEFRKLQKLDTLFLQVNGLSGPITP  279


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L  N      P      
Sbjct  393  LFGPIPESLGECVSLARIRMGENYLNGSIPKGLLSLPNLVQVELQANYLTGNLPDSGKAS  452

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  L L NN L+G LP  + K +SL+ L L GN FSG+IPP
Sbjct  453  ENLGQLSLSNNRLSGQLPASIGKFSSLQKLLLDGNGFSGQIPP  495



>ref|XP_010941985.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1024

 Score =   158 bits (399),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 99/171 (58%), Positives = 119/171 (70%), Gaps = 4/171 (2%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G  +G  E  ALL +KAA   D   +L  W+ +  HC  W  V CD+   VV
Sbjct  16   RPSAAASGGGRVG--EHRALLDLKAAL-GDPSGALAGWDAAADHCQAWVGVACDAAGRVV  72

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            SL++S LNLSG L P V +L  L+ LS AANQLSGP+PPE+S +S LRFLNLSNN F  T
Sbjct  73   SLNISNLNLSGPLPPAVSRLRSLLRLSTAANQLSGPIPPELSLLSGLRFLNLSNNAFNET  132

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            FP  L++L NL VLDLYNNNLTG LP+EV ++ +LRHLHLGGN+FSG IPP
Sbjct  133  FPSALSRLKNLHVLDLYNNNLTGVLPLEVAELPALRHLHLGGNFFSGAIPP  183


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  + +L+ ++LSNN      P   A+L
Sbjct  250  LSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAEL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  310  KNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIP  351


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G+   +  L +  NQ SG +P EI  +  L  ++ S N F      ++ + 
Sbjct  468  LSGALPPSIGKFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IP
Sbjct  528  KLLTFVDLSRNNLSGEIPAEITGMRILNYLNLSRNHLEGEIP  569


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  +V +LP L +L +  N  SG +PPE      L +L +S N  G   P +L  
Sbjct  152  NLTGVLPLEVAELPALRHLHLGGNFFSGAIPPEYGRWEHLEYLAVSGNELGGPIPPELGN  211

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +  L+ L + Y N+  G LP  +  +T+L  L       SG+IPP
Sbjct  212  VTTLRELYIGYFNSFQGSLPAAIGNITALVRLDAANCGLSGKIPP  256


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G L  L ++ ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  274  LSGGITPELGMLRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP
Sbjct  334  PRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPP  376


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N+ SGP+ PEI     L F++LS N      P ++  +
Sbjct  492  FSGRIPLEIGRLQQLSKMDFSGNRFSGPITPEIRKCKLLTFVDLSRNNLSGEIPAEITGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  552  RILNYLNLSRNHLEGEIPASISTMQSLTAVDFSYNNLSGLVP  593


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G LP L  L +  N  +G +P  +     L+ L+LS+N    + P  L   
Sbjct  322  LHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPPNLCSG  381

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQVL    N L G +P  + +  SL  + +G NY +G IP
Sbjct  382  NNLQVLIALGNFLFGSIPESLGRCKSLSRIRMGENYLNGSIP  423


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G L   +G +  LV L  A   LSG +PPEI  +  L  L L  N        +L  
Sbjct  225  SFQGSLPAAIGNITALVRLDAANCGLSGKIPPEIGNLQNLDTLFLQVNGLSGGITPELGM  284

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  285  LRSLKSMDLSNNALTGEIPRTFAELKNLTLLNLFRNRLHGAIP  327


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  I  +  L  L L  N F    P +L   
Sbjct  298  LTGEIPRTFAELKNLTLLNLFRNRLHGAIPDLIGDLPRLEVLQLWENNFTGEIPRRLGTN  357

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP  +    +L+ L   GN+  G IP
Sbjct  358  GRLQLLDLSSNKLTGSLPPNLCSGNNLQVLIALGNFLFGSIP  399


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 52/105 (50%), Gaps = 2/105 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI--SAISTLRFLNLSNNIFGSTFPHQLA  453
            L+G +   +  LP L  + +  N L+G  P     S  STL  ++LSNN      P  + 
Sbjct  418  LNGSIPSGLFSLPNLAQVELQDNLLTGGFPETAGSSISSTLGQISLSNNRLSGALPPSIG  477

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + + +Q L L  N  +G +P+E+ ++  L  +   GN FSG I P
Sbjct  478  KFSGVQKLLLNQNQFSGRIPLEIGRLQQLSKMDFSGNRFSGPITP  522



>gb|AES94465.2| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1014

 Score =   155 bits (393),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPP
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPP  181


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIP  349


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L   ++  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPP  374


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIP  301


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIP  325


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIP  253


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ K   L  + L  N  SG IP
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIP  541



>ref|XP_003611507.1| Receptor-like protein kinase [Medicago truncatula]
Length=1109

 Score =   155 bits (393),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 87/157 (55%), Positives = 121/157 (77%), Gaps = 0/157 (0%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  ALLS + + T  +  SL+SWN +T+HCTW  VTC++  HV +++L+GL+LSG LS
Sbjct  25   ISEYRALLSFRQSITDSTPPSLSSWNTNTTHCTWFGVTCNTRRHVTAVNLTGLDLSGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++  LPFL NLS+A N+ SG +PP +SA++ LR LNLSNN+F  TFP +L+ L NL+VL
Sbjct  85   DELSHLPFLTNLSLADNKFSGQIPPSLSAVTNLRLLNLSNNVFNGTFPSELSLLKNLEVL  144

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LP+ V ++ +LRHLHLGGNY +G+IPP
Sbjct  145  DLYNNNMTGTLPLAVTELPNLRHLHLGGNYLTGQIPP  181


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN+     P    +L
Sbjct  248  LSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M +L  + L  N F+G IP
Sbjct  308  KNLTLLNLFRNKLHGAIPEFIGDMPALEVIQLWENNFTGNIP  349


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +   +G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P+++  +
Sbjct  488  FEGKIPSQIGRLQQLSKIDFSHNRFSGPIAPEISKCKLLTFVDLSRNELSGIIPNEITHM  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L   ++  N+L G +P  +  M SL  +    N  SG +P
Sbjct  548  KILNYFNISRNHLVGSIPGSIASMQSLTSVDFSYNNLSGLVP  589


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N L+G +P     +  L  LNL  N      P  +  +
Sbjct  272  LSGSLTWELGNLKSLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIPEFIGDM  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+V+ L+ NN TG++P+ +     L  L +  N  +G +PP
Sbjct  332  PALEVIQLWENNFTGNIPMSLGTNGKLSLLDISSNKLTGTLPP  374


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N+ +G +PP+I  ++ L  L+ +        PH++ +
Sbjct  199  LDGTIPPEIGNLTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGK  258

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL  L L  N L+G L  E+  + SL+ + L  N  +G IP
Sbjct  259  LQNLDTLFLQVNALSGSLTWELGNLKSLKSMDLSNNMLTGEIP  301


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P +G L  L+ L  A   LSG +P EI  +  L  L L  N    +   +L  L 
Sbjct  225  TGGIPPQIGNLTELIRLDAAYCGLSGEIPHEIGKLQNLDTLFLQVNALSGSLTWELGNLK  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  285  SLKSMDLSNNMLTGEIPTSFGELKNLTLLNLFRNKLHGAIP  325


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++G L   V +LP L +L +  N L+G +PPE  +   L++L +S N    T P ++  
Sbjct  150  NMTGTLPLAVTELPNLRHLHLGGNYLTGQIPPEYGSWQHLQYLAVSGNELDGTIPPEIGN  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ L + Y N  TG +P ++  +T L  L       SG IP
Sbjct  210  LTSLRELYIGYFNEYTGGIPPQIGNLTELIRLDAAYCGLSGEIP  253


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ NQLSGP+PP I   S ++ L L  N+F    P Q+ +L  L  +D  +N  +
Sbjct  454  LGQITLSNNQLSGPLPPSIGNFSGVQKLLLDGNMFEGKIPSQIGRLQQLSKIDFSHNRFS  513

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +  E+ K   L  + L  N  SG IP
Sbjct  514  GPIAPEISKCKLLTFVDLSRNELSGIIP  541



>ref|XP_009394620.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1003

 Score =   154 bits (390),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 93/159 (58%), Positives = 117/159 (74%), Gaps = 4/159 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGV  291
            TE  ALL +KAA  +D  ++L++WN S    HC+W  V CD     VVSLDLSGLNLSG 
Sbjct  29   TEVEALLELKAA-VSDPSAALSAWNSSDGVDHCSWPGVACDPLRGSVVSLDLSGLNLSGT  87

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP VG+L  L+NLS+A+N LSGP+P ++S ++ LR LNLS+N+   +FP  LA L NL 
Sbjct  88   LSPAVGRLRHLLNLSVASNSLSGPIPADLSRLADLRHLNLSDNLLNGSFPSALAHLKNLL  147

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP EV ++ +LRHLHLGGN+F+G IPP
Sbjct  148  VLDLYNNNLTGPLPAEVAELPNLRHLHLGGNFFTGVIPP  186


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPAEVAELPNLRHLHLGGNFFTGVIPPEFGGWEFLEYLAVSGNDLGGPIPPELGN  214

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+ L + Y N+  G +P E+ ++ +L  L +     SG IPP
Sbjct  215  LTRLRQLYVGYFNSFVGGIPPEIGRLAALVRLDMANCGLSGAIPP  259


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G+L  LV L +A   LSG +PPE+  +  L  L L  N      P  L +L +
Sbjct  231  GGIPPEIGRLAALVRLDMANCGLSGAIPPELGNLQNLDTLFLQVNGLAGDIPSALGRLRS  290

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +D+ NN LTG++P     + +L  L+L  N   G IP
Sbjct  291  LKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIP  330


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/101 (34%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P+ G+L  L  L ++ N+ SGP+ PEIS    L F++LS N      P  +A +
Sbjct  495  FSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPPDIAGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
              L  L+L  N+L G +P  +  + SL  +    N  SG +
Sbjct  555  RILNYLNLSRNHLEGSIPQSLATIQSLTAVDFSYNNLSGLV  595


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+   +  L +  NQ SG +PPE   +  L  L+LS N F      ++++ 
Sbjct  471  LSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELCKLDLSGNRFSGPIAPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N ++G++P ++  M  L +L+L  N+  G IP
Sbjct  531  KLLAFVDLSRNEISGEIPPDIAGMRILNYLNLSRNHLEGSIP  572


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +G+L  L ++ I+ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  277  LAGDIPSALGRLRSLKSMDISNNALTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP
Sbjct  337  PALEVLQLWENNFTGGIPQRLGESARLQLLDVSSNKLTGNLPP  379


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 52/99 (53%), Gaps = 6/99 (6%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +SPD+G    L+NLS   N+LSGP+P  I   S ++ L L+ N F    P +  +L  L 
Sbjct  457  ISPDLG----LINLS--NNRLSGPLPRSIGKYSGVQKLLLNQNQFSGRIPPETGRLQELC  510

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             LDL  N  +G +  E+ +   L  + L  N  SG IPP
Sbjct  511  KLDLSGNRFSGPIAPEISRCKLLAFVDLSRNEISGEIPP  549


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L + 
Sbjct  301  LTGEIPSTFADLQNLTLLNLFRNKLQGSIPECVGDLPALEVLQLWENNFTGGIPQRLGES  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A LQ+LD+ +N LTG+LP ++     L+ L +  N+  G IP
Sbjct  361  ARLQLLDVSSNKLTGNLPPDLCSGNRLQTLIVLRNFLFGPIP  402



>ref|XP_009408581.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1016

 Score =   154 bits (389),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 85/154 (55%), Positives = 104/154 (68%), Gaps = 2/154 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E  ALLSIK+  + D  ++LT+W+ +T HC W  VTCD    V        NLSG LSP 
Sbjct  30   EHHALLSIKSQLS-DPGAALTAWDPATDHCAWPGVTCDRAAVVELDLSGR-NLSGPLSPA  87

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
             G L  L+ LS A N LSGP+PP ++ ++ LR LNLSNN+F  +FP  LA LA+L+VLDL
Sbjct  88   FGSLRSLLRLSAAENSLSGPIPPALALLTVLRHLNLSNNLFDGSFPPALAGLADLRVLDL  147

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            YNNNLTG LP EV  +  LRHLHLGGN+FSG IP
Sbjct  148  YNNNLTGPLPREVAALHQLRHLHLGGNFFSGSIP  181


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P+VG+L  L  L  + N+ +GP+ PEIS    L F++LS N      P ++A 
Sbjct  490  SFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKCKLLTFVDLSRNELSGDIPEEIAA  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  550  MRILNYLNLSRNHLEGQIPAAISTMQSLTQVDFSYNNLSGVVP  592


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L +L +  N L G +P E+  + +L+ ++LSNN      P   A L
Sbjct  249  LSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  +  L  L L  N F+G +P
Sbjct  309  GNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVP  350


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P +     L  L +  N  +G +PPE+  +  L  L+ S N F      ++++ 
Sbjct  467  LTGPLPPSIANFFGLQKLLLNQNSFTGGIPPEVGRLQQLSKLDFSGNRFAGPITPEISKC  526

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L+L  N+  G+IP
Sbjct  527  KLLTFVDLSRNELSGDIPEEIAAMRILNYLNLSRNHLEGQIP  568


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  273  LVGEIPLELGRLRSLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDL  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + K   L+ L L  N  +G +PP
Sbjct  333  PELEVLQLWENNFTGSVPRRLGKNGRLQSLDLSSNKLTGSLPP  375


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPEI  +STL  L+++N       P ++  
Sbjct  200  LGGPIPPEIGNLSSLRELYIGYYNSYEGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGN  259

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  L L  N L G++P+E+ ++ SL+ + L  N  +G IPP
Sbjct  260  LRILDSLFLQVNGLVGEIPLELGRLRSLKSMDLSNNALTGEIPP  303


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
             G L P++G L  L+ L +A   LSG +PPEI  +  L  L L  N      P +L +L 
Sbjct  226  EGGLPPEIGNLSTLLRLDVANCGLSGRIPPEIGNLRILDSLFLQVNGLVGEIPLELGRLR  285

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  286  SLKSMDLSNNALTGEIPPSFADLGNLTLLNLFRNKLFGAIP  326


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F  + P +L + 
Sbjct  297  LTGEIPPSFADLGNLTLLNLFRNKLFGAIPEFVGDLPELEVLQLWENNFTGSVPRRLGKN  356

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ LDL +N LTG LP ++     L+ L   GN+  G IP
Sbjct  357  GRLQSLDLSSNKLTGSLPPDLCYGNKLQTLIALGNFLFGPIP  398



>ref|XP_007156674.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
 gb|ESW28668.1| hypothetical protein PHAVU_002G007600g [Phaseolus vulgaris]
Length=1005

 Score =   152 bits (383),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 125/159 (79%), Gaps = 0/159 (0%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            L  +E  ALLS+++A T  +   L+SWN STS+C+W  VTCDS  HV++L+L+GL+LSG 
Sbjct  18   LPFSEYTALLSLRSAITDATPPVLSSWNASTSYCSWLGVTCDSHRHVIALNLTGLDLSGT  77

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LS D+  LPFL NLS+A N+ SGP+PP +S++S+LR LNLSNN F  TFP +L++L +L+
Sbjct  78   LSADIAHLPFLSNLSLATNKFSGPIPPALSSLSSLRLLNLSNNGFNQTFPPELSRLQSLE  137

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNN+TG LP+   +M +LRHLHLGGN+FSGRIPP
Sbjct  138  VLDLYNNNMTGALPLAAAQMLNLRHLHLGGNFFSGRIPP  176


 Score = 68.6 bits (166),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++  +G+L  L  L +  N LSGP+ PE+  + +L+ ++LSNN+     P   ++L
Sbjct  243  LSGEITAALGKLQKLDTLFLQVNALSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSEL  302

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L G +P  + ++ SL  + L  N F+G IP
Sbjct  303  KNITLLNLFRNKLHGAIPEFIGELPSLEVVQLWENNFTGSIP  344


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N  SGP+PP+I  +  L  ++ S N F      +++Q 
Sbjct  459  LSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEPEISQC  518

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N+L+G++P E+  M  L  L+L  N+  G IP
Sbjct  519  KLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIP  560


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+P++G L  L ++ ++ N LSG +P   S +  +  LNL  N      P  + +L
Sbjct  267  LSGPLTPELGNLKSLKSMDLSNNMLSGEIPATFSELKNITLLNLFRNKLHGAIPEFIGEL  326

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+V+ L+ NN TG +P  + K   L  L +  N  +G +PP
Sbjct  327  PSLEVVQLWENNFTGSIPEGLGKNGRLSVLDISSNKLTGALPP  369


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 1/97 (1%)
 Frame = +1

Query  298  PDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            P+ G +   L  ++++ NQLSGP+PP I   S+++ L L  N+F    P Q+ +L  L  
Sbjct  440  PEAGSVAVNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPPQIGRLQQLSK  499

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +D   N  +G +  E+ +   L  L L  N  SG IP
Sbjct  500  IDFSGNKFSGRIEPEISQCKLLTFLDLSRNDLSGEIP  536


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G    L  + +  N L+G +P  +  +  L  + L +N     FP   +  
Sbjct  387  LFGPIPEALGSCESLTRIRMGENFLNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVA  446

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL  + L NN L+G LP  +   +S++ L L GN FSG IPP
Sbjct  447  VNLGQITLSNNQLSGPLPPSIGNFSSVQKLLLDGNMFSGPIPP  489


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ GQ   L  L+++ N+L G +PPEI  +++LR L +   N +    P ++  
Sbjct  170  FSGRIPPEYGQWQRLEYLAVSGNELEGKIPPEIGNLTSLRELYIGYYNTYEGGIPPEIGN  229

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD     L+G++   + K+  L  L L  N  SG + P
Sbjct  230  LSELVRLDAAYCGLSGEITAALGKLQKLDTLFLQVNALSGPLTP  273


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG + P++ Q   L  L ++ N LSG +P EI+ +  L  LNLS+N    + P  ++ 
Sbjct  506  KFSGRIEPEISQCKLLTFLDLSRNDLSGEIPNEITGMRILNCLNLSSNHLVGSIPSSISS  565

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  566  MQSLTSVDFSYNNLSGLVP  584


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P   S    L  + LSNN      P  +   
Sbjct  411  LNGSIPKGLFGLPKLTQVELQDNYLSGGFPEAGSVAVNLGQITLSNNQLSGPLPPSIGNF  470

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +++Q L L  N  +G +P ++ ++  L  +   GN FSGRI P
Sbjct  471  SSVQKLLLDGNMFSGPIPPQIGRLQQLSKIDFSGNKFSGRIEP  513



>emb|CDY08759.1| BnaA06g24650D [Brassica napus]
Length=971

 Score =   149 bits (377),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 81/159 (51%), Positives = 105/159 (66%), Gaps = 27/159 (17%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
              DV +     NLS+A NQ+SGP+PPEIS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRRH---NLSLADNQISGPIPPEISNLSGLRHLNLSNNVFNGSFPDKISSGLANLR  117

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP
Sbjct  118  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPP  156


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  223  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDL  282

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  283  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIP  324


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  439  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRC  498

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  499  KLLTFVDLSRNELSGEIPKEITGMKILNYLNLSRNHLIGSIP  540


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  203  LPPEIGNLSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  262

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P     + +L  L+L  N   G IP
Sbjct  263  SMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIP  300


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  247  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGEL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP
Sbjct  307  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPP  349


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  150  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  209

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG
Sbjct  210  LSELVRFDAANCALNGEIPPEIGRLQKLDTLFLQVNVFSG  249


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  463  FEGPIPSEVGKLQQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIPKEITGM  522

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  523  KILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  564


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  421  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  474

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  475  QQLSKIDFSHNLFSGGIAPEISRCKLLTFVDLSRNELSGEIP  516


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  271  FTGEIPASFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  330

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  331  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIP  372



>ref|XP_010675918.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Beta vulgaris subsp. vulgaris]
Length=940

 Score =   147 bits (371),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 78/158 (49%), Positives = 107/158 (68%), Gaps = 2/158 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            ++E+ ALLSIK+A T D Q+ L+SWN +T HC+W  +TC SL   V       L L+G+L
Sbjct  51   LSEEKALLSIKSAITDDPQNYLSSWNTTTHHCSWPFITCSSLSSSVISLDISGLELTGIL  110

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+G L  L NL+IA N  S P+PP +S ++ LR+LNLS N F +TFP   + L  L +
Sbjct  111  SPDIGSLTHLQNLNIAENSFSDPIPPSLSLLTQLRYLNLSYNDF-TTFPSTFSSLKKLTI  169

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD+ +NN TG LP+ V +M+ LR+L LGGN+F G +PP
Sbjct  170  LDILSNNFTGLLPLSVVEMSELRYLDLGGNHFYGEVPP  207


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++G+L  L  LS   N+LSG +P E+ ++ +L+ ++  NN      P   + 
Sbjct  259  NFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIPESYSL  318

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L N+   DL NN L G +P  +     L  L L  N F+G IPP
Sbjct  319  LQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPP  362


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 53/111 (48%), Gaps = 11/111 (10%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIA-----------ANQLSGPVPPEISAISTLRFLNLSNNIFGS  432
            G + P+ GQ   L  LS +            N  SG +PPE+  ++ L  L  S   F  
Sbjct  203  GEVPPEYGQWENLEYLSFSWPNYYLDYVDYNNIFSGGIPPELGNLTKLTTLYGSTCNFSG  262

Query  433  TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              P +L +L  L+VL  Y N L+G LP E+  M SL+H+    N  SG IP
Sbjct  263  KIPTELGKLKKLEVLSFYENKLSGGLPFELGSMKSLKHMDFFNNTLSGVIP  313


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G L  L  L  +    SG +P E+  +  L  L+   N      P +L  +
Sbjct  236  FSGGIPPELGNLTKLTTLYGSTCNFSGKIPTELGKLKKLEVLSFYENKLSGGLPFELGSM  295

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L+ +D +NN L+G +P     + ++ H  LG N   G IP
Sbjct  296  KSLKHMDFFNNTLSGVIPESYSLLQNITHFDLGNNKLHGSIP  337


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 59/130 (45%), Gaps = 27/130 (21%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G+L   + +   L +L+I  N+L GP+P  + +  +L+ + +  N      P  L  
Sbjct  379  NLTGILPVSLCKGDRLQDLTIFNNRLVGPIPESLGSCKSLQIVEMGYNFLNGLIPKGLFG  438

Query  457  LANLQV---------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHL  555
            L N+ +                           LDL NN LTG+LP  +   + LR+L L
Sbjct  439  LPNISLIQLNDNHLTGRGFDENTTHPFSVSLIWLDLSNNQLTGELPASIGNFSILRYLLL  498

Query  556  GGNYFSGRIP  585
             GN F+G IP
Sbjct  499  DGNKFTGSIP  508


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSGV+      L  + +  +  N+L G +P  I     L  L+LS+N F  + P +L   
Sbjct  308  LSGVIPESYSLLQNITHFDLGNNKLHGSIPDFIGDFPELEELDLSSNNFTGSIPPKLGTN  367

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ + +  NNLTG LPV + K   L+ L +  N   G IP
Sbjct  368  GRLQFVRMDRNNLTGILPVSLCKGDRLQDLTIFNNRLVGPIP  409


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/94 (32%), Positives = 49/94 (52%), Gaps = 6/94 (6%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L+ L ++ NQL+G +P  I   S LR+L L  N F  + P ++++   L  LDL +N  +
Sbjct  469  LIWLDLSNNQLTGELPASIGNFSILRYLLLDGNKFTGSIPSEISKCQALIQLDLSSNQFS  528

Query  502  GDLPVEVY------KMTSLRHLHLGGNYFSGRIP  585
             ++P E+        +  +R L L  N  +G IP
Sbjct  529  DEIPNEITGNKSICNLDEIRFLDLSNNTLTGEIP  562



>ref|XP_003608587.1| Receptor-like protein kinase [Medicago truncatula]
 gb|AES90784.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=1005

 Score =   147 bits (370),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 118/157 (75%), Gaps = 2/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            ++E  +LLS K++ T D Q+ LTSWN  T +C+W  + C    HV+SL+L+ L+L+G LS
Sbjct  25   ISEYHSLLSFKSSITNDPQNILTSWNPKTPYCSWYGIKCSQHRHVISLNLTSLSLTGTLS  84

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
              +  LPFL NLS+A N+ SGP+P  +S++S+LRFLNLSNNIF  T P +L+ L NLQVL
Sbjct  85   --LSNLPFLTNLSLADNKFSGPIPSSLSSLSSLRFLNLSNNIFNGTLPQELSNLFNLQVL  142

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            DLYNNN+TG LPV V  ++ LRHLHLGGN+F+G+IPP
Sbjct  143  DLYNNNMTGSLPVSVTHLSFLRHLHLGGNFFTGKIPP  179


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +  E+  + +L+ ++LSNN F    P   A+L
Sbjct  246  LTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAEL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + +M SL  L +  N F+G IP
Sbjct  306  KNLTLLNLFRNKLHGAIPEFIGEMPSLEVLQIWENNFTGSIP  347


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++ ++
Sbjct  486  FSGKIPAEIGKLHQLSKIDFSHNKFSGPIAPEISHCKLLTFVDLSRNELSGEIPKEITKM  545

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  +G +P
Sbjct  546  KILNYLNLSRNHLVGTIPGSIASMQSLTSVDFSYNNLTGLVP  587


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  +V    A   L+G VPPE+  +  L  L L  N    +   +L  L +
Sbjct  224  GGIPPEIGNLSEMVRFDAAYCGLTGEVPPELGKLQKLDTLFLQVNALSGSLTSELGNLKS  283

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN  TG++PV   ++ +L  L+L  N   G IP
Sbjct  284  LKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIP  323


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  +G VP   + +  L  LNL  N      P  + ++
Sbjct  270  LSGSLTSELGNLKSLKSMDLSNNAFTGEVPVSFAELKNLTLLNLFRNKLHGAIPEFIGEM  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL ++ NN TG +P  + K   L  + +  N  +G +PP
Sbjct  330  PSLEVLQIWENNFTGSIPQSLGKNGKLTLVDVSSNKLTGSLPP  372


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+    FP  ++  
Sbjct  390  LFGPIPDSLGKCKSLNRIRMGENFLNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMS  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  + L NN L+G LP  +   TS++ L L GN FSG+IP
Sbjct  450  INLGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIP  491


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/112 (30%), Positives = 55/112 (49%), Gaps = 24/112 (21%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP------HQLAQL--------  459
            L  ++++ N+LSGP+PP I   ++++ L L  N F    P      HQL+++        
Sbjct  452  LGQVTLSNNKLSGPLPPSIGNFTSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFS  511

Query  460  ----------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
                        L  +DL  N L+G++P E+ KM  L +L+L  N+  G IP
Sbjct  512  GPIAPEISHCKLLTFVDLSRNELSGEIPKEITKMKILNYLNLSRNHLVGTIP  563


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 47/103 (46%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG  P  +S    L  + LSNN      P  +   
Sbjct  414  LNGSIPKGLFGLPELTQVELQDNLLSGNFPQPVSMSINLGQVTLSNNKLSGPLPPSIGNF  473

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             ++Q L L  N  +G +P E+ K+  L  +    N FSG I P
Sbjct  474  TSVQKLILDGNQFSGKIPAEIGKLHQLSKIDFSHNKFSGPIAP  516



>gb|ADB85326.1| putative receptor protein kinase [Phyllostachys edulis]
Length=265

 Score =   139 bits (351),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 99/143 (69%), Gaps = 1/143 (1%)
 Frame = +1

Query  163  ADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSI  339
            +D   +L SW N + SHC W  VTC +   VV LD++GLNLSG L P + +L  L  LS+
Sbjct  36   SDPTGALASWANGTASHCAWAGVTCSTRGTVVGLDVAGLNLSGALPPALSRLRGLFRLSV  95

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  519
            AAN  SGP+P  ++ +  L  LNLSNN F  +FP  LA+L +L+VLDLYNNNLT  LP+E
Sbjct  96   AANAFSGPIPASLARLQFLVHLNLSNNAFDGSFPAPLARLRSLRVLDLYNNNLTSPLPLE  155

Query  520  VYKMTSLRHLHLGGNYFSGRIPP  588
            V +M  LRHLHLGGN+FSG IPP
Sbjct  156  VVQMPQLRHLHLGGNFFSGEIPP  178


 Score = 55.8 bits (133),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  
Sbjct  147  NLTSPLPLEVVQMPQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGN  206

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L          SG IPP
Sbjct  207  LTSLRELYIGYYNSYSGGLPPELGNLTELVRFDAANCGLSGEIPP  251



>ref|XP_008237309.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Prunus mume]
Length=968

 Score =   147 bits (370),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 73/104 (70%), Positives = 82/104 (79%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G LS D+  L FL N ++A NQ SGP+P EISA+S LR LNLSNNIF +TFP QL+ 
Sbjct  26   DLVGTLSSDIAHLRFLSNGTLADNQFSGPIPSEISALSGLRLLNLSNNIFNTTFPPQLSN  85

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L VLDLYNNNLTGDLPV V  MTSLRHLHLGGN+FSGRIPP
Sbjct  86   LTRLAVLDLYNNNLTGDLPVAVTHMTSLRHLHLGGNFFSGRIPP  129


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++G+L  +  L +  N LSG +  E+ ++ +L+ ++LSNN+F    P   ++
Sbjct  195  NLTGEVPRELGRLQNVDTLFLQVNALSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSE  254

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L+L+ N L G +P  +  +  L+ L L  N F+G IP
Sbjct  255  LKNLTLLNLFRNKLHGAIPEFIGDLPELQVLQLWENNFTGSIP  297


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 60/102 (59%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+++ N+L G +PPEI  +++L+ L +   N++    P ++  
Sbjct  123  FSGRIPPEFGRFPLLEYLAVSGNELGGSIPPEIGNLTSLKELYIGYYNVYEGGIPPEIGN  182

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            L+ L  LD  N NLTG++P E+ ++ ++  L L  N  SG +
Sbjct  183  LSQLVRLDAANCNLTGEVPRELGRLQNVDTLFLQVNALSGSL  224


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L+ ++G L  L ++ ++ N  SG +P   S +  L  LNL  N      P  +  L
Sbjct  220  LSGSLTAELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRNKLHGAIPEFIGDL  279

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQVL L+ NN TG +P  + K   L  L L  N  +G +PP
Sbjct  280  PELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPP  322


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +PPEI  +  L  ++ S+N F      +++Q 
Sbjct  412  LSGSLPPTIGNFSGVQKLLLDGNKFSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQC  471

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L G++P E+  M  L +L+L  N+  G IP
Sbjct  472  KLLTFVDLSRNELAGEIPKEITGMRILNYLNLSRNHLVGSIP  513


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+  GP+ PEIS    L F++LS N      P ++  +
Sbjct  436  FSGRIPPEIGRLQQLSKIDFSHNKFLGPIAPEISQCKLLTFVDLSRNELAGEIPKEITGM  495

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  496  RILNYLNLSRNHLVGSIPSSISTMQSLTSVDFSYNNLSGLVP  537


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP      
Sbjct  340  LFGPIPESLGKCGSLSRIRMGENFLNGSIPKGLFGLPKLTQVELQDNLLAGSFPETETIS  399

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            ANL  + L NN L+G LP  +   + ++ L L GN FSGRIPP
Sbjct  400  ANLGQISLSNNRLSGSLPPTIGNFSGVQKLLLDGNKFSGRIPP  442


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 43/152 (28%), Positives = 67/152 (44%), Gaps = 8/152 (5%)
 Frame = +1

Query  130  AALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            A L S+K+  + D  +++ S  I  S    + +T  +L            L G +   +G
Sbjct  226  AELGSLKSLKSMDLSNNMFSGEIPGSFSELKNLTLLNLFRN--------KLHGAIPEFIG  277

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             LP L  L +  N  +G +P  +     L  L+LS+N    T P  +    NLQ L    
Sbjct  278  DLPELQVLQLWENNFTGSIPQGLGKNGKLITLDLSSNKLTGTLPPDMCFGNNLQTLITLG  337

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N L G +P  + K  SL  + +G N+ +G IP
Sbjct  338  NFLFGPIPESLGKCGSLSRIRMGENFLNGSIP  369



>ref|XP_009395647.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1004

 Score =   145 bits (367),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 84/142 (59%), Positives = 104/142 (73%), Gaps = 1/142 (1%)
 Frame = +1

Query  166  DSQSSLTSWNISTSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
            D   +L +WN +  HC+W  V CD   + V+SLDL+GLNLSG LSP VG+L  LVNLS A
Sbjct  46   DPSGALYAWNSADGHCSWPGVACDPIRVFVLSLDLTGLNLSGTLSPAVGRLHHLVNLSTA  105

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  522
            +N LSGP+P E+S +S LR LNLSNN+F  +FP   ++L NL VLDLYNNNL G LP EV
Sbjct  106  SNSLSGPLPAELSHLSNLRHLNLSNNLFNGSFPSAFSRLKNLLVLDLYNNNLAGTLPPEV  165

Query  523  YKMTSLRHLHLGGNYFSGRIPP  588
             ++ +L HLHLGGN+FSG IPP
Sbjct  166  SELPNLLHLHLGGNFFSGVIPP  187


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/129 (35%), Positives = 66/129 (51%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLP------------------------FLVNLSIAANQLSGPVPPEISA  384
            NL+G L P+V +LP                        FL  L+++ N+L GP+PPE+  
Sbjct  156  NLAGTLPPEVSELPNLLHLHLGGNFFSGVIPPEFGHWEFLEYLAVSGNELGGPIPPELGN  215

Query  385  ISTLRFLNLSN-NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            ++ LR L +   N F    P ++  L+ L  LD+ N  LTGD+P E+ K+ +L  L L  
Sbjct  216  LTRLRQLYVGYFNSFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQV  275

Query  562  NYFSGRIPP  588
            N  SGR+PP
Sbjct  276  NGLSGRLPP  284


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  254  LTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP
Sbjct  314  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIP  355


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + NQ SGP+ PEIS    L F++LS N        ++A +
Sbjct  496  FSGGIPPEIGRLQQLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILPEIAGM  555

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N FSG +P
Sbjct  556  RILNYLNLSRNQLEGSIPPSISTMQSLTAVDFSYNNFSGLVP  597


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  278  LSGRLPPELGGLRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDL  337

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L+ L +  N  +G +PP
Sbjct  338  PALEVLQLWENNFTGGIPRRLGQSGRLQILDISSNKLTGTLPP  380


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G L  LV L +A   L+G +PPE+  +  L  L L  N      P +L  
Sbjct  229  SFEGGIPPEIGGLSELVRLDMANCGLTGDIPPELGKLQNLDTLFLQVNGLSGRLPPELGG  288

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  289  LRSLKSMDLSNNALTGEIPGSFADLQNLTLLNLFRNKLHGSIP  331


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 6/102 (6%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+GQ    +NLS   N+L GP+PP I   S L+ L L+ N F    P ++ +L 
Sbjct  455  AAAISPDLGQ----INLS--NNRLLGPLPPSIGNFSGLQKLLLNQNQFSGGIPPEIGRLQ  508

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             L  +D   N  +G +  E+ +   L  + L  N  SG I P
Sbjct  509  QLSKVDFSGNQFSGPIAPEISRCKLLTFVDLSRNKLSGEILP  550


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  302  LTGEIPGSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  361

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LD+ +N LTG LP  +     L+ L   GN+  G IP
Sbjct  362  GRLQILDISSNKLTGTLPPNLCFGNRLQTLIALGNFLFGSIP  403



>ref|XP_010685023.1| PREDICTED: receptor-like protein 12 [Beta vulgaris subsp. vulgaris]
Length=762

 Score =   143 bits (360),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 86/170 (51%), Positives = 112/170 (66%), Gaps = 12/170 (7%)
 Frame = +1

Query  106  KPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTC---------dsllhvvs  258
            KPL   EQ  LLSIK++ T D Q++L+SWN +T+HCTW  VTC          +   V+S
Sbjct  21   KPLQ-DEQKVLLSIKSSITDDPQNTLSSWNTTTNHCTWPFVTCSHHHHSPTNTTTSTVIS  79

Query  259  ldlsglNLSGVLS-PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
            LD+S LNL+G+LS  ++  L  L  LS+A N  SG +PP +S +S LR+LNLS+NIF  T
Sbjct  80   LDISSLNLTGILSLSNISLLTNLQKLSVADNYFSGQIPPSLSLLSNLRYLNLSDNIFNGT  139

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            FP  L+    L +LD+YNN LTG LP+ V  MT LRHL LG NYF G++P
Sbjct  140  FP-SLSSFKRLTILDVYNNYLTGSLPLSVINMTKLRHLDLGSNYFYGKLP  188


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 48/106 (45%), Gaps = 4/106 (4%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +   L  L ++ NQL G VP  +S    L FLNL NN+    FP  L  L
Sbjct  390  LTGTIPTSFTKCDSLKYLDLSYNQLEGVVPKSLSQCQNLSFLNLENNMLKDKFPSWLESL  449

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMT----SLRHLHLGGNYFSGRIP  585
              LQVL L  N+  G L     K+      ++   L  N F G +P
Sbjct  450  PQLQVLSLSYNSFHGLLLTSSSKVKHPFPKIQIFDLSNNKFCGELP  495


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L    GQL  L N  +  N L G +PPE+  +  L  L L +N F    P +L  L  
Sbjct  185  GKLPSGYGQLKNLKNFYVDQNNLVGEIPPELGKLEKLDSLFLWSNYFSGDIPSELGSLKT  244

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  +DL NN L+G++P     +  L  L+L  N   G IP
Sbjct  245  LISMDLSNNTLSGEIPRSFSLLKKLNFLNLFQNKLQGVIP  284



>ref|XP_008790445.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=1019

 Score =   144 bits (362),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 108/153 (71%), Gaps = 5/153 (3%)
 Frame = +1

Query  142  SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl--lhvvsldlsglNLSGVLSPDVG  309
            S+K+A + D  ++L  WN S    HC+W  V CD+     V+SLDL+GLNLSG L P V 
Sbjct  42   SLKSALS-DPGAALAGWNASAYPDHCSWPGVACDNAPLRRVISLDLTGLNLSGSLPPAVA  100

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             L  L+NLS AAN LSGP+PPE+S +  LR LNLSNN+F  +FP  L +L +L+VLDLYN
Sbjct  101  HLRHLLNLSAAANLLSGPIPPELSLLFDLRHLNLSNNVFNGSFPSALRRLKHLEVLDLYN  160

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NNLTG LP E   + +LRHLHLGGN+FSG IPP
Sbjct  161  NNLTGVLPAEAADLPNLRHLHLGGNFFSGVIPP  193


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +PPE+  + +L+ ++LSNN F    P   A L
Sbjct  260  LSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADL  319

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  320  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIP  361


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  NQ SG +P EI  +  L  ++ S+N F    P ++++ 
Sbjct  478  LSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQLSKVDFSSNSFSGGIPPEMSKC  537

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  +DL  NNL+G++P E+  M  L +L+L  N+  G IPP
Sbjct  538  KLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPP  580


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N  +G +PP  + +  L  LNL  N    T P  +  L
Sbjct  284  LSGELPPELGRLRSLKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  343

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  344  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPP  386


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L G + P++G L  L  L I   N   G +PPE   +S L   + +N       P +L +
Sbjct  211  LGGAIPPEIGNLTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPPELGR  270

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  N L+G+LP E+ ++ SL+ + L  N F+G IPP
Sbjct  271  LENLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNAFTGEIPP  314


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/99 (36%), Positives = 54/99 (55%), Gaps = 3/99 (3%)
 Frame = +1

Query  298  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G     P L  +S++ N+LSGP+PP I   S ++ L L+ N F    P ++ +L  L
Sbjct  457  PDTGNASISPSLGQISLSNNRLSGPLPPCIGNFSGVQKLLLNQNQFSGRIPTEIGRLQQL  516

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +D  +N+ +G +P E+ K   L  + LG N  SG IP
Sbjct  517  SKVDFSSNSFSGGIPPEMSKCKLLTFVDLGRNNLSGEIP  555


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  +   LP L +L +  N  SG +PPE      L +L +S N  G   P ++  
Sbjct  162  NLTGVLPAEAADLPNLRHLHLGGNFFSGVIPPEYGRWEHLEYLAVSGNELGGAIPPEIGN  221

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+ L + Y N+  G +P E  K+++L          SG IPP
Sbjct  222  LTRLRQLYIGYFNSYDGGIPPEFGKLSALVRFDAANCGLSGEIPP  266


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G+L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  238  GGIPPEFGKLSALVRFDAANCGLSGEIPPELGRLENLDTLFLQVNGLSGELPPELGRLRS  297

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN  TG++P     + +L  L+L  N   G IP
Sbjct  298  LKSMDLSNNAFTGEIPPTFADLRNLTLLNLFRNKLYGTIP  337


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P++ +   L  + +  N LSG +P EI+ +  L +LNLS N    + P  +A 
Sbjct  525  SFSGGIPPEMSKCKLLTFVDLGRNNLSGEIPGEIAGMRILNYLNLSRNHLEGSIPPSIAT  584

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  585  MQSLTAVDFSYNNLSGLVP  603



>ref|XP_010936307.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Elaeis guineensis]
Length=1007

 Score =   143 bits (361),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 91/158 (58%), Positives = 114/158 (72%), Gaps = 5/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTS--HCTWRRVTCdsl--lhvvsldlsglNLSGV  291
            E+ ALLS+K+A + D  ++L  WN S +  HC+W  V CD      V++LDLSGLNLSG 
Sbjct  33   ERVALLSLKSALS-DPGAALAGWNASANPDHCSWPGVACDDAPLRRVIALDLSGLNLSGS  91

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P V  L  L+NLS AAN LSGP+P ++S +S LR+LNLSNN+F  +FP  L +L NL+
Sbjct  92   LPPAVAHLRHLLNLSTAANLLSGPIPLDLSLLSDLRYLNLSNNVFNGSFPSALRRLKNLE  151

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            VLDLYNNNLTG LP EV  + +LRHLHLGGN+FSG IP
Sbjct  152  VLDLYNNNLTGILPAEVADLHNLRHLHLGGNFFSGVIP  189


 Score = 77.0 bits (188),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  NQ SG +PPEI  +  L  ++ S+N F S  P ++++ 
Sbjct  475  LSGPLPPSIGNFSGVQKLLLNQNQFSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  +DL  NNL+GD+P E+  M  L +L+L  N+  G IPP
Sbjct  535  KLLTFVDLSRNNLSGDIPAEIAGMRILNYLNLSRNHLEGSIPP  577


 Score = 70.1 bits (170),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   A L
Sbjct  257  LSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADL  316

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  +  L  L L  N F+G IP
Sbjct  317  RNLTLLNLFRNKLYGTIPDFIGDLPELEVLQLWDNNFTGIIP  358


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N    T P  +  L
Sbjct  281  LSGELPPELGRLRSLKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIPDFIGDL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L++NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  341  PELEVLQLWDNNFTGIIPRGIGRSGKLQLLDLSSNKLTGDLPP  383


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L +   N   G +PPEI  +S L   + +N       P +L  
Sbjct  208  LSGAIPPEIGNLTRLRQLYVGYFNSYDGGIPPEIGHLSALVRFDAANCGLSGQIPPELGH  267

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L  L L  N L+G+LP E+ ++ SL+ + L  N  +G IPP
Sbjct  268  LEHLDTLFLQVNGLSGELPPELGRLRSLKSMDLSNNALTGEIPP  311


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  ++N+ S  +PPEIS    L F++LS N      P ++A +
Sbjct  499  FSGRIPPEIGRLQQLSKVDFSSNRFSSGIPPEISKCKLLTFVDLSRNNLSGDIPAEIAGM  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  559  RILNYLNLSRNHLEGSIPPSISTMQSLTAVDFSYNNLSGLVP  600


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV    A   LSG +PPE+  +  L  L L  N      P +L +L +
Sbjct  235  GGIPPEIGHLSALVRFDAANCGLSGQIPPELGHLEHLDTLFLQVNGLSGELPPELGRLRS  294

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  295  LKSMDLSNNALTGEIPPTFADLRNLTLLNLFRNKLYGTIP  334



>ref|XP_009396449.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1006

 Score =   141 bits (355),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 84/146 (58%), Positives = 105/146 (72%), Gaps = 3/146 (2%)
 Frame = +1

Query  160  TADSQSSLTSWNISTS--HCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D   +L++WN S S  HC+W  V CD     VVSLDL+G NLSG LS  V +L  L+N
Sbjct  43   VSDPSDALSAWNNSASGGHCSWPGVACDPLRGFVVSLDLTGFNLSGTLSLAVVRLRHLLN  102

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            LS A+N LSGP+P E+S +S LR LNLSNN+F  +FP  + +L NL VLD+YNNNLTG L
Sbjct  103  LSAASNSLSGPIPAELSRLSNLRHLNLSNNLFNGSFPSAIVRLKNLLVLDIYNNNLTGPL  162

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P EV ++ +LRHLHLGGN+FSG IPP
Sbjct  163  PAEVSELPNLRHLHLGGNFFSGVIPP  188


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SGV+ P  G+  FL  L+++ N+L GP+PPE+  ++ LR L L   N F    P ++  
Sbjct  182  FSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYLGYFNNFEGGIPPEIGG  241

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  LD+ N  LTG++P E+  + +L  L L  N  SGR+P
Sbjct  242  LPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLP  284


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  L  + N+ SGP+ PEIS    L F++LS N      P ++A +
Sbjct  497  FSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPPEIAGM  556

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N  SG +P
Sbjct  557  RILNYLNLSRNQLEGSIPASIATMQSLTAVDFSYNNLSGLVP  598


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G L  L  L +  NQ SG +PPE+  +  L  L+ S N F      ++++ 
Sbjct  473  LSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQQLSKLDFSGNRFSGPIAPEISRC  532

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G+LP E+  M  L +L+L  N   G IP
Sbjct  533  KLLTFVDLSRNELSGELPPEIAGMRILNYLNLSRNQLEGSIP  574


 Score = 65.9 bits (159),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  230  NFEGGIPPEIGGLPELVRLDMANCGLTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGR  289

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  290  LRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIP  332


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L +  N LSG +P E+  + +L+ ++LSNN      P   A L
Sbjct  255  LTGEIPPELGNLQNLDTLFLQVNGLSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP
Sbjct  315  QNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIP  356


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 6/102 (6%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+GQ+      S++ N+LSGP+PP I  ++ L+ L L+ N F    P ++ +L 
Sbjct  456  AAAISPDLGQI------SLSNNRLSGPLPPSIGNLTGLQKLLLNQNQFSGRIPPEMGRLQ  509

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             L  LD   N  +G +  E+ +   L  + L  N  SG +PP
Sbjct  510  QLSKLDFSGNRFSGPIAPEISRCKLLTFVDLSRNELSGELPP  551


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 52/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V +LP L +L +  N  SG +PP       L +L +S N  G   P +L  
Sbjct  157  NLTGPLPAEVSELPNLRHLHLGGNFFSGVIPPVFGRWEFLEYLAVSGNELGGPIPPELGN  216

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+ L L Y NN  G +P E+  +  L  L +     +G IPP
Sbjct  217  LTRLRQLYLGYFNNFEGGIPPEIGGLPELVRLDMANCGLTGEIPP  261


 Score = 58.2 bits (139),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G+L  L ++ ++ N L+G +P   + +  L  LNL  N    + P  +  L
Sbjct  279  LSGRLPVELGRLRSLKSMDLSNNALTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP
Sbjct  339  PALEVLQLWENNFTGGIPRRLGQSGRLQIVDLSSNKLTGTLPP  381


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  +  +  L  L L  N F    P +L Q 
Sbjct  303  LTGEIPSSFADLQNLTLLNLFRNKLHGSIPEFVGDLPALEVLQLWENNFTGGIPRRLGQS  362

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ++DL +N LTG LP ++     L+ L   GN+  G IP
Sbjct  363  GRLQIVDLSSNKLTGTLPPDLCFGNKLQTLIALGNFLFGPIP  404


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 52/130 (40%), Gaps = 26/130 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L+G L PD+     L  L    N L GP+P  +    +L  + +  N    + PH L  
Sbjct  374  KLTGTLPPDLCFGNKLQTLIALGNFLFGPIPETLGRCESLGRIRMGENYLNGSIPHGLFS  433

Query  457  LANLQVLDLY--------------------------NNNLTGDLPVEVYKMTSLRHLHLG  558
            L  L  L+L                           NN L+G LP  +  +T L+ L L 
Sbjct  434  LPKLSQLELQDNLLTGGFPDTGAAAISPDLGQISLSNNRLSGPLPPSIGNLTGLQKLLLN  493

Query  559  GNYFSGRIPP  588
             N FSGRIPP
Sbjct  494  QNQFSGRIPP  503



>dbj|BAJ84911.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96166.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1020

 Score =   138 bits (348),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 93/143 (65%), Gaps = 2/143 (1%)
 Frame = +1

Query  166  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldl-sglNLSGVLSPDVGQLPFLVNLSI  339
            D   SL SW N ST  C W  V+CD     V     SG NLSG +     +LP+L  L++
Sbjct  37   DPTGSLASWSNASTGPCAWSGVSCDGRSGAVVGVDLSGRNLSGAVPRAFSRLPYLARLNL  96

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  519
            AAN LSGP+PP +S +  L +LNLS+N+   +FP  LA+L  L+VLDLYNNN TG LP+E
Sbjct  97   AANSLSGPIPPSLSRLGLLTYLNLSSNLLNGSFPPPLARLRALRVLDLYNNNFTGSLPLE  156

Query  520  VYKMTSLRHLHLGGNYFSGRIPP  588
            V  M  LRHLHLGGN+FSG IPP
Sbjct  157  VVGMAQLRHLHLGGNFFSGEIPP  179


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 52/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  +V  +  L +L +  N  SG +PPE      L++L +S N      P +L  
Sbjct  148  NFTGSLPLEVVGMAQLRHLHLGGNFFSGEIPPEYGRWGRLQYLAVSGNELSGKIPPELGN  207

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y NN +G +P E+  MT L  L       SG IPP
Sbjct  208  LTSLRQLYIGYYNNYSGGIPAELGNMTELVRLDAANCGLSGEIPP  252


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PP +  + +L  L+LSNN      P     L
Sbjct  246  LSGEIPPELGNLAKLDTLFLQVNGLTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVAL  305

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL + +L+ N L GD+P  V  +  L  L L  N F+G IP
Sbjct  306  KNLTLFNLFRNRLRGDIPQFVGDLPGLEVLQLWENNFTGGIP  347


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G +  ++G+   L  L ++ N+LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  510  SFDGGVPSEIGKCRLLTYLDVSQNKLSGDIPPAISGMRILNYLNLSRNQLDGEIPVTIAA  569

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +PV
Sbjct  570  MQSLTAVDFSYNNLSGLVPV  589


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +G+L  L +L ++ N LSG +P    A+  L   NL  N      P  +  L
Sbjct  270  LTGGIPPVLGRLGSLSSLDLSNNALSGEIPATFVALKNLTLFNLFRNRLRGDIPQFVGDL  329

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG +P  + +    + L L  N  +G +PP
Sbjct  330  PGLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPP  372


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIS-TLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP L  + +  N LSG  P  +SA    L  ++LSNN    + P  +  
Sbjct  414  LNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSAGGPNLGGISLSNNQLTGSLPASIGS  473

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             + LQ L L  N  TG +P E+ ++  L    L GN F G +P
Sbjct  474  FSGLQKLLLDQNAFTGAIPPEIGRLQQLSKADLSGNSFDGGVP  516


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-A  453
            +L G +   +G+   L  + +  N L+G +P  +  +  L  + L +N+   +FP  + A
Sbjct  389  SLFGPIPDSLGKCKALTRVRLGENFLNGSIPEGLFELPNLTQVELQDNLLSGSFPAVVSA  448

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
               NL  + L NN LTG LP  +   + L+ L L  N F+G IPP
Sbjct  449  GGPNLGGISLSNNQLTGSLPASIGSFSGLQKLLLDQNAFTGAIPP  493



>ref|XP_008787754.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Phoenix dactylifera]
Length=990

 Score =   136 bits (343),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 79/171 (46%), Positives = 101/171 (59%), Gaps = 27/171 (16%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A AG+   V E  ALL +KAA +     S   W+ +  HC +W  V CD+     
Sbjct  15   RPSAAADAGEVTAV-EHRALLDVKAA-SGSPSGSFAGWDATADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            FP  L+ L NL+VLD+YNNNLTG LPV+V  + +LRHLHLGGN+FSG IPP
Sbjct  109  FPSALSSLKNLRVLDIYNNNLTGVLPVDVADLPALRHLHLGGNFFSGAIPP  159


 Score = 77.8 bits (190),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P + ++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLGQNQFSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP
Sbjct  501  KLLTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIP  542


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L G + PE+  + +L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGNLQNLDTLFLQVNGLFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP
Sbjct  286  KNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIP  327


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LFGEITPELGKLRSLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP
Sbjct  310  PQLEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPP  352


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ S P+P E S    L F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGKLQQLSKMDFSGNRFSCPIPAETSKCKLLTFIDLSRNNLSGEIPVEITEM  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNNLSGLVP  566


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+GVL  DV  LP L +L +  N  SG +PPE      + +L +S N  G     +L  
Sbjct  128  NLTGVLPVDVADLPALRHLHLGGNFFSGAIPPEYGRWEHIEYLAISGNELGGPITPELGN  187

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+  G LP  +  +TSL  L       SG IPP
Sbjct  188  LTSLRELYIGYFNSYQGSLPAAIGNLTSLVRLDAANCGLSGEIPP  232


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LAGEIPPTFADLKNLTLLNLFRNKLYGAIPDFVGDLPQLEVLQLWENNFTGEIPRRLGTN  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP ++     L+ L   GN+  G IP
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLQTLIALGNFLFGSIP  375


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 53/101 (52%), Gaps = 2/101 (2%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQLA  462
            G L   +G L  LV L  A   LSG +PPE+  +  L  L L  N +FG   P +L +L 
Sbjct  204  GSLPAAIGNLTSLVRLDAANCGLSGEIPPEMGNLQNLDTLFLQVNGLFGEITP-ELGKLR  262

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ +DL NN L G++P     + +L  L+L  N   G IP
Sbjct  263  SLKSMDLSNNALAGEIPPTFADLKNLTLLNLFRNKLYGAIP  303


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G+   L  + +  N L+G +P  + ++  L  + L +N+   +FP + A  
Sbjct  370  LFGSIPESLGRCKSLSRIRLGENYLTGSIPIGLFSLRNLVQVELQDNLLNGSFPEK-ASS  428

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  + L NN L+G LP  +     L+ L LG N FSG IPP
Sbjct  429  PTLGQISLSNNRLSGALPSSIGNFPGLQKLLLGQNQFSGCIPP  471



>ref|XP_008440463.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Cucumis melo]
Length=973

 Score =   136 bits (342),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 84/157 (54%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  LS
Sbjct  39   ESQALLSLKSSISDDPHSSLSSWNPAAVATHCSWLGVTCDSHRHVVALDLSSLDLTATLS  98

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N+ SG +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  99   PHIASLRFLTNVSFGLNKFSGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  158

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            D+YNNNLTG+ P  V +M +LR+LHLGGN+F+GRIPP
Sbjct  159  DVYNNNLTGEFPRVVTEMPNLRYLHLGGNFFTGRIPP  195


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 55/103 (53%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L+L +N      P  +A L
Sbjct  286  LSGPLM-ELGGLKSIEALDISCNMLVGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADL  344

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPP
Sbjct  345  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPP  387


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 7/100 (7%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  455  GELPITNSVSANLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSSIGRLQQ  514

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  ++   N  +G +  E+ +   L  L L GN  SG IP
Sbjct  515  LSRINFSQNKFSGSIVAEISECKHLIFLDLSGNELSGEIP  554


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 50/101 (50%), Gaps = 7/101 (7%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  310  VGEIPISFAVFKNLRLLHLFDNKLSGEIPGFMADLPKLEILQLWNNNFTGSIPRNLGKNG  369

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L+ LDL  N+LTG +P EV     L  L   GN  SG IP
Sbjct  370  MLRTLDLAFNHLTGTIPPEVCHGNKLEVLIAMGNSLSGLIP  410


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P+V     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  380  HLTGTIPPEVCHGNKLEVLIAMGNSLSGLIPESLGNCISLKRILLWGNALNGSIPKRLLG  439

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP
Sbjct  440  LPNITQIDLHDNFLSGELPITNSVSANLLQISLSNNMLSGSLPP  483



>ref|XP_004160944.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1-like [Cucumis sativus]
Length=984

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPP
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPP  197


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPP
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPP  389


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 7/100 (7%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  ++   N  +G +  E+ +   L  L L GN  SG IP
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIP  556


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L+ LDL  N+LTG +P E+     L  L    N  SG IP
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIP  412


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPP  485



>ref|XP_004143533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Cucumis sativus]
 gb|KGN48656.1| Receptor-like protein kinase 3 [Cucumis sativus]
Length=984

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/157 (53%), Positives = 117/157 (75%), Gaps = 2/157 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALLS+K++ + D  SSL+SWN +   +HC+W  VTCDS  HVV+LDLS L+L+  +S
Sbjct  41   ESQALLSLKSSISDDPHSSLSSWNPAAVHAHCSWLGVTCDSRRHVVALDLSSLDLTATIS  100

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +  L FL N+S   N++ G +PPEI+++S+L+ LNLS+N+   + P + ++L NLQVL
Sbjct  101  PHISSLRFLTNVSFGLNKIFGGIPPEIASLSSLQLLNLSSNVLNGSIPSEFSRLKNLQVL  160

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            D+YNNNLTGD P  V +M +LR+LHLGGN+F+GRIPP
Sbjct  161  DVYNNNLTGDFPRVVTEMPNLRYLHLGGNFFTGRIPP  197


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L  ++G L  +  L I+ N L G +P   +    LR L L +N      P  +A L
Sbjct  288  LSGSLM-ELGGLKSIEELDISCNMLVGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADL  346

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L++L L+NNN TG +P  + K   LR L L  N+ +G IPP
Sbjct  347  PKLEILQLWNNNFTGSIPRNLGKNGMLRTLDLAFNHLTGTIPP  389


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 49/100 (49%), Gaps = 7/100 (7%)
 Frame = +1

Query  307  GQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G+LP        L+ +S++ N LSG +PP I ++  ++ L L  N F    P  + +L  
Sbjct  457  GELPIINSVSVNLLQISLSNNMLSGSLPPTIGSLVAVQKLLLDRNKFSGQIPSNIGRLQQ  516

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  ++   N  +G +  E+ +   L  L L GN  SG IP
Sbjct  517  LSRINFSQNKFSGSIVPEISECKHLIFLDLSGNELSGEIP  556


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 49/101 (49%), Gaps = 7/101 (7%)
 Frame = +1

Query  304  VGQLPF-------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            VG++P        L  L +  N+LSG +P  ++ +  L  L L NN F  + P  L +  
Sbjct  312  VGEIPISFAVFKNLRLLQLFDNKLSGEIPEFMADLPKLEILQLWNNNFTGSIPRNLGKNG  371

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L+ LDL  N+LTG +P E+     L  L    N  SG IP
Sbjct  372  MLRTLDLAFNHLTGTIPPEICHGNKLEVLIAMDNSLSGLIP  412


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++     L  L    N LSG +P  +    +L+ + L  N    + P +L  
Sbjct  382  HLTGTIPPEICHGNKLEVLIAMDNSLSGLIPESLGNCLSLKRILLWGNALNGSIPRRLLG  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L N+  +DL++N L+G+LP+      +L  + L  N  SG +PP
Sbjct  442  LPNITQIDLHDNFLSGELPIINSVSVNLLQISLSNNMLSGSLPP  485



>ref|XP_009411355.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1009

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 87/146 (60%), Positives = 108/146 (74%), Gaps = 3/146 (2%)
 Frame = +1

Query  160  TADSQSSLTSWNIS--TSHCTWRRVTCd-sllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
             +D  +SL++WN S    HC+W  V CD     VVSLDL+G NLSG L P VG+L  L+N
Sbjct  41   VSDPSASLSAWNSSAGVGHCSWPGVGCDPIQGSVVSLDLTGFNLSGSLFPAVGRLRHLLN  100

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            LS A+N LSGP+P EIS +++LR LNLSNN+   +FP  LA+L NL VLDLYNNNLTG L
Sbjct  101  LSAASNSLSGPIPAEISRLASLRHLNLSNNLLNGSFPSALARLKNLLVLDLYNNNLTGPL  160

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            PVEV ++ +LRHLHLGGN+F+G IPP
Sbjct  161  PVEVAQLPNLRHLHLGGNFFTGVIPP  186


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 61/104 (59%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +GV+ P+ G+  FL  L+++ N+L GP+PPE+  ++ LR L +   N F    P ++  
Sbjct  180  FTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGNLTRLRQLYVGYFNSFEGGIPPEIGS  239

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  LD+ N  L G++P E++K+ +L  L L  N  +G IPP
Sbjct  240  LPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPP  283


 Score = 65.5 bits (158),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++ +L  L  L +  N L+G +PPE+  + +L+ ++LSNN      P   A L
Sbjct  253  LNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  + ++ +L  L L  N F+G IP
Sbjct  313  ENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIP  354


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G LP LV L +A   L+G +PPE+  +  L  L L  N      P +L +
Sbjct  228  SFEGGIPPEIGSLPALVRLDMANCGLNGEIPPELWKLQNLDTLFLQVNGLAGDIPPELGR  287

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  288  LRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIP  330


 Score = 64.3 bits (155),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             S  + P++G+L  L  +  + N+ SGP+ PEIS    L F++LS N      P ++A++
Sbjct  495  FSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPPEIARM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G +P  +  M SL  +    N  SG +P
Sbjct  555  RILNYLNLSRNQLEGGIPPSIATMQSLTAVDFSYNKLSGHVP  596


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P +G    +  L +  NQ S  +PPEI  +  L  ++ S N F      ++++ 
Sbjct  471  LSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQELSKVDFSGNRFSGPITPEISRC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  +DL  N L+G++P E+ +M  L +L+L  N   G IPP
Sbjct  531  KLLTFVDLSRNELSGEIPPEIARMRILNYLNLSRNQLEGGIPP  573


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L  +V QLP L +L +  N  +G +PPE      L +L +S N  G   P +L  
Sbjct  155  NLTGPLPVEVAQLPNLRHLHLGGNFFTGVIPPEFGRWEFLEYLAVSGNELGGPIPPELGN  214

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+ L + Y N+  G +P E+  + +L  L +     +G IPP
Sbjct  215  LTRLRQLYVGYFNSFEGGIPPEIGSLPALVRLDMANCGLNGEIPP  259


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L ++ ++ N L+G +P   + +  L  LNL  N      P  + +L
Sbjct  277  LAGDIPPELGRLRSLKSMDLSNNALTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGEL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L+ NN TG +P ++ +   L+ L L  N  +G +P
Sbjct  337  PALEVLQLWENNFTGGIPRQLGRSGRLQLLDLSSNKLTGTLP  378


 Score = 55.5 bits (132),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +  +SPD+G+    +NLS   N+LSG +PP I   S ++ L L+ N F    P ++ +L 
Sbjct  454  AAAISPDLGE----INLS--NNRLSGSIPPSIGNYSGVQKLLLNQNQFSDRIPPEIGRLQ  507

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             L  +D   N  +G +  E+ +   L  + L  N  SG IPP
Sbjct  508  ELSKVDFSGNRFSGPITPEISRCKLLTFVDLSRNELSGEIPP  549


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L++  N+L G +P  I  +  L  L L  N F    P QL + 
Sbjct  301  LTGEIPATFADLENLTLLNLFRNKLRGLIPEFIGELPALEVLQLWENNFTGGIPRQLGRS  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP  +    +L  +   GN+  G IP
Sbjct  361  GRLQLLDLSSNKLTGTLPTGLCSENTLETVIALGNFLFGPIP  402



>ref|XP_006650665.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Oryza brachyantha]
Length=1021

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 99/146 (68%), Gaps = 4/146 (3%)
 Frame = +1

Query  163  ADSQSSLTSW----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVN  330
            +D   +L SW    N STSHC+W  VTC S   VV LD+SG NLSG L  ++ +L  L+ 
Sbjct  32   SDPTGALASWGNGTNTSTSHCSWAGVTCSSRGTVVGLDVSGFNLSGALPAELSRLRGLLR  91

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L++ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  L
Sbjct  92   LAVGANAFSGPIPGSLGRLQFLTYLNLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPL  151

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P+EV +M  LRHLHLGGN+FSG IPP
Sbjct  152  PMEVVQMPLLRHLHLGGNFFSGEIPP  177


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  461  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKC  520

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP
Sbjct  521  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPP  563


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++GQL  L    +++N   G VPPEI     L +L+LS N      P  ++ 
Sbjct  484  SFSGVVPPEIGQLQQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  543

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  544  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  586


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SGV +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ QL
Sbjct  443  VSGVAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGQL  496

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L   DL +N   G +P E+ K   L +L L  N  SG+IPP
Sbjct  497  QQLSKADLSSNAFEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  539


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  244  LSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  303

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  304  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  345


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  146  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGRIPPELGN  205

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  206  LTSLRELYIGYYNSYSGGLPPELGNLTELIRLDAANCGLSGEIPP  250


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  292  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  351

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP
Sbjct  352  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIP  393


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  L+ L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  221  SGGLPPELGNLTELIRLDAANCGLSGEIPPELGKLQNLDTLFLQVNGLTGGIPSELGYLK  280

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  281  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIP  321



>ref|NP_001058840.2| Os07g0134200 [Oryza sativa Japonica Group]
 dbj|BAF20754.2| Os07g0134200 [Oryza sativa Japonica Group]
Length=883

 Score =   131 bits (329),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPP
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPP  184


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIP  352


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIP  569


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G++P  +  M SL  +    N  SG +P
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVP  593


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L   
Sbjct  323  LRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAG  382

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+ L    N+L G +P  + K TSL  + LG NY +G IP
Sbjct  383  GKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIP  424


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIP  304


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPP  377



>gb|EAZ02682.1| hypothetical protein OsI_24796 [Oryza sativa Indica Group]
Length=1023

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPP
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPP  184


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIP  352


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIP  569


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G++P  +  M SL  +    N  SG +P
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVP  593


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L+ L    N+L G +P  + K TSL  + LG NY +G IP
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIP  424


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIP  304


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPP  377



>dbj|BAC82955.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 dbj|BAD30615.1| putative OsLRK1(receptor-type protein kinase) [Oryza sativa Japonica 
Group]
 gb|EAZ38608.1| hypothetical protein OsJ_22997 [Oryza sativa Japonica Group]
 dbj|BAH01666.1| unnamed protein product [Oryza sativa Japonica Group]
Length=1023

 Score =   131 bits (329),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 84/159 (53%), Positives = 104/159 (65%), Gaps = 5/159 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP+EV  M  LRHLHLGGN+FSG IPP
Sbjct  146  VLDLYNNNLTGALPLEVVSMAQLRHLHLGGNFFSGGIPP  184


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +P E+  +++L  L+LSNN      P   A L
Sbjct  251  LSGEIPPELGNLANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIPATFADL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G IP
Sbjct  311  KNLTLLNLFRNKLRGDIPEFVGDLPSLEVLQLWENNFTGGIP  352


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N F    P ++ + 
Sbjct  468  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N   G IP
Sbjct  528  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIP  569


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N   G VPPEI     L +L+LS N      P  ++ +
Sbjct  492  FTGEIPPEIGRLQQLSKADLSGNSFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L G++P  +  M SL  +    N  SG +P
Sbjct  552  RILNYLNLSRNQLDGEIPATIAAMQSLTAVDFSYNNLSGLVP  593


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SFDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAA  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +P 
Sbjct  575  MQSLTAVDFSYNNLSGLVPA  594


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
             L G +   VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L  
Sbjct  322  KLRGDIPEFVGDLPSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPPDLCA  381

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L+ L    N+L G +P  + K TSL  + LG NY +G IP
Sbjct  382  GGKLETLIALGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIP  424


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  
Sbjct  202  LSGKIPPELGNLTSLRELYIGYFNSYSGGIPPELGNMTDLVRLDAANCGLSGEIPPELGN  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LANL  L L  N L G +P E+ K+ SL  L L  N  +G IP
Sbjct  262  LANLDTLFLQVNGLAGGIPRELGKLASLSSLDLSNNALAGEIP  304


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G+L  L +L ++ N L+G +P   + +  L  LNL  N      P  +  L
Sbjct  275  LAGGIPRELGKLASLSSLDLSNNALAGEIPATFADLKNLTLLNLFRNKLRGDIPEFVGDL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +    + L L  N  +G +PP
Sbjct  335  PSLEVLQLWENNFTGGIPRRLGRNGRFQLLDLSSNRLTGTLPP  377



>tpg|DAA59489.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1037

 Score =   129 bits (325),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/144 (52%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  336
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG +   + +L  L  L 
Sbjct  45   SDPAGALASWTNATSTGACAWSGVTCNARAAVIGLDLSGRNLSGPVPTALSRLAHLARLD  104

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            +AAN L GP+P  +S + +L  LNLSNN+   TFP  LA+L  L+VLDLYNNNLTG LP+
Sbjct  105  LAANALCGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPLARLRALRVLDLYNNNLTGPLPL  164

Query  517  EVYKMTSLRHLHLGGNYFSGRIPP  588
             V  +  LRHLHLGGN+FSG IPP
Sbjct  165  AVVGLPVLRHLHLGGNFFSGEIPP  188


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G+   L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  472  LTGALPASIGKFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKC  531

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP
Sbjct  532  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLGGEIP  573


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G   P + +L  L  L +  N L+GP+P  +  +  LR L+L  N F    P +  + 
Sbjct  134  LNGTFPPPLARLRALRVLDLYNNNLTGPLPLAVVGLPVLRHLHLGGNFFSGEIPPEYGRW  193

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLG-GNYFSGRIPP  588
              LQ L +  N L+G +P E+  +T+LR L++G  N +S  +PP
Sbjct  194  RRLQYLAVSGNELSGRIPPELGGLTTLRELYIGYYNSYSSGLPP  237


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  255  LSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAAL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP
Sbjct  315  RNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIP  356


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  496  FTGAVPPEIGRLQQLSKADLSGNTLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  555

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  556  RILNYLNLSRNHLGGEIPATIAAMQSLTAVDFSYNNLSGLVP  597


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  279  LAGAIPPELGRLKSLSSLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIPELVGDL  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP
Sbjct  339  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPP  381


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 37/98 (38%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L +L 
Sbjct  235  LPPELGNMTDLVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGAIPPELGRLKSLS  294

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             LDL NN LTG++P     + +L  L+L  N   G IP
Sbjct  295  SLDLSNNALTGEIPASFAALRNLTLLNLFRNKLRGSIP  332



>ref|XP_002985227.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
 gb|EFJ13721.1| hypothetical protein SELMODRAFT_121783 [Selaginella moellendorffii]
Length=1023

 Score =   129 bits (323),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 99/160 (62%), Gaps = 3/160 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            G  +++ALL++KAA   DS  SL  W     + C W  +TCD  L  V        NLSG
Sbjct  22   GFQDKSALLALKAAMI-DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSG  80

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            + S  +G+L  L+NL++  N  +G +P E++ +  L FLN+S+N F   FP + + L  L
Sbjct  81   IFSSSIGRLTELINLTLDVNNFTGNLPSELATLHDLHFLNVSHNTFTGDFPGRFSNLQLL  140

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +VLD YNNN +G LP+E+ ++ +LRHLHLGG+YF G IPP
Sbjct  141  EVLDAYNNNFSGPLPIELSRLPNLRHLHLGGSYFEGEIPP  180


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  247  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  306

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL++L L+ N L+G++P  V  + +L+ L L  N F+G +P
Sbjct  307  QNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELP  348


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  222  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  281

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+ LDL NNNLTG +P+E+ K+ +L  L L  N  SG IP
Sbjct  282  LVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIP  324


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  270  HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  329

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NLQ L L+ NN TG+LP  + +  +L  L +  N  +G +PP
Sbjct  330  LPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPP  373


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  L++  N L GP+PPE+  +  L  L L   N F    P +L +
Sbjct  174  FEGEIPPSYGNMTSLSYLALCGNCLVGPIPPELGYLVGLEELYLGYFNHFTGGIPPELGR  233

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NLQ LD+ +  L G +P E+  +++L  L L  N+ SG IPP
Sbjct  234  LLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPP  277


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V +LP L  L + +NQ  G +P E+  +S L  L+L +N      P +LAQ 
Sbjct  462  LQGSIPAGVARLPSLQKLFLHSNQFVGGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQC  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + L  LD+ +N LTG +P E+  M  L  L++  N  SG IPP
Sbjct  522  SKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNRLSGGIPP  564


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++GQL  L++L + +N+LSG +P E++  S L +L++S+N      P +L  +  
Sbjct  488  GGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEV  547

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L++L++  N L+G +P ++    SL       N FSG +P
Sbjct  548  LELLNVSRNRLSGGIPPQILGQESLTSADFSYNDFSGTVP  587


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++ +L  L  LS+  N LSG +P  ++ +  L+ L L  N F    P +L +
Sbjct  294  NLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGE  353

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              NL  LD+ +N LTG LP  + K   L  L L  N  +G IPP
Sbjct  354  NMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIENGITGTIPP  397


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   V  LP L  L +  N  +G +P  +     L  L++S+N      P  L + 
Sbjct  319  LSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKG  378

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L  N +TG +P  +    SL  + L GN+ +G IP
Sbjct  379  GQLEVLVLIENGITGTIPPALGHCKSLIKVRLAGNHLTGPIP  420



>ref|XP_004955422.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1030

 Score =   128 bits (322),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 2/139 (1%)
 Frame = +1

Query  178  SLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
            +L SW  N + S C W  VTC++   V+ +DLSG NLSG +   + +LP L  L +AAN 
Sbjct  48   ALASWTANATASPCAWSGVTCNARGAVIGVDLSGRNLSGPVPAALSRLPHLARLDLAANA  107

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKM  531
             SGP+P  ++ +  L  LNLSNN+   TFP  LA+L  L+V+DLYNNNLTG LP+ V  +
Sbjct  108  FSGPIPTPLARLRYLTHLNLSNNVLNGTFPPPLARLRALRVVDLYNNNLTGPLPLGVAAL  167

Query  532  TSLRHLHLGGNYFSGRIPP  588
             +LRHLHLGGN+FSG IPP
Sbjct  168  PALRHLHLGGNFFSGEIPP  186


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAAL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  + SL  L L  N F+G IP
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPSLEVLQLWENNFTGGIP  354


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIP  571


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  494  FNGAVPPEIGRLQQLSKADLSGNSLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLVP  595


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  517  SLDGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIPATIAA  576

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D   NNL+G +P
Sbjct  577  MQSLTAVDFSYNNLSGLVP  595


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LAGGIPPELGRLRSLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +   L+ + L  N  +G +PP
Sbjct  337  PSLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPP  379


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 53/160 (33%), Positives = 73/160 (46%), Gaps = 15/160 (9%)
 Frame = +1

Query  109  PLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSG  288
            PLGV    AL  +          +  S  I   + TW R+          L +SG  LSG
Sbjct  161  PLGVAALPALRHLHLG------GNFFSGEIPPEYGTWGRLQ--------YLAVSGNELSG  206

Query  289  VLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
             + P++G L  L  L I   N  SG +PPE+  ++ L  L+ +N       P +L  LAN
Sbjct  207  RIPPELGNLTSLRELYIGYYNSYSGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLAN  266

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L L  N L G +P E+ ++ SL  L L  N  +G IP
Sbjct  267  LDTLFLQVNGLAGGIPPELGRLRSLSSLDLSNNALTGEIP  306


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG + P++G +  LV L  A   LSG +PPE+  ++ L  L L  N      P +L +L 
Sbjct  230  SGGIPPELGNMTELVRLDAANCGLSGEIPPELGNLANLDTLFLQVNGLAGGIPPELGRLR  289

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P     + +L  L+L  N   G IP
Sbjct  290  SLSSLDLSNNALTGEIPATFAALKNLTLLNLFRNKLRGSIP  330


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 49/104 (47%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   + +LP LV + +  N LSG  P    +A S L  + LSNN      P  +  
Sbjct  421  LNGSIPEGLFELPNLVQVELQDNLLSGGFPAVAGAAASNLGSITLSNNQLTGALPASIGN  480

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + LQ L L  N   G +P E+ ++  L    L GN   G +PP
Sbjct  481  FSGLQKLLLDQNAFNGAVPPEIGRLQQLSKADLSGNSLDGGVPP  524



>ref|XP_002466378.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
 gb|EER93376.1| hypothetical protein SORBIDRAFT_01g006690 [Sorghum bicolor]
Length=1030

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/142 (56%), Positives = 96/142 (68%), Gaps = 5/142 (4%)
 Frame = +1

Query  178  SLTSWNISTS-HCTWRRVTCd---sllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  345
            +L SW +++S HC W  VTC    S   VV LD+SGLNLSG L P + +L  L  LS+AA
Sbjct  46   ALASWGVASSDHCAWAGVTCAPRGSGGVVVGLDVSGLNLSGALPPALSRLRGLQRLSVAA  105

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLPVEV  522
            N   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP+EV
Sbjct  106  NGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSATLPLEV  165

Query  523  YKMTSLRHLHLGGNYFSGRIPP  588
              M  LRHLHLGGN+FSG IPP
Sbjct  166  THMPMLRHLHLGGNFFSGEIPP  187


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  471  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  530

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP
Sbjct  531  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPP  573


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  181  FSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTGGLPPELGN  240

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  LD  N  L+G++P E+ ++ +L  L L  N  +G IP
Sbjct  241  LTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIP  283


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ +
Sbjct  495  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISGM  554

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  555  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  596


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  254  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSEL  313

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  314  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  355


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/91 (34%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = +1

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  495
            P L  +S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  L   DL +N 
Sbjct  459  PNLGEISLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNK  518

Query  496  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              G +P E+ K   L +L +  N  SG+IPP
Sbjct  519  FEGGVPPEIGKCRLLTYLDMSQNNLSGKIPP  549


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P  L + 
Sbjct  302  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRSLGRN  361

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP
Sbjct  362  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIP  403


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  231  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLK  290

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  291  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIP  331


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  278  LTGSIPSELGYLKSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDL  337

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  338  PSLEVLQLWENNFTGGVPRSLGRNGRLQLLDLSSNKLTGTLPP  380



>ref|XP_008665503.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Zea mays]
 tpg|DAA51666.1| TPA: putative leucine-rich repeat receptor-like protein kinase 
family protein [Zea mays]
Length=1034

 Score =   128 bits (321),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 79/148 (53%), Positives = 97/148 (66%), Gaps = 6/148 (4%)
 Frame = +1

Query  163  ADSQSSLTSWNISTS-HCTWRRVTCd----sllhvvsldlsglNLSGVLSPDVGQLPFLV  327
            +D   +L SW+ ++S HC W  VTC         VV LD+SGLNLSG L P + +L  L 
Sbjct  34   SDPTGALASWDAASSDHCAWVGVTCAPRGSGGGVVVGLDVSGLNLSGALPPALSRLRGLQ  93

Query  328  NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-G  504
             LS+AAN   GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT  
Sbjct  94   RLSVAANGFYGPIPPSLARLQLLVHLNLSNNAFNGSFPPALARLRALRVLDLYNNNLTSA  153

Query  505  DLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             LP+EV  M  LRHLHLGGN+FSG IPP
Sbjct  154  TLPLEVTHMPMLRHLHLGGNFFSGEIPP  181


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +PPEI  +  L   +LS+N F    P ++ + 
Sbjct  465  LTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP
Sbjct  525  RLLTYLDMSQNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPP  567


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P+ G+ P L  L+++ N+LSG +PPE+  +++LR L +   N +    P +L  
Sbjct  175  FSGEIPPEYGRWPRLQYLAVSGNELSGKIPPELGNLTSLRELYIGYYNSYTGGLPPELGN  234

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  LD  N  L+G++P E+ ++ +L  L L  N  +G IP
Sbjct  235  LTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIP  277


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L    +++N+  G VPPE+     L +L++S N      P  ++ +
Sbjct  489  FSGAIPPEIGRLQQLSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPPAISGM  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  549  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  590


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  248  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSEL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  308  KNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVP  349


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 53/101 (52%), Gaps = 6/101 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  +P++G++      S++ NQL+G +P  +   S ++ L L  N F    P ++ +L  
Sbjct  449  GAAAPNLGEI------SLSNNQLTGALPASLGNFSGVQKLLLDQNAFSGAIPPEIGRLQQ  502

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L   DL +N   G +P EV K   L +L +  N  SG+IPP
Sbjct  503  LSKADLSSNKFEGGVPPEVGKCRLLTYLDMSQNNLSGKIPP  543


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  296  LTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDLPSLEVLQLWENNFTGGVPRRLGRN  355

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP
Sbjct  356  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIP  397


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  225  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGYLR  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  285  SLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIP  325


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  L
Sbjct  272  LTGSIPSELGYLRSLSSLDLSNNALTGEIPASFSELKNLTLLNLFRNKLRGDIPGFVGDL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  332  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPP  374



>gb|AAF73373.1|AF193835_1 LRK1 protein [Oryza sativa]
Length=970

 Score =   127 bits (319),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 103/159 (65%), Gaps = 5/159 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVL-  294
            E  ALL++KAA   D   +L SW  N ++S C W  V C++   VV LD+SG NL+G L 
Sbjct  27   EADALLAVKAALD-DPTGALASWTTNTTSSPCAWSGVACNARGAVVGLDVSGRNLTGGLP  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQLANLQ  471
               +  L  L  L +AAN LSGP+P  +S ++  L  LNLSNN    TFP QL++L  L+
Sbjct  86   GAALSGLQHLARLDLAANALSGPIPAALSRLAPFLTHLNLSNNGLNGTFPPQLSRLRALR  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLDLYNNNLTG LP+EV  +  LRHLHLGGN FSG IPP
Sbjct  146  VLDLYNNNLTGALPLEVVSLRKLRHLHLGGNIFSGGIPP  184


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/78 (36%), Positives = 44/78 (56%), Gaps = 0/78 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A + 
Sbjct  521  TGGVPPEIGKCRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIPATIAAMQ  580

Query  463  NLQVLDLYNNNLTGDLPV  516
            +L  +D   NNL+G +P 
Sbjct  581  SLTAVDFSYNNLSGLVPA  598


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (49%), Gaps = 0/94 (0%)
 Frame = +1

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            VG LP L  L +  N  +G +P  +      + L+LS+N    T P  L     L+ L  
Sbjct  334  VGDLPSLEVLQLWENNFTGGMPRRLGRNGRFQLLDLSSNRLTGTLPPDLCAGGKLETLIA  393

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              N+L G +P  + K TSL  + LG NY +G IP
Sbjct  394  LGNSLFGAIPASLGKCTSLTRVRLGDNYLNGSIP  427


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST-FPHQLAQ  456
            L+G L   +G    +  L +  N  +G +PPEI  +  L   +LS N   +   P ++ +
Sbjct  471  LTGALPAFIGSFSGVQKLLLDQNAFTGEIPPEIGRLQQLSKADLSGNSLPTGGVPPEIGK  530

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  LDL  NNL+G++P  +  M  L +L+L  N   G IP
Sbjct  531  CRLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNQLDGEIP  573



>emb|CDY02112.1| BnaA03g40550D [Brassica napus]
Length=969

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 87/140 (62%), Gaps = 24/140 (17%)
 Frame = +1

Query  172  QSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQ  351
             S L SW++STS C W  VTCD                         L  +++L ++   
Sbjct  45   HSPLASWDLSTSFCLWTGVTCD-----------------------ASLRHVISLDLSGLN  81

Query  352  LSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEVYK  528
            LSG +P  ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +  
Sbjct  82   LSGTLPSSMASLSELRRLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSITN  141

Query  529  MTSLRHLHLGGNYFSGRIPP  588
            +T LRHLHLGGNYF+GRIPP
Sbjct  142  LTELRHLHLGGNYFAGRIPP  161


 Score = 76.6 bits (187),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  228  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  287

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  288  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIP  329


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  155  FAGRIPPAYGSWPTLEYLAVSGNELAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGN  214

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ L  LD  N  L G++P E+ ++  L  L L  N FSG +PP
Sbjct  215  LSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPP  258


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SG +P EI  +  L  L+ S+N+F    P ++++ 
Sbjct  446  LSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRC  505

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+GD+P E+  M  L +L++  N+  G IP
Sbjct  506  KLLTYVDLSRNELSGDIPNEITSMRILNYLNVSRNHLVGSIP  547


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  204  FDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  263

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  264  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIP  305


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I + S ++ L L  N F    P ++ +L
Sbjct  428  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGSFSGVQKLLLDGNKFSGAIPSEIGRL  481

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LD  +N  +G +P E+ +   L ++ L  N  SG IP
Sbjct  482  QQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIP  523


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++G+L  L  L  + N  SG +PPEIS    L +++LS N      P+++  +
Sbjct  470  FSGAIPSEIGRLQQLSKLDFSHNLFSGGIPPEISRCKLLTYVDLSRNELSGDIPNEITSM  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L G +PV +  M SL  +    N  SG +P
Sbjct  530  RILNYLNVSRNHLVGSIPVTISSMQSLTSIDFSYNNLSGLVP  571


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  179  LAGKIPPEIGNLTTLRELYIGYFNAFDGGLPPEIGNLSELLRLDAANCGLRGEIPPEIGR  238

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP
Sbjct  239  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPP  282


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P   QL  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  276  FTGEIPPSFEQLRNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIPRKLGEN  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LDL +N LTG LP  +     L  L   GN+  G IP
Sbjct  336  GRLVILDLSSNKLTGTLPPNMCFGNRLVTLITLGNFLFGSIP  377



>ref|XP_010260843.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
 ref|XP_010260847.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Nelumbo nucifera]
Length=1006

 Score =   127 bits (319),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 75/158 (47%), Positives = 104/158 (66%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsl-lhvvsldlsglNLSGVL  294
            + +  LS+K AF   + + L +WN S   S C+W  + CD +   VVSLD+S  N+SGV+
Sbjct  53   QASIFLSLKQAFYVPT-TCLDTWNESNFMSLCSWTGIQCDDMGSSVVSLDISNFNISGVI  111

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G+L  L+NLSIA N  SG  PPE+  +++LRFLN+SNN F  +     + L  L+V
Sbjct  112  SPAIGELQSLLNLSIAGNSFSGLFPPELHKLTSLRFLNISNNQFNGSLSWNFSSLRELEV  171

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD+YNNN  G LP+ V ++  L+HL LGGNY SG+IPP
Sbjct  172  LDVYNNNFFGSLPLGVTELPKLKHLDLGGNYISGKIPP  209


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G L   V +LP L +L +  N +SG +PP   A+  L +L+L+ N  G   P +L  
Sbjct  178  NFFGSLPLGVTELPKLKHLDLGGNYISGKIPPSYGAMEELNYLSLAGNDLGGLIPGELGN  237

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+ L L Y N   G +P E  K+ +L HL L      G IPP
Sbjct  238  LTNLKQLYLGYFNEFDGGIPPEFGKLVNLVHLDLSSCGLEGPIPP  282


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV+L +++  L GP+PPE+  ++ L  L L  N    + PHQ   L
Sbjct  252  FDGGIPPEFGKLVNLVHLDLSSCGLEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LDL NN LTG++PVE  ++  L  LHL  N   G IP
Sbjct  312  SSLKSLDLSNNGLTGEIPVEFSELRELSLLHLFINKLHGEIP  353


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + PD+G    L  L ++ NQLSGP+P +IS I  L +LN+S N    + P ++  
Sbjct  540  NLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLPKEIGA  599

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  600  IKSLTSADFSHNDFSGRIP  618


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G+L  L+ L ++ N L+G +PP+I     L +L+LS N      P Q++Q+
Sbjct  517  FTGEIPSELGRLKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIPVQISQI  576

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  + SL       N FSGRIP
Sbjct  577  HILNYLNISWNHLNQSLPKEIGAIKSLTSADFSHNDFSGRIP  618


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G  + D  ++P  L  L+++ N+LSG +P  I   S+L+ L L  N F    P +L +
Sbjct  468  LTGWFAEDPNKVPSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGR  527

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL  LD+  NNLTG +P ++     L +L L  N  SG IP
Sbjct  528  LKNLLKLDMSRNNLTGRIPPDIGNCLLLTYLDLSQNQLSGPIP  570


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   + +LP L  L +  N  +G +PP++     L  L+LS N      P  L   
Sbjct  348  LHGEIPRFIAELPKLEVLKLWQNNFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLG  407

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L++L L NN L G LP ++    +L  + LG NY SG IP
Sbjct  408  RKLRILILLNNFLFGPLPDDLGDCVTLLRVRLGQNYLSGSIP  449


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G L  L  L +  NQLSG +P +   +S+L+ L+LSNN      P + ++L
Sbjct  276  LEGPIPPELGNLNKLDTLFLQTNQLSGSIPHQFGNLSSLKSLDLSNNGLTGEIPVEFSEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +L L+ N L G++P  + ++  L  L L  N F+G IPP
Sbjct  336  RELSLLHLFINKLHGEIPRFIAELPKLEVLKLWQNNFTGTIPP  378


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 59/128 (46%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  387
            L G L  D+G    L+ + +  N LSG +P      PE+S +                  
Sbjct  420  LFGPLPDDLGDCVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTGWFAEDPNKV  479

Query  388  -STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
             S L  LNLSNN    + P  +   ++LQ L L  N  TG++P E+ ++ +L  L +  N
Sbjct  480  PSKLGQLNLSNNRLSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRN  539

Query  565  YFSGRIPP  588
              +GRIPP
Sbjct  540  NLTGRIPP  547


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G    L  L +  NQ +G +P E+  +  L  L++S N      P  +   
Sbjct  493  LSGSIPSSIGNFSSLQALLLGGNQFTGEIPSELGRLKNLLKLDMSRNNLTGRIPPDIGNC  552

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N L+G +PV++ ++  L +L++  N+ +  +P
Sbjct  553  LLLTYLDLSQNQLSGPIPVQISQIHILNYLNISWNHLNQSLP  594


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 31/100 (31%), Positives = 45/100 (45%), Gaps = 0/100 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G + P +GQ   L  L ++ N+L+G VP  +     LR L L NN      P  L  
Sbjct  371  NFTGTIPPKLGQNGKLTELDLSTNKLTGLVPRSLCLGRKLRILILLNNFLFGPLPDDLGD  430

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
               L  + L  N L+G +P     +  L  + L  NY +G
Sbjct  431  CVTLLRVRLGQNYLSGSIPYGFLYLPELSLMELQNNYLTG  470



>ref|XP_010943209.1| PREDICTED: LOW QUALITY PROTEIN: leucine-rich repeat receptor-like 
serine/threonine-protein kinase BAM1 [Elaeis guineensis]
Length=995

 Score =   127 bits (318),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 76/171 (44%), Positives = 97/171 (57%), Gaps = 27/171 (16%)
 Frame = +1

Query  79   RHSAGAGAGKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHC-TWRRVTCdsllhvv  255
            R SA A  G+     E  AL+ +KAA   +   SL  W+ +  HC +W  V CD+     
Sbjct  15   RPSATAATGEGT-AAEHRALVELKAAI-GNPTGSLAGWDAAADHCRSWAGVACDAAGR--  70

Query  256  sldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGST  435
                                  +V+L I+   LSGP+PPE+S +S LR+LNLSNN+F  T
Sbjct  71   ----------------------VVSLDISNLNLSGPIPPELSLLSGLRYLNLSNNVFNGT  108

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            FP  L++L NL+ LDLYNNNLT  LPV V  +  LRHLHLGGN+FSG IPP
Sbjct  109  FPSDLSRLKNLRALDLYNNNLTDVLPVVVADLPVLRHLHLGGNFFSGAIPP  159


 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L +  NQ SG +PPEI  +  L  ++ S N F    P ++++ 
Sbjct  441  LSGALPSSIGNFPGLQKLLLNQNQFSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +  +DL  NNL+G++PVE+ +M  L +L+L  N+  G IP
Sbjct  501  RLVTFIDLSRNNLSGEIPVEITEMRILNYLNLSRNHLEGEIP  542


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P++G+L  L  +  + N+ S P+PPEIS    + F++LS N      P ++ ++
Sbjct  465  FSGCIPPEIGRLQQLSKMDFSGNRFSCPIPPEISKCRLVTFIDLSRNNLSGEIPVEITEM  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  525  RILNYLNLSRNHLEGEIPTSISTMQSLTAVDFSYNNLSGLVP  566


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N LSG + PE+  +  L+ ++LSNN      P   A L
Sbjct  226  LSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  +  L  L L  N F+G IP
Sbjct  286  KNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIP  327


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG ++P++G+L  L ++ ++ N L+G +PP  + +  L  LNL  N      P  +  L
Sbjct  250  LSGEITPELGKLWGLKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDL  309

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL L+ NN TG++P  +     L+ L L  N  +G +PP
Sbjct  310  PELEVLQLWENNFTGEIPRRLGTNGRLQLLDLSSNKLTGSLPP  352


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P+ G+   +  L+I+ N+LSGP+PPE+  ++TLR L +   N +    P     
Sbjct  153  FSGAIPPEYGRWEHIEYLAISGNELSGPIPPELGNLTTLRELYIGYFNSYQGGLPAAFGN  212

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L  LD  N  L+G++P E+  + +L  L L  N  SG I P
Sbjct  213  LTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITP  256


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P    L  L  L++  N+L G +P  +  +  L  L L  N F    P +L   
Sbjct  274  LTGEIPPTFADLKNLTLLNLFRNKLHGAIPDFVGDLPELEVLQLWENNFTGEIPRRLGTN  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP ++     L  L   GN+  G IP
Sbjct  334  GRLQLLDLSSNKLTGSLPPDLCSGDKLETLIALGNFLFGSIP  375


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 48/100 (48%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G L    G L  LV L  A   LSG +PPE+  +  L  L L  N        +L +L  
Sbjct  204  GGLPAAFGNLTSLVRLDAANCGLSGEIPPEMGDLQNLDTLFLQVNGLSGEITPELGKLWG  263

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN LTG++P     + +L  L+L  N   G IP
Sbjct  264  LKSMDLSNNALTGEIPPTFADLKNLTLLNLFRNKLHGAIP  303



>ref|XP_011045060.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=972

 Score =   127 bits (318),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  V CD    VVSL+LS  +L
Sbjct  20   GYSDLEVLLKLKTSMCGHNGTGLQDWVASPASPTAHCYFSGVMCDEDSRVVSLNLSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G++ P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGLIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP
Sbjct  140  AQLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIP  181


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  + FL  + I  N + G +P  I   ++L  ++ S N      P  +A+L
Sbjct  488  LSGEIPEEICGMKFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVPKTIAKL  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG LPVE+  M SL  L+L  N   GRIP
Sbjct  548  KDLSFLDLSRNQLTGQLPVEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +GQL  L +L +  N L+G +PPE+S + +L+ L+LS N      P   + 
Sbjct  248  NLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSD  307

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L ++++++L+ N L G +P       +L  L + GN F+  +P
Sbjct  308  LKDIELVNLFQNKLHGPIPEFFGDFPNLEVLQVWGNNFTFELP  350


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L P++     L  LS++ N+++G +PP I  +  L+ L+L  N      P ++  +
Sbjct  441  FSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEICGM  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D+  NN+ G++P  +++ TSL  +    N  SG +P
Sbjct  500  KFLTKIDIRGNNIRGEIPASIFQCTSLTSVDFSQNSLSGGVP  541


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  +  ++  L  L +  N LSG VP  +S +  L+ L +   N +  + P +   
Sbjct  176  FSGTIPEEYSEILSLEYLGLNGNALSGKVPSSLSRLKNLKSLCVGYFNRYEGSIPPEFGL  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL++LD+ + NL G++P  + ++T L  L L  N  +G IPP
Sbjct  236  LSNLELLDMASCNLDGEIPSTLGQLTHLHSLFLQVNNLTGHIPP  279


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ N L+G +P   S +  +  +NL  N      P     
Sbjct  272  NLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKDIELVNLFQNKLHGPIPEFFGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              NL+VL ++ NN T +LP  + +   L  L +  N+ +G +P
Sbjct  332  FPNLEVLQVWGNNFTFELPQNLGRNGKLMILDVSINHLTGLVP  374


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMILDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +L  + + NN  +G +P  ++ +     + L  N+FSG +PP
Sbjct  404  CKSLIKIRIMNNMFSGTIPAGMFNLPMATLVELSNNFFSGELPP  447



>gb|AHJ14779.1| CLAVATA1 [Rhododendron ovatum]
Length=992

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 93/158 (59%), Gaps = 3/158 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            +   LLS+K AF     S LTSWN+S   S CTW  + CD+    +        N+SG L
Sbjct  37   QATILLSLKQAFEPPEDSCLTSWNVSNYNSLCTWTGIKCDAKNTSILSLDISNYNISGYL  96

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
             P +  +  LVNLS++ N LSG  P +I  +  L+FLN+SNN F  +   Q ++L  L V
Sbjct  97   LPAISDIHTLVNLSVSGNSLSGTFPVDIHKLVRLQFLNISNNQFNGSLNWQFSKLKKLVV  156

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD YNN  +G LP+ V  ++ L+HL  GGNYFSG+IPP
Sbjct  157  LDAYNNEFSGSLPLGVTDLSKLKHLDFGGNYFSGKIPP  194


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/127 (32%), Positives = 64/127 (50%), Gaps = 25/127 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI------------  423
            L G + P++G L  L  L +  NQLSG +PPE++ ++TL+  +LSNN+            
Sbjct  261  LKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANLTTLKSFDLSNNVLTGEIPVELFSG  320

Query  424  -------------FGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
                         F    P  LA+L NL+VL L+ NN TG +P  + +  +L+ + L  N
Sbjct  321  LKELTLLNLFLNKFHGEIPRVLAELPNLEVLKLWQNNFTGSIPSMLGQNGNLKEIDLSTN  380

Query  565  YFSGRIP  585
              +G +P
Sbjct  381  KLTGLVP  387


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G L  LV L +++  L GP+PPE+  ++ L  L L  N    + P +LA L
Sbjct  237  FDGGIPAELGNLVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPPELANL  296

Query  460  ANLQVLDLYNNNLTGDLPVEVYK-MTSLRHLHLGGNYFSGRIP  585
              L+  DL NN LTG++PVE++  +  L  L+L  N F G IP
Sbjct  297  TTLKSFDLSNNVLTGEIPVELFSGLKELTLLNLFLNKFHGEIP  339


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/100 (37%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  D+G+L  +  L ++ N  SG +P EIS    L +L+LS N      P Q+AQ+  
Sbjct  505  GDIPSDIGRLKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHI  564

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  565  LNYLNISWNHLNQSLPKEIGLMKSLTSADFSHNNFSGPIP  604


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L     +LP  L  L++A N+LSG +P  I   S+L  L L+ N F    P  + +
Sbjct  454  LTGQLEQQRSKLPMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIPSDIGR  513

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NN +G +P E+     L +L L  N  SG IP
Sbjct  514  LKNIFKLDMSRNNFSGQIPAEISNCLMLTYLDLSQNQLSGPIP  556


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG + P  G L  L  LS+A N L G +P ++  ++ L  L+L   N+F    P +L  
Sbjct  188  FSGKIPPVYGSLENLDYLSLAGNNLVGYIPKQLGNLTNLNQLHLGYYNLFDGGIPAELGN  247

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL +  L G +P E+  +  L  L L  N  SG IPP
Sbjct  248  LVNLVRLDLSSCGLKGPIPPELGNLNKLDTLFLQTNQLSGSIPP  291


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++     L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  526  NFSGQIPAEISNCLMLTYLDLSQNQLSGPIPDQIAQIHILNYLNISWNHLNQSLPKEIGL  585

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  586  MKSLTSADFSHNNFSGPIP  604


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 49/103 (48%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G+   L  + I  N LSG +P     +  L  + L NN        Q ++L
Sbjct  406  LFGPLPKDLGKCDTLSRVRIGQNYLSGSIPNGFLYLPQLSLVELQNNYLTGQLEQQRSKL  465

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  L+L NN L+G LP  +   +SL  L L GN F G IP
Sbjct  466  PMKLGQLNLANNRLSGSLPASIGNFSSLNILLLNGNRFIGDIP  508



>emb|CDY23037.1| BnaC07g31500D [Brassica napus]
Length=967

 Score =   126 bits (317),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 69/142 (49%), Positives = 86/142 (61%), Gaps = 24/142 (17%)
 Frame = +1

Query  166  DSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAA  345
            D  S L SWN+STS C W  VTCD                         L  + +L ++ 
Sbjct  42   DQHSPLASWNLSTSFCLWTGVTCD-----------------------ASLRHVTSLYLSG  78

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLANLQVLDLYNNNLTGDLPVEV  522
              LSG +   ++++S LR LNLSNN+F  +FP +L A L NL+VLDLYNNNLTGDLPV +
Sbjct  79   LNLSGTLSSSMASLSELRLLNLSNNVFNGSFPDELSAGLVNLRVLDLYNNNLTGDLPVSL  138

Query  523  YKMTSLRHLHLGGNYFSGRIPP  588
              +T LRHLHLGGNYF+GRIPP
Sbjct  139  TNLTELRHLHLGGNYFAGRIPP  160


 Score = 76.3 bits (186),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G+L  L  L +  N  SG +PPE+  IS+L+ ++LSNN+F    P    QL
Sbjct  227  LRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPPSFEQL  286

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  +  M  L  L L  N F+G IP
Sbjct  287  RNLTLLNLFRNKLYGAIPEFIGDMPGLEVLQLWENNFTGSIP  328


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 58/104 (56%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P L  L+++ N+L+G +PPEI  ++ LR L +   N F    P ++  
Sbjct  154  FAGRIPPAYGSWPALEYLAVSGNELAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGN  213

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L++L  LD  N  L G++P E+ ++  L  L L  N FSG +PP
Sbjct  214  LSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPP  257


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+ SGP+P EI  +  L  L+ S+N+F      ++++ 
Sbjct  445  LSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRLQQLSKLDFSHNLFSGGIAPEISRC  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L++  N+  G IP
Sbjct  505  KLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIP  546


 Score = 62.8 bits (151),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G L P++G L  L+ L  A   L G +PPEI  +  L  L L  N F  T P +L  +
Sbjct  203  FDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGRLRRLDTLFLQVNAFSGTLPPELGTI  262

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ +DL NN  TG++P    ++ +L  L+L  N   G IP
Sbjct  263  SSLKSMDLSNNMFTGEIPPSFEQLRNLTLLNLFRNKLYGAIP  304


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G + P++G L  L  L I   N   G +PPEI  +S L  L+ +N       P ++ +
Sbjct  178  LAGKIPPEIGNLTALRELYIGYFNAFDGGLPPEIGNLSDLLRLDAANCGLRGEIPPEIGR  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  L L  N  +G LP E+  ++SL+ + L  N F+G IPP
Sbjct  238  LRRLDTLFLQVNAFSGTLPPELGTISSLKSMDLSNNMFTGEIPP  281


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 55/102 (54%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +S ++GQ+      S++ NQLSGP+PP I   S ++ L L  N F    P ++ +L
Sbjct  427  ISGGVSVNLGQI------SLSNNQLSGPLPPAIGNFSGVQKLLLDGNKFSGPIPSEIGRL  480

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LD  +N  +G +  E+ +   L ++ L  N  SG IP
Sbjct  481  QQLSKLDFSHNLFSGGIAPEISRCKLLTYVDLSRNELSGEIP  522


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 24/78 (31%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG ++P++ +   L  + ++ N+LSG +P EI+++  L +LN+S N    + P  ++ +
Sbjct  493  FSGGIAPEISRCKLLTYVDLSRNELSGEIPNEITSMRILNYLNVSRNHLVGSIPATISSM  552

Query  460  ANLQVLDLYNNNLTGDLP  513
             +L  +D   NNL+G +P
Sbjct  553  QSLTSVDFSYNNLSGLVP  570



>ref|XP_010266811.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
 ref|XP_010266812.1| PREDICTED: receptor protein kinase CLAVATA1 [Nelumbo nucifera]
Length=979

 Score =   126 bits (316),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 70/159 (44%), Positives = 103/159 (65%), Gaps = 4/159 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+  ALL +K A      S L  WN+S+S   HC +  V+CD    VV+L++S + L G 
Sbjct  25   TDLDALLKLKTAMIGRRGSGLDDWNVSSSRNSHCLFSGVSCDENSRVVALNVSYVPLFGT  84

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            +SP++G L  LVNL+++ N L+G +P EI+ +++L+ LN+SNN F    P  +A  L  +
Sbjct  85   VSPEIGLLNKLVNLTLSCNNLTGKLPEEIANLTSLKLLNISNNAFVGGVPEGIAGGLLEV  144

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++ D+YNNN TG LP  + K+  L+HLHLGGN+FSG IP
Sbjct  145  EIFDIYNNNFTGRLPTGLVKLKRLKHLHLGGNFFSGEIP  183


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  250  NLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L +++L+ N+L G +P  V ++  L  L + GN F+  +P
Sbjct  310  LKQLTLINLFRNHLRGRIPPFVAELPYLEVLQVWGNNFTFELP  352


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +  L  L  LS+  N  SG +PPEI  +  L  +N+S+N      P  L   
Sbjct  466  ITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEIPIALGHC  525

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +D   NNL G +P E+ K+  L  L+L  N+ +G+IP
Sbjct  526  KSLSSVDFSRNNLFGRIPREIAKLEILSTLNLSRNHLTGQIP  567


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  + G L  L+ L + +  L+G +P  +  +  L  L L  N      P +L+ L +
Sbjct  229  GGIPTEFGSLSSLLILDMGSCNLTGEIPASLGRLKLLHTLFLQLNKLSGLIPAELSGLVS  288

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ LDL NN+LTG++P    ++  L  ++L  N+  GRIPP
Sbjct  289  LKSLDLSNNDLTGEIPESFSELKQLTLINLFRNHLRGRIPP  329


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N+++G +PP I+ ++ LR L+L  N+F    P ++  L  L  +++ +NN+TG++
Sbjct  459  LTLSNNRITGKIPPAIANLTNLRTLSLDVNLFSGEIPPEIFGLKMLSKINISSNNITGEI  518

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P+ +    SL  +    N   GRIP
Sbjct  519  PIALGHCKSLSSVDFSRNNLFGRIP  543


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G    L  + ++ N L+GP+PP + A   L  L L NN F    P +L  
Sbjct  346  NFTFELPQNLGSNGMLKKIDVSINHLTGPIPPRLCAGQRLETLILMNNYFLGPIPEELGD  405

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + L  N L G +P  ++ +  +  L L  N+F+G +P
Sbjct  406  CKSLTRVRLMKNFLNGTIPSGLFNLPLVDMLELNDNFFTGELP  448


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG++  ++  L  L +L ++ N L+G +P   S +  L  +NL  N      P  +A+L
Sbjct  275  LSGLIPAELSGLVSLKSLDLSNNDLTGEIPESFSELKQLTLINLFRNHLRGRIPPFVAEL  334

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL ++ NN T +LP  +     L+ + +  N+ +G IPP
Sbjct  335  PYLEVLQVWGNNFTFELPQNLGSNGMLKKIDVSINHLTGPIPP  377


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/101 (32%), Positives = 53/101 (52%), Gaps = 1/101 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++G    L  + +  N L+G +P  +  +  +  L L++N F    P +++    
Sbjct  397  GPIPEELGDCKSLTRVRLMKNFLNGTIPSGLFNLPLVDMLELNDNFFTGELPDRISG-ET  455

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L L NN +TG +P  +  +T+LR L L  N FSG IPP
Sbjct  456  LGLLTLSNNRITGKIPPAIANLTNLRTLSLDVNLFSGEIPP  496



>ref|XP_002307734.1| receptor protein kinase [Populus trichocarpa]
 gb|EEE94730.1| receptor protein kinase [Populus trichocarpa]
Length=973

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 70/162 (43%), Positives = 105/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G ++   LL +K +    + + L  W  S    T+HC +  VTCD    VVSL++S  +L
Sbjct  20   GYSDLEVLLKLKTSMYGHNGTGLQDWVASPASPTAHCYFSGVTCDEDSRVVSLNVSFRHL  79

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL+++ N L+G  P EI+ +++LR LN+SNN+    FP ++   +
Sbjct  80   PGSIPPEIGLLNKLVNLTLSGNNLTGGFPVEIAMLTSLRILNISNNVIAGNFPGKITLGM  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A L+VLD+YNNN TG LP E+ K+ +L+H+HLGGN+FSG IP
Sbjct  140  ALLEVLDVYNNNFTGALPTEIVKLKNLKHVHLGGNFFSGTIP  181


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L  L  ++I AN + G +P  IS  ++L  ++ S N      P ++A+L
Sbjct  488  LSGEIPEEIWGLKSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIPKKIAKL  547

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG LP E+  M SL  L+L  N   GRIP
Sbjct  548  NDLSFLDLSRNQLTGQLPGEIGYMRSLTSLNLSYNNLFGRIP  589


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 53/102 (52%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +   +  LP    + ++ N  SG +PPEIS    L  L++SNN      P  +  L
Sbjct  417  FSGTIPAGIFNLPLATLVELSNNLFSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNL  475

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L L  N L+G++P E++ + SL  +++  N   G IP
Sbjct  476  KNLQTLSLDTNRLSGEIPEEIWGLKSLTKINIRANNIRGEIP  517


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  +  ++  L  L +  N LSG VP  +S +  L+ L +   N +  + P +   
Sbjct  176  FSGTIPEEYSEILSLEYLGLNGNALSGKVPSSLSRLKNLKSLCVGYFNRYEGSIPPEFGS  235

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NL++LD+ + NL G++P  + ++T L  L L  N  +G IPP
Sbjct  236  LSNLELLDMASCNLDGEIPSALSQLTHLHSLFLQVNNLTGHIPP  279


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ N L+G +P   S +  +  +NL  N      P     
Sbjct  272  NLTGHIPPELSGLISLKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIPEFFGD  331

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              NL+VL ++ NN T +LP  + +   L  L +  N+ +G +P
Sbjct  332  FPNLEVLQVWGNNFTFELPQNLGRNGKLMMLDVSINHLTGLVP  374


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 53/102 (52%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L P++     L  LS++ N+++G +PP I  +  L+ L+L  N      P ++  L
Sbjct  441  FSGELPPEISG-DALGLLSVSNNRITGKIPPAIGNLKNLQTLSLDTNRLSGEIPEEIWGL  499

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +++  NN+ G++P  +   TSL  +    N  SG IP
Sbjct  500  KSLTKINIRANNIRGEIPASISHCTSLTSVDFSQNSLSGEIP  541


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 53/104 (51%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L+ L ++ N L+G VP ++     L  L L NN F  + P ++ Q
Sbjct  344  NFTFELPQNLGRNGKLMMLDVSINHLTGLVPRDLCKGGKLTTLILMNNFFLGSLPDEIGQ  403

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +L  + + NN  +G +P  ++ +     + L  N FSG +PP
Sbjct  404  CKSLLKIRIMNNMFSGTIPAGIFNLPLATLVELSNNLFSGELPP  447


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L G +P  +S ++ L  L L  N      P +L+ L +
Sbjct  227  GSIPPEFGSLSNLELLDMASCNLDGEIPSALSQLTHLHSLFLQVNNLTGHIPPELSGLIS  286

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL  NNLTG++P     + ++  ++L  N   G IP
Sbjct  287  LKSLDLSINNLTGEIPESFSDLKNIELINLFQNKLHGPIP  326



>ref|XP_002461427.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
 gb|EER97948.1| hypothetical protein SORBIDRAFT_02g002450 [Sorghum bicolor]
Length=1031

 Score =   126 bits (316),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 95/145 (66%), Gaps = 3/145 (2%)
 Frame = +1

Query  163  ADSQSSLTSWN--ISTSHCTWRRVTCdsllhvvsldlsglNLSG-VLSPDVGQLPFLVNL  333
            +D   +L SW    ST  C W  VTC++   V+ LDLSG NLSG V +  + +L  L  L
Sbjct  42   SDPAGALASWTNATSTGPCAWSGVTCNARGAVIGLDLSGRNLSGAVPAAALSRLAHLARL  101

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  513
             +AAN LSGP+P  +S + +L  LNLSNN+   TFP   A+L  L+VLDLYNNNLTG LP
Sbjct  102  DLAANALSGPIPAPLSRLQSLTHLNLSNNVLNGTFPPPFARLRALRVLDLYNNNLTGPLP  161

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPP  588
            + V  +  LRHLHLGGN+FSG IPP
Sbjct  162  LVVVALPMLRHLHLGGNFFSGEIPP  186


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N  +G VPPEI  +  L   +LS N      P ++ + 
Sbjct  470  LTGALPASIGNFSGLQKLLLDQNAFTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKC  529

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  NNL+G++P  +  M  L +L+L  N+  G IP
Sbjct  530  RLLTYLDLSRNNLSGEIPPAISGMRILNYLNLSRNHLDGEIP  571


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P++G+L  L    ++ N L G +PPEI     L +L+LS N      P  ++ +
Sbjct  494  FTGAVPPEIGRLQQLSKADLSGNALDGGMPPEIGKCRLLTYLDLSRNNLSGEIPPAISGM  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  554  RILNYLNLSRNHLDGEIPATIAAMQSLTAVDFSYNNLSGLVP  595


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N L+G +PPE+  + +L  L+LSNN      P   A L
Sbjct  253  LSGEIPPELGNLENLDTLFLQVNGLTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAAL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G +P  V  + +L  L L  N F+G IP
Sbjct  313  KNLTLLNLFRNKLRGSIPELVGDLPNLEVLQLWENNFTGGIP  354


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L +L ++ N L+G +P   +A+  L  LNL  N    + P  +  L
Sbjct  277  LTGAIPPELGRLRSLSSLDLSNNGLTGEIPASFAALKNLTLLNLFRNKLRGSIPELVGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VL L+ NN TG +P  + +   L+ + L  N  +G +PP
Sbjct  337  PNLEVLQLWENNFTGGIPRRLGRNGRLQLVDLSSNRLTGTLPP  379



>ref|XP_007017845.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOY15070.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=982

 Score =   125 bits (314),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/161 (43%), Positives = 103/161 (64%), Gaps = 4/161 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L  W  S+S   HC +  V CD   HVVSL+ S   LS
Sbjct  25   GYSDLEVLLKLKSSMIGPKGSGLEDWEFSSSPSAHCHFSGVQCDEEFHVVSLNASFAPLS  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  462
            G + P++G L  LVNL+IAA  L+G +P E+  +++L+  N+SNN+F  +FP + L  + 
Sbjct  85   GTIPPEIGLLNKLVNLTIAAANLTGKIPVEMGNLTSLKLFNISNNVFKGSFPGEILTGMT  144

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L++LD YNNN TG LP+EV  +T+++HL LGGN+F+G IP
Sbjct  145  ELEILDAYNNNFTGLLPIEVANLTNIKHLCLGGNFFTGEIP  185


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  +  L  ++I+ N ++G +PP IS  ++L  ++ S N      P  + +L
Sbjct  492  FSGEIPEEIFNIKLLSKINISDNSITGEIPPSISRCTSLTSIDFSQNSLTGEIPKGIEKL  551

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L+   N LTG++P E+  M SL  L L  N F GRIP
Sbjct  552  KDLSILNFSRNQLTGEIPGEIRYMISLTTLDLSYNNFVGRIP  593


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +  L  L  LS+  N+ SG +P EI  I  L  +N+S+N      P  +++ 
Sbjct  468  ITGKIPPAISNLRNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSITGEIPPSISRC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +D   N+LTG++P  + K+  L  L+   N  +G IP
Sbjct  528  TSLTSIDFSQNSLTGEIPKGIEKLKDLSILNFSRNQLTGEIP  569


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N  SG +P ++S  S L  L +SNN      P  ++ L
Sbjct  421  LNGTIPAGIFNLPLLSIVELNDNFFSGELPTQMSGAS-LGQLKVSNNWITGKIPPAISNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NLQVL L  N  +G++P E++ +  L  +++  N  +G IPP
Sbjct  480  RNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSITGEIPP  522


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 58/128 (45%), Gaps = 25/128 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G+L  +V  L  + +L +  N  +G +P + S I +L +L L+              
Sbjct  155  NFTGLLPIEVANLTNIKHLCLGGNFFTGEIPEKYSDIQSLEYLGLNGIGLTGKSPAFLAR  214

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L+ LQVLD+ + NLTG++PV +  +  L  L L  
Sbjct  215  LKNLKEMYIGYFNAYVGEIPPEFGTLSQLQVLDMASCNLTGEIPVSLSNLKHLHTLFLQL  274

Query  562  NYFSGRIP  585
            N  +GRIP
Sbjct  275  NRLTGRIP  282


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/88 (30%), Positives = 49/88 (56%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L ++ N ++G +PP IS +  L+ L+L  N F    P ++  +  L  +++ +N++T
Sbjct  458  LGQLKVSNNWITGKIPPAISNLRNLQVLSLEMNKFSGEIPEEIFNIKLLSKINISDNSIT  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G++P  + + TSL  +    N  +G IP
Sbjct  518  GEIPPSISRCTSLTSIDFSQNSLTGEIP  545


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 33/100 (33%), Positives = 51/100 (51%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L+G +P  +S +  L  L L  N      P +L+ L +
Sbjct  231  GEIPPEFGTLSQLQVLDMASCNLTGEIPVSLSNLKHLHTLFLQLNRLTGRIPSELSGLIS  290

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL  N LTG++P     + ++  +HL  N   G IP
Sbjct  291  LKSLDLSINELTGEIPESFSALQNITLIHLFKNNLYGPIP  330


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            L+G +  ++  L  L +L ++ N+L+G +P   SA+  +  ++L  NN++G   P  +  
Sbjct  277  LTGRIPSELSGLISLKSLDLSINELTGEIPESFSALQNITLIHLFKNNLYGP-IPSFVGD  335

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L  L +  N+ +G IP
Sbjct  336  FPHLEVLQVWGNNFTRELPENLGRNGKLFKLDVTSNHLTGLIP  378



>ref|XP_004981595.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1-like [Setaria italica]
Length=1029

 Score =   125 bits (313),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 79/145 (54%), Positives = 94/145 (65%), Gaps = 8/145 (6%)
 Frame = +1

Query  178  SLTSWN-ISTSHCTWRRVTCd------sllhvvsldlsglNLSGVLSPDVGQLPFLVNLS  336
            +L SWN  S  HC W  VTC           VV LD+SGLNLSG L   + +L  L  LS
Sbjct  41   ALRSWNATSPDHCAWAGVTCAPPGGGRGGGIVVGLDVSGLNLSGALPQALSRLHGLQRLS  100

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT-GDLP  513
            +AAN L GP+PP ++ +  L  LNLSNN F  +FP  LA+L  L+VLDLYNNNLT   LP
Sbjct  101  VAANALYGPIPPSLARLQQLVHLNLSNNAFNGSFPPALARLRGLRVLDLYNNNLTSATLP  160

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPP  588
            +EV +M  LRHLHLGGN+FSG IPP
Sbjct  161  LEVTQMPMLRHLHLGGNFFSGEIPP  185


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N F    P ++ + 
Sbjct  469  LTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LD+  NNL+G +P  +  M  L +L+L  N+  G IPP
Sbjct  529  RLLTYLDMSQNNLSGKIPPAISGMWILNYLNLSRNHLDGEIPP  571


 Score = 62.0 bits (149),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN      P   ++L
Sbjct  252  LSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  M SL  L L  N F+G +P
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVP  353


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P++G+L  L    +++N+  G VPPEI     L +L++S N      P  ++ 
Sbjct  492  SFSGAVPPEIGRLQQLSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  552  MWILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 55/101 (54%), Gaps = 6/101 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            GV +P++G++      S++ NQL+G +P  + + S ++ L L  N F    P ++ +L  
Sbjct  453  GVAAPNLGEI------SLSNNQLTGALPASLGSFSGIQKLLLDRNSFSGAVPPEIGRLQQ  506

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L   DL +N   G +P E+ K   L +L +  N  SG+IPP
Sbjct  507  LSKADLSSNKFEGGVPPEIGKCRLLTYLDMSQNNLSGKIPP  547


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            S  L  +V Q+P L +L +  N  SG +PPE      L++L +S N      P +L  L 
Sbjct  156  SATLPLEVTQMPMLRHLHLGGNFFSGEIPPEYGRWPRLQYLAVSGNELSGRIPPELGNLT  215

Query  463  NLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             L+ L + Y N+ TG LP E+  +T L  L       SG IPP
Sbjct  216  TLRELYIGYYNSYTGGLPPELGNLTELVRLDAANCGLSGEIPP  258


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDMPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     L+ L   GN+  G IP
Sbjct  360  GRLQLLDLSSNKLTGTLPPELCAGGKLQTLIALGNFLFGAIP  401


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G L  L +L ++ N L+G +P   S +  L  LNL  N      P  +  +
Sbjct  276  LTGSIPSELGHLKSLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIPDFVGDM  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P  + +   L+ L L  N  +G +PP
Sbjct  336  PSLEVLQLWENNFTGGVPRRLGRNGRLQLLDLSSNKLTGTLPP  378


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 39/101 (39%), Positives = 54/101 (53%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G L P++G L  LV L  A   LSG +PPE+  +  L  L L  N    + P +L  L 
Sbjct  229  TGGLPPELGNLTELVRLDAANCGLSGEIPPELGRLQNLDTLFLQVNGLTGSIPSELGHLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  289  SLSSLDLSNNALTGEIPESFSELKNLTLLNLFRNKLRGDIP  329



>ref|XP_008357152.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=837

 Score =   124 bits (310),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N TG LPVE+  + +L+HL LGGN+ +G IP
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIP  183


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELP  352


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + G + +G IP
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGXHLTGLIP  376


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 38/110 (35%), Positives = 54/110 (49%), Gaps = 7/110 (6%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSG-------PVPPEISAISTLRFLNLSNNIFGST  435
            N +  L  ++G+   L  L +    L+G        +P  IS  S+L   +LS N     
Sbjct  346  NFTFELPENLGRNGRLKELDVTGXHLTGLIPRDFRKIPDSISRCSSLTSADLSQNNLVGE  405

Query  436  FPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             P  +A+L  L +L+   N LTG++P E+  MTSL  L L  N F GRIP
Sbjct  406  IPKGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIP  455


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPP
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPP  281



>ref|XP_008364929.1| PREDICTED: receptor protein kinase CLAVATA1-like [Malus domestica]
Length=973

 Score =   124 bits (310),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 68/151 (45%), Positives = 100/151 (66%), Gaps = 1/151 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQL  315
            LL +KAA     +S L  WN S+SHC++  V CD    VVSL++S L L G ++ ++G L
Sbjct  33   LLKLKAAMIGXKRSGLEDWNPSSSHCSFSGVLCDRDSRVVSLNVSNLPLYGTIAAEIGLL  92

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYNN  492
              LVNL+IA N  +G +P E++ ++ L+ LN+S N+F  +FP ++   +  L+VLD YNN
Sbjct  93   DKLVNLTIAGNNFTGRLPAEMANLTALKHLNISGNLFHGSFPIEIVVGMTELEVLDAYNN  152

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N TG LPVE+  + +L+HL LGGN+ +G IP
Sbjct  153  NFTGTLPVELVSLKNLKHLQLGGNFITGEIP  183


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L  L  ++I+AN     +P  IS  S+L   +LS N      P  +A+L
Sbjct  490  FSGEIPSEIFDLKLLSRINISANNJGRKIPDSISRCSSLTSADLSQNNLVGEIPKGIAKL  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+   N LTG++P E+  MTSL  L L  N F GRIP
Sbjct  550  KVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSDNNFVGRIP  591


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 60/103 (58%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N+LSG +P   S +  +  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPELSALNRLMSLDLSINELSGEIPESFSELKNITLINLYRNNLYGP-IPKFIGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKELDVTGNHLTGLIP  376


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG + P  G L  L  L +  N  SG +P EI  +  L  +N+S N  G   P  +++
Sbjct  465  HLSGKIPPAXGNLKSLQTLXLEMNGFSGEIPSEIFDLKLLSRINISANNJGRKIPDSISR  524

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             ++L   DL  NNL G++P  + K+  L  L+   N  +G IP
Sbjct  525  CSSLTSADLSQNNLVGEIPKGIAKLKVLSILNFSRNQLTGEIP  567


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L  L +  N+LSG +PPE+SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPPELSALNRLMSLDLSINELSGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ +++LY NNL G +P  +     L  L +  N F+  +P
Sbjct  310  LKNITLINLYRNNLYGPIPKFIGDFPHLEVLQIWENNFTFELP  352


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
            ++G +  +  ++  L  L +  N LSG VP  +S +  LR L +   N +    P +L  
Sbjct  178  ITGEIPENYSEIQSLEYLGVNGNMLSGRVPASLSRLKNLRELYVGYYNSYSGGIPPELGS  237

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L++LQ+LD+ + NL G +P  +  +  L  L L  N  SG IPP
Sbjct  238  LSSLQILDMGSCNLVGPIPTTLSLLKHLHTLFLQVNRLSGSIPP  281


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+     L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCTGGNLKTAILMENHFFGPIPEELGRCNSLTKIRMMKNSLSGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL +++L +N L+G+LP E     ++  L L GN+ SG+IPP
Sbjct  430  LPNLIMIELNDNFLSGELP-EQMSGGNIGILTLSGNHLSGKIPP  472



>emb|CDY45620.1| BnaCnng13280D [Brassica napus]
Length=973

 Score =   122 bits (307),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/159 (46%), Positives = 101/159 (64%), Gaps = 25/159 (16%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSS-LTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            ++E  ALLS+K++ T D+ +S L SW  +TS CTW  VTC                    
Sbjct  23   ISEFRALLSLKSSLTGDAPNSPLASWKPTTSFCTWTGVTC--------------------  62

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANLQ  471
              DV +   + +L +++  LSG +  +IS +S LR LNLSNN+F  +FP +++  LANL+
Sbjct  63   --DVSRR-HVTSLDLSSLNLSGTLSRDISNLSGLRHLNLSNNVFNGSFPDEISSGLANLR  119

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            VLD+YNNN+TGDLP+ V  +T LRHLHLGGNYF+G IPP
Sbjct  120  VLDVYNNNMTGDLPLSVTNLTQLRHLHLGGNYFAGEIPP  158


 Score = 71.6 bits (174),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G+L  L  L +  N  SGP+  E+  +S+L+ ++LSNN+F    P   + L
Sbjct  225  LNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDL  284

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  285  KNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIP  326


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L P +G    +  L +  N+  GP+P E+  +  L  ++ S+N+F      ++++ 
Sbjct  441  LSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRC  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N L+G++P E+  M  L +L+L  N+  G IP
Sbjct  501  KLLTFVDLSRNELSGEIPKEITGMRILNYLNLSRNHLIGSIP  542


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/98 (36%), Positives = 52/98 (53%), Gaps = 0/98 (0%)
 Frame = +1

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            L P++G L  LV    A   L+G +PPEI  +  L  L L  N+F      +L +L++L+
Sbjct  205  LPPEIGNLSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSGPLTWELGKLSSLK  264

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +DL NN  TG++P     + +L  L+L  N   G IP
Sbjct  265  SMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIP  302


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 54/100 (54%), Gaps = 1/100 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P  G  P +  L+++ N+L+G +PPEI  ++TLR L +   N F    P ++  
Sbjct  152  FAGEIPPSYGTWPEIEYLAVSGNELTGKIPPEIGNLTTLRELYIGYFNAFEDGLPPEIGN  211

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSG  576
            L+ L   D  N  L G++P E+ ++  L  L L  N FSG
Sbjct  212  LSELVRFDAANCGLNGEIPPEIGRLQKLDTLFLQVNVFSG  251


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L+ ++G+L  L ++ ++ N  +G +P   S +  L  LNL  N      P  + +L
Sbjct  249  FSGPLTWELGKLSSLKSMDLSNNMFTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGEL  308

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L+VL L+ NN TG +P ++ +   L  + L  N  +G +PP
Sbjct  309  PDLEVLQLWENNFTGSIPEKLGENGRLHLVDLSSNKLTGTLPP  351


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  +VG+L  L  +  + N  SG + PEIS    L F++LS N      P ++  +
Sbjct  465  FEGPIPSEVGKLQQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIPKEITGM  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G +P  +  M SL  L    N  SG +P
Sbjct  525  RILNYLNLSRNHLIGSIPGSISSMQSLTSLDFSYNNLSGLVP  566


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 6/102 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +S ++GQL      S++ NQLSG +PP I   + ++ L L  N F    P ++ +L
Sbjct  423  VTGSVSVNLGQL------SLSNNQLSGQLPPAIGNFTGVQKLLLDGNKFEGPIPSEVGKL  476

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +D  +N  +G +  E+ +   L  + L  N  SG IP
Sbjct  477  QQLSKIDFSHNLFSGRIAPEISRCKLLTFVDLSRNELSGEIP  518


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 47/102 (46%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +      L  L  L++  N+L G +P  I  +  L  L L  N F  + P +L + 
Sbjct  273  FTGEIPSSFSDLKNLTLLNLFRNKLHGEIPEFIGELPDLEVLQLWENNFTGSIPEKLGEN  332

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L ++DL +N LTG LP  +     L  L   GN+  G IP
Sbjct  333  GRLHLVDLSSNKLTGTLPPNMCAGNKLETLITLGNFLFGSIP  374


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L P++     L  L    N L G +P  +    +L  + +  N    + P  L  L
Sbjct  345  LTGTLPPNMCAGNKLETLITLGNFLFGSIPESLGKCESLTRIRMGENFLNGSIPKGLFGL  404

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  ++L +N LTG+LPV      +L  L L  N  SG++PP
Sbjct  405  PKLTQVELQDNYLTGELPVTGSVSVNLGQLSLSNNQLSGQLPP  447



>ref|XP_006853709.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
 gb|ERN15176.1| hypothetical protein AMTR_s00056p00150470 [Amborella trichopoda]
Length=918

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 79/161 (49%), Positives = 109/161 (68%), Gaps = 3/161 (2%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLS  285
            + V     L ++K A   D +SSL +W+   S+++C+W  + CD   +V  LD+S + LS
Sbjct  19   ISVDNSGPLWAVKFAIN-DPESSLETWSKGNSSNYCSWIGIQCDDSGYVSVLDISDMGLS  77

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +SP++G L  L  LS+A N+ SG +P EI+ IS L  LNLSNN+F  TFP  L+ L N
Sbjct  78   GQISPEIGNLQRLTTLSLAVNEFSGQIPAEIARISGLNLLNLSNNLFNGTFPVSLSGLKN  137

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+VLDLYNNNLTG LP  V +++ ++HLHLGGNYF+G IPP
Sbjct  138  LEVLDLYNNNLTGPLPKGVAEISGIKHLHLGGNYFNGEIPP  178


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L+ LS++ NQL+G +P  I    +L+ L L+ N F    P ++  L +L VLDL  NN +
Sbjct  450  LLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGNQFSGEIPPKICSLNDLSVLDLSRNNFS  509

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G++P ++  M SL +L+L  N+  G+IP
Sbjct  510  GEIPAKIAGMRSLTYLNLSKNHLVGQIP  537


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/101 (38%), Positives = 59/101 (58%), Gaps = 0/101 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N+L+G +PPE+  +  L+ L+LSNN      P   A+L
Sbjct  245  LSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNLRVLKSLDLSNNKLSGEIPANFAEL  304

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
             NL++L+L+ N+L G +P  V ++  L  L L  N FSG +
Sbjct  305  KNLKLLNLFINSLKGTIPPFVAELPELEVLQLWDNEFSGEL  345


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             +G + P+ G+L  +  L+++ N+LSG +P E+  ++ L  L L   N F    P +   
Sbjct  172  FNGEIPPEYGKLKEIEYLALSGNELSGNIPKELGNLTKLEQLYLGYFNWFSGGIPPEFGN  231

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  LD+ +  L+G++P E+  +T L  L L  N  +G+IPP
Sbjct  232  LRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPP  275


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 57/128 (45%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++     L  L +  N  SG VP  ++   +L+ + L +N+   + P+ L  L
Sbjct  363  LAGKIPPEICSGGLLQTLILLNNSFSGQVPGSLTTCQSLKRVRLGDNLLNGSLPYGLLSL  422

Query  460  ANLQVLDLYNNNLT-------------------------GDLPVEVYKMTSLRHLHLGGN  564
             NL  L+L NN LT                         G++P  +    SL+ L L GN
Sbjct  423  QNLTQLELKNNKLTGKFFSGNLSVSETLLELSLSNNQLNGEIPAIIGDFGSLQKLFLAGN  482

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  483  QFSGEIPP  490


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P+ G L  L  L +A+  LSG +P EI  ++ L  L L  N      P ++  L
Sbjct  221  FSGGIPPEFGNLRRLFRLDMASCGLSGEIPAEIGNLTLLGTLFLQVNELTGKIPPEMGNL  280

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+ LDL NN L+G++P    ++ +L+ L+L  N   G IPP
Sbjct  281  RVLKSLDLSNNKLSGEIPANFAELKNLKLLNLFINSLKGTIPP  323



>ref|XP_004291349.1| PREDICTED: receptor protein kinase CLAVATA1 [Fragaria vesca subsp. 
vesca]
Length=972

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 73/163 (45%), Positives = 101/163 (62%), Gaps = 6/163 (4%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIST-----SHCTWRRVTCdsllhvvsldlsglN  279
            G  +  ALL +KA+      S L  W  ++     +HC +  VTCD    VV+L++ GL 
Sbjct  22   GNGDLEALLKLKASMIGPKGSGLDDWKTTSLLSPSAHCGFAGVTCDRDFRVVALNVCGLP  81

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-  456
            L G +  ++G L  LVNL+IA N  +G +P EI  ++ LR LN+SNN+F   FP  + Q 
Sbjct  82   LFGKVGVEIGLLTKLVNLTIADNNFTGKLPEEIGNLTALRHLNISNNLFFGKFPGGITQR  141

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L+VLD YNNN TG LPVE+  + +L+HLHLGGNYF+G IP
Sbjct  142  MMELEVLDAYNNNFTGPLPVELVDLKNLKHLHLGGNYFTGPIP  184


 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +  L  L +L +  NQL+G +PP++SA+++L  L+LS N+     P   ++
Sbjct  251  NLTGTIPISLSNLKHLHSLFLQINQLTGFIPPQLSALTSLMSLDLSINLLTGEIPATFSE  310

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ +++LY NNL G +P  V + T L  L +  N F+  +P
Sbjct  311  LKNITLINLYKNNLYGSIPRFVGEFTHLEVLQIWENNFTYELP  353


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 61/103 (59%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            L+G + P +  L  L++L ++ N L+G +P   S +  +  +NL  NN++GS  P  + +
Sbjct  276  LTGFIPPQLSALTSLMSLDLSINLLTGEIPATFSELKNITLINLYKNNLYGS-IPRFVGE  334

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + GN+F+G IP
Sbjct  335  FTHLEVLQIWENNFTYELPENLGRNGRLKDLDVTGNHFTGLIP  377


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++  L  L  ++I+ N LS  +P  IS  S+L   +LS N      P  +A+
Sbjct  490  NFSGEIPMEIFNLKSLAKINISDNNLSSRIPDTISQCSSLTSADLSRNKLVGEIPKGIAK  549

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L +L+   N+LTG +P+++  M SL  L L  N  SG++P
Sbjct  550  LKVLSILNFSRNHLTGPIPMQIRNMISLTTLDLSDNNLSGKLP  592


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N   G +PPE+ ++S+LR L++++     T P  L+ L +L  L L  N LTG +P ++ 
Sbjct  226  NSYDGGIPPELGSLSSLRVLDMASCNLTGTIPISLSNLKHLHSLFLQINQLTGFIPPQLS  285

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             +TSL  L L  N  +G IP
Sbjct  286  ALTSLMSLDLSINLLTGEIP  305


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 58/129 (45%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G L  ++  L  L +L +  N  +GP+P   S I +L +L L+              
Sbjct  154  NFTGPLPVELVDLKNLKHLHLGGNYFTGPIPENYSDILSLEYLGLNGIGLTGKFPASLSR  213

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +L  L++L+VLD+ + NLTG +P+ +  +  L  L L  
Sbjct  214  LKNLKEMYVGYFNSYDGGIPPELGSLSSLRVLDMASCNLTGTIPISLSNLKHLHSLFLQI  273

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  274  NQLTGFIPP  282


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L +L +  N  +G +P ++     LR L L +N F    P  L Q
Sbjct  347  NFTYELPENLGRNGRLKDLDVTGNHFTGLIPKDLCKGRMLRNLILMDNHFFGPIPEDLGQ  406

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N LTG +P  ++ + +   + L  NY SG++P
Sbjct  407  CKSLIKIRMNRNTLTGTIPAGMFSLPNAIMIELNDNYLSGQLP  449



>ref|XP_009405747.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=984

 Score =   122 bits (306),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 77/158 (49%), Positives = 101/158 (64%), Gaps = 6/158 (4%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH---CTWRRVTCdsll-hvvsldlsglNLSGV  291
            + + LLSIK +F   SQS L SWN S++H   C W  V CD     V++LD++  N SG 
Sbjct  35   QASILLSIKRSFH-HSQSLLPSWN-SSAHAALCAWDGVRCDDSNHLVLALDVANSNFSGS  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            LSP + +L  L +LS+A N LSGP P  IS +  LR+LN+SNN F  T     +  A L+
Sbjct  93   LSPAIAELKGLASLSVAGNSLSGPFPHAISELPRLRYLNISNNQFNGTLNWSFSDTAELE  152

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            VLD Y+N+ +G LPV + ++T LRHL LGGNYFSG IP
Sbjct  153  VLDAYDNDFSGPLPVGLPRLTKLRHLDLGGNYFSGAIP  190


 Score = 67.8 bits (164),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 43/127 (34%), Positives = 64/127 (50%), Gaps = 24/127 (19%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFP------  441
            L G + P++G L  L  L +  NQL+G +P ++  +S+LR+L++SNN      P      
Sbjct  258  LEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIPKEFSKL  317

Query  442  HQL------------------AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  567
            HQL                  A+L +L+VL L+ NN TG +P  + +   LR L L  N 
Sbjct  318  HQLTLLHVFMNRLHSEIPGFVAELPSLEVLKLWQNNFTGSIPAALGRNGRLRELDLSTNK  377

Query  568  FSGRIPP  588
             +G IPP
Sbjct  378  LTGLIPP  384


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G L  L++L +++  L G +PPE+  +  L  L L  N      P QL  L
Sbjct  234  FDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELGNLKNLDTLFLQTNQLTGAIPFQLGNL  293

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LD+ NN LTG++P E  K+  L  LH+  N     IP
Sbjct  294  SSLRYLDISNNALTGEIPKEFSKLHQLTLLHVFMNRLHSEIP  335


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +G L  ++ + ++ N  SG +PPEI   S+L +L+LS+N      P +++Q+
Sbjct  499  FAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQV  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N L+  +P E+  M SL       N FSG+IP
Sbjct  559  RILSYLNLSWNRLSQRIPQEMASMKSLTSADFSHNDFSGKIP  600


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQL+GP+P  IS +  L +LNLS N      P ++A 
Sbjct  522  NFSGRIPPEIGDCSSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIPQEMAS  581

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  582  MKSLTSADFSHNDFSGKIP  600


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +L G + P++G +  L  L +   N+  G VP EI  +  L  L+LS+       P +L 
Sbjct  208  DLGGFIPPELGNVTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPPELG  267

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L NL  L L  N LTG +P ++  ++SLR+L +  N  +G IP
Sbjct  268  NLKNLDTLFLQTNQLTGAIPFQLGNLSSLRYLDISNNALTGEIP  311


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    L  L +  N+ +G +P ++  +  +  +++S N F    P ++   
Sbjct  475  LTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRNNFSGRIPPEIGDC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L  LDL +N L G +P  + ++  L +L+L  N  S RIP
Sbjct  535  SSLTYLDLSHNQLAGPIPARISQVRILSYLNLSWNRLSQRIP  576


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/105 (31%), Positives = 49/105 (47%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG L   + +L  L +L +  N  SG +P      S + +L+L+ N  G   P +L  
Sbjct  160  DFSGPLPVGLPRLTKLRHLDLGGNYFSGAIPFAYGGFSAITYLSLAGNDLGGFIPPELGN  219

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +  L+ L L Y N   G +P E+  +  L HL L      G IPP
Sbjct  220  VTTLKQLYLGYYNEFDGGVPAEIGNLIGLLHLDLSSCGLEGEIPP  264


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 54/128 (42%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  L L NN        + AQ 
Sbjct  402  LFGPLPDDLGDCMTLSRVRMGQNYLTGSIPRGFLYLPELSLLELQNNYLTGVVAEEPAQK  461

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYF----------------------  570
             A L +L+L NN LTG LP  +   +SL+ L LGGN F                      
Sbjct  462  PAKLGLLNLSNNRLTGPLPSSIGNFSSLQILLLGGNEFAGEIPSQLGLLKQVLKVDMSRN  521

Query  571  --SGRIPP  588
              SGRIPP
Sbjct  522  NFSGRIPP  529



>ref|XP_002510557.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
 gb|EEF52744.1| Receptor protein kinase CLAVATA1 precursor, putative [Ricinus 
communis]
Length=985

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 106/162 (65%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglN-L  282
            G ++   LL +K++  A + S L  W  S S   HC++  VTCD    VVSL+L+  +  
Sbjct  25   GYSDAELLLKLKSSMIARNGSGLQDWEPSPSPSAHCSFSGVTCDKDSRVVSLNLTSRHGF  84

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNLSIA+  L+G +P E++ +++LR  N+SNN F   FP ++   +
Sbjct  85   FGFIPPEIGLLNKLVNLSIASLNLTGRLPLELAQLTSLRIFNISNNAFIGNFPGEITLVM  144

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LD+YNNN +G LP+E+ K+ +L+HLHLGGNYFSG IP
Sbjct  145  TQLQILDIYNNNFSGLLPLELIKLKNLKHLHLGGNYFSGTIP  186


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P +GQL  L +L +  N+LSG +PPE+S + +L+ L+LS N      P   ++
Sbjct  253  NLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLISLQSLDLSINSLKGEIPASFSK  312

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ ++ L+ NNL G++P  +    +L  LH+  N F+  +P
Sbjct  313  LKNITLIHLFQNNLGGEIPEFIGDFPNLEVLHVWENNFTLELP  355


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +  LP +  L +  N  SG +P E+S I+ L  L +SNN+   + P  L  L
Sbjct  422  LSGTIPSGIFNLPSMAILELNDNYFSGELPSEMSGIA-LGLLKISNNLISGSIPETLGNL  480

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NLQ++ L  N L+G++P E++ +  L  ++   N  SG IPP
Sbjct  481  RNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPP  523


 Score = 67.8 bits (164),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L +L  ++ +AN LSG +PP IS  ++L  ++ S N      P ++A L
Sbjct  493  LSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHCTSLTSVDFSRNNLHGQIPVEIANL  552

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L++  N+LTG +P ++  MTSL  L L  N   GR+P
Sbjct  553  KDLSILNVSQNHLTGQIPGDIRIMTSLTTLDLSYNNLLGRVP  594


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A + LSG +PP +  +  L  L L  N      P +L+ L +
Sbjct  232  GGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQMNRLSGHIPPELSDLIS  291

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LQ LDL  N+L G++P    K+ ++  +HL  N   G IP
Sbjct  292  LQSLDLSINSLKGEIPASFSKLKNITLIHLFQNNLGGEIP  331


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/129 (30%), Positives = 61/129 (47%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG+L  ++ +L  L +L +  N  SG +P   SAI +L +L L+ N      P  LA+
Sbjct  156  NFSGLLPLELIKLKNLKHLHLGGNYFSGTIPESYSAIESLEYLGLNGNSLSGKVPASLAK  215

Query  457  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL                         ++LD+  +NL+G++P  + ++ +L  L L  
Sbjct  216  LKNLRKLYLGYFNSWEGGIPPEFGSLSSLEILDMAQSNLSGEIPPSLGQLKNLNSLFLQM  275

Query  562  NYFSGRIPP  588
            N  SG IPP
Sbjct  276  NRLSGHIPP  284


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG +   +G L  L  + +  N+LSG +P EI  +  L  +N S N      P  ++  
Sbjct  469  ISGSIPETLGNLRNLQIIKLEINRLSGEIPNEIFNLKYLTAINFSANNLSGDIPPSISHC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +D   NNL G +PVE+  +  L  L++  N+ +G+IP
Sbjct  529  TSLTSVDFSRNNLHGQIPVEIANLKDLSILNVSQNHLTGQIP  570


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G    L  L ++ N L+G +P ++     L+ L L  N F    P +L Q
Sbjct  349  NFTLELPKNLGSSGKLKMLDVSYNHLTGLIPKDLCKGGRLKELVLMKNFFLGPLPDELGQ  408

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + + NN L+G +P  ++ + S+  L L  NYFSG +P
Sbjct  409  CKSLYKIRVANNMLSGTIPSGIFNLPSMAILELNDNYFSGELP  451


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L +  N   GP+P E+    +L  + ++NN+   T P  +  
Sbjct  373  HLTGLIPKDLCKGGRLKELVLMKNFFLGPLPDELGQCKSLYKIRVANNMLSGTIPSGIFN  432

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L ++ +L+L +N  +G+LP E+  + +L  L +  N  SG IP
Sbjct  433  LPSMAILELNDNYFSGELPSEMSGI-ALGLLKISNNLISGSIP  474



>dbj|BAJ89729.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=1030

 Score =   122 bits (305),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 90/145 (62%), Gaps = 8/145 (6%)
 Frame = +1

Query  178  SLTSWNISTS--------HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNL  333
            +L SW +  +        HC W  V+C +   V  L L GLNLSG L P + +L  L+ L
Sbjct  40   ALASWEVPAAASNGTGYAHCAWAGVSCGARGAVAGLALGGLNLSGALPPALSRLRGLLRL  99

Query  334  SIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLP  513
             + AN LSGPVP  +  +  L  LNLSNN F  + P  LA+L  L+VLDLYNNNLT  LP
Sbjct  100  DVGANALSGPVPAALGHLRFLTHLNLSNNAFNGSLPPALARLRGLRVLDLYNNNLTSPLP  159

Query  514  VEVYKMTSLRHLHLGGNYFSGRIPP  588
            +EV +M  LRHLHLGGN+FSG IPP
Sbjct  160  IEVAQMPMLRHLHLGGNFFSGEIPP  184


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 37/105 (35%), Positives = 55/105 (52%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L LS N      P +L  
Sbjct  153  NLTSPLPIEVAQMPMLRHLHLGGNFFSGEIPPEYGRWTRLQYLALSGNELSGKIPPELGN  212

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N  +G +P E+  +T L  L       SG+IPP
Sbjct  213  LTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPP  257


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+GVL   +G    +  L +  N  SG +P E+  +  L   +LS N      P ++ + 
Sbjct  468  LTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NNL+G +P  +  M  L +L+L  N+  G IPP
Sbjct  528  RLLTYLDLSRNNLSGKIPPAISGMRILNYLNLSRNHLDGEIPP  570


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P ++ ++ +L  L+LSNN      P   +QL
Sbjct  251  LSGKIPPELGRLQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPPSFSQL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVP  352


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG L  +VG+L  L    ++ N + G VPPE+     L +L+LS N      P  ++ 
Sbjct  491  SFSGALPAEVGRLQQLSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPPAISG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLDGEIPPSISTMQSLTAVDFSYNNLSGLVP  593


 Score = 56.6 bits (135),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 53/101 (52%), Gaps = 6/101 (6%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G  +P++G+    +NLS   NQL+G +P  I   S ++ L L  N F    P ++ +L  
Sbjct  452  GAAAPNLGE----INLS--NNQLTGVLPASIGNFSGVQKLLLDRNSFSGALPAEVGRLQQ  505

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L   DL  N + G +P EV K   L +L L  N  SG+IPP
Sbjct  506  LSKADLSGNAIEGGVPPEVGKCRLLTYLDLSRNNLSGKIPP  546


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 27/81 (33%), Positives = 41/81 (51%), Gaps = 0/81 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N L+G +PP  S +  +  LNL  N      P  +  L +L+VL L+ NN TG +P  + 
Sbjct  297  NALAGEIPPSFSQLKNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGSVPRRLG  356

Query  526  KMTSLRHLHLGGNYFSGRIPP  588
                L+ + L  N  +G +PP
Sbjct  357  GNNRLQLVDLSSNRLTGTLPP  377


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG + P++G L  L  L I   N  SG VPPE+  ++ L  L+ +N       P +L +
Sbjct  202  LSGKIPPELGNLTSLRELYIGYYNAYSGGVPPELGNLTDLVRLDAANCGLSGKIPPELGR  261

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L  L L  N LTG +P ++  + SL  L L  N  +G IPP
Sbjct  262  LQKLDTLFLQVNGLTGAIPSDLGSLKSLSSLDLSNNALAGEIPP  305



>gb|KEH33614.1| LRR receptor-like kinase family protein [Medicago truncatula]
Length=985

 Score =   122 bits (305),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 100/164 (61%), Gaps = 6/164 (4%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldl---sg  273
            L +  QA++L S+K  F   S +SL+SWN+S   S CTW  + CD  +  +S+     S 
Sbjct  25   LSLKNQASILVSMKQDFEPSSNTSLSSWNMSNYMSLCTWYGIQCDHTITNMSIVSLDISN  84

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            LN+SG  SP + +L  LVN+SI  N   G  P EI  +  L+ LN+SNN+F      +  
Sbjct  85   LNISGSFSPQITKLYNLVNVSIQGNSFYGEFPTEIHKLQRLKCLNISNNMFSGNLSWEFN  144

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  L+VLD+YNN   G LP  V +++SL+HL+ GGNYFSG+IP
Sbjct  145  KLKELEVLDIYNNGFNGSLPRGVTQVSSLKHLNFGGNYFSGKIP  188


 Score = 63.9 bits (154),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G  P L  L ++ N+ SG +P +I  +  +  L++S+N F  T P ++ + 
Sbjct  474  LSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFSGTIPSEIGKC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N  +G +P+++ ++  L HL++  N+ +  IP
Sbjct  534  TLLTYLDLSQNQFSGPIPIQLAQIHILNHLNVSWNHLNQSIP  575


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N F S  P  +++L
Sbjct  280  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIPDFISEL  339

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L+ NN TG +P ++ +   L  + L  N  +G +P
Sbjct  340  PKLEVLKLWRNNFTGVIPSKLGQNGRLTEVDLSTNKLTGILP  381


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 48/88 (55%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L   +++ N+LSG +P  I     L+ L LS N F    P  + +L  +  LD+ +NN +
Sbjct  464  LEQCNLSNNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIPSDIGKLKKILKLDISSNNFS  523

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G +P E+ K T L +L L  N FSG IP
Sbjct  524  GTIPSEIGKCTLLTYLDLSQNQFSGPIP  551


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++GQL  L  L +  NQL+G +PPE+  +S L  L+LS N      P++ + L
Sbjct  256  LKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNL  315

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N    ++P  + ++  L  L L  N F+G IP
Sbjct  316  RELSLLNLFINKFHSEIPDFISELPKLEVLKLWRNNFTGVIP  357


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 50/104 (48%), Gaps = 2/104 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA--  453
            L G L  D+GQ   L  + I  N  +G +P     +  L  L L NN      P Q    
Sbjct  400  LFGSLPNDLGQCYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIPQQTHKN  459

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + + L+  +L NN L+G LP  +    +L+ L L GN FSG+IP
Sbjct  460  KTSKLEQCNLSNNRLSGSLPTSIGNFPNLQTLQLSGNRFSGQIP  503


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G++  L  LS+A N LSG +P E+  +++L  L L   N F    P +  +
Sbjct  183  FSGKIPTSYGEMKQLNFLSLAGNDLSGFLPSELGNLTSLENLYLGYFNQFDGGVPKEFGK  242

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL +  L G +P+E+ ++  L  L L  N  +G IPP
Sbjct  243  LINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPP  286


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +GV+   +GQ   L  + ++ N+L+G +P  +     L+ L L NN    + P+ L Q
Sbjct  351  NFTGVIPSKLGQNGRLTEVDLSTNKLTGILPKSLCFGKRLKILILLNNFLFGSLPNDLGQ  410

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               LQ + +  N  TG +P     + +L  L L  NY SG IP
Sbjct  411  CYTLQRVRIGQNYFTGSIPHGFLYLPNLSLLELQNNYLSGVIP  453


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  + G+L  LV+L +A+  L G +P E+  ++ L  L L  N      P +L  L
Sbjct  232  FDGGVPKEFGKLINLVHLDLASCFLKGSIPLELGQLNKLDTLFLQKNQLTGFIPPELGNL  291

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + L  LDL  NNLTG +P E   +  L  L+L  N F   IP
Sbjct  292  SRLNALDLSLNNLTGGIPNEFSNLRELSLLNLFINKFHSEIP  333



>ref|XP_004295533.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Fragaria vesca subsp. vesca]
Length=982

 Score =   121 bits (304),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 72/158 (46%), Positives = 96/158 (61%), Gaps = 5/158 (3%)
 Frame = +1

Query  127  QAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            QA++L S+K  F A S  SL+SWN+S     C+W  + CD+L   V        NLSG L
Sbjct  29   QASILASVKQGFEA-SDPSLSSWNVSNYKFLCSWAGIMCDNLSRSVISLDVSNYNLSGSL  87

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SPD+ +L  LVNLS++ N  SG  P  I  +  L++LN+SNN FG +   + AQL  L +
Sbjct  88   SPDITELRTLVNLSVSGNDFSGSFPAGIHKLPRLQYLNISNNGFGGSMDWEFAQLKELIL  147

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP
Sbjct  148  LDAYNNDFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPP  185


 Score = 65.5 bits (158),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH++A+L
Sbjct  276  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIPHEIAEL  335

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL L+ NN TG +P ++ +   L  L L  N  +G +P
Sbjct  336  PNLEVLKLWQNNFTGAIPSKLGQNGKLVELDLSTNKLTGEVP  377


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 53/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V QLP L  L    N  SG +PP    +S L +L+++ N      P +L  
Sbjct  154  DFNGSLPLGVTQLPKLKRLDFGGNYFSGSIPPSYGNMSQLNYLSVAGNDLSGFIPSELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L Y N+  G +P E+ K+T+L HL L      G IPP
Sbjct  214  LTNLTQLFLGYYNDFDGGIPPEIGKLTNLFHLDLANCGLEGSIPP  258


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 50/89 (56%), Gaps = 0/89 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L++++N+LSG  P  I   S+L+ L LS N F    P  + +L N+  LD+  NN +
Sbjct  460  LSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSRNNFS  519

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            G +P E+   T L +L L  N  SG IPP
Sbjct  520  GSIPPEIGNCTLLTYLDLSQNQLSGPIPP  548


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQLSGP+PP++  I  L + N+S N    + P +L  
Sbjct  517  NFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQIHILNYFNVSWNHLNQSLPKELGS  576

Query  457  LANLQVLDLYNNNLTGDLP  513
            L +L   D  +N+ +G +P
Sbjct  577  LKSLTSADFSHNSFSGSVP  595


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G + P++G+L  L +L +A   L G +PPE+  +  L  L L  N    + P QL  
Sbjct  227  DFDGGIPPEIGKLTNLFHLDLANCGLEGSIPPELGNLKKLDTLFLQTNQLSGSIPAQLGN  286

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L++L+ LDL NN LTGD+PVE   +  L  L+L  N F G IP
Sbjct  287  LSSLRSLDLSNNALTGDIPVEFSALRELTLLNLFINKFHGEIP  329


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  D+G+L  ++ L ++ N  SG +PPEI   + L +L+LS N      P Q+ Q+
Sbjct  494  FTGEIPSDIGRLRNVLKLDMSRNNFSGSIPPEIGNCTLLTYLDLSQNQLSGPIPPQVVQI  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L   ++  N+L   LP E+  + SL       N FSG +P
Sbjct  554  HILNYFNVSWNHLNQSLPKELGSLKSLTSADFSHNSFSGSVP  595


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 61/129 (47%), Gaps = 26/129 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  387
            L G L  D+G+   LV + +  N LSG +P      PE++ +                  
Sbjct  396  LFGPLPDDLGECDTLVRVRLGQNYLSGSIPRGFLYLPELTLMELQNNYLTGQLDMQEKSQ  455

Query  388  --STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
              S L  LNLS+N    + P  +   ++LQ+L L  N  TG++P ++ ++ ++  L +  
Sbjct  456  VPSKLSQLNLSSNRLSGSPPASIGNFSSLQILLLSGNRFTGEIPSDIGRLRNVLKLDMSR  515

Query  562  NYFSGRIPP  588
            N FSG IPP
Sbjct  516  NNFSGSIPP  524



>ref|XP_009334873.1| PREDICTED: receptor protein kinase CLAVATA1 [Pyrus x bretschneideri]
Length=973

 Score =   121 bits (303),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 69/158 (44%), Positives = 99/158 (63%), Gaps = 1/158 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVL  294
            G  +  ALL +KAA      S L  WN S+SHC +  V CD    VVSL++S + L G +
Sbjct  26   GHRDLDALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVSLNVSNIPLFGTI  85

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQ  471
               +G L  LVNL I  + L+G +P E++ ++ L+ LN+SNN F  +FP ++   + +L+
Sbjct  86   PAAIGLLDKLVNLKITDDNLTGRLPAEMANLTALKHLNISNNAFSGSFPGEIMLGMTDLE  145

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            VLD YNNN  G LPVE+  + +++HLHLGGNY +G IP
Sbjct  146  VLDAYNNNFNGTLPVELASLKNIKHLHLGGNYITGEIP  183


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 42/128 (33%), Positives = 61/128 (48%), Gaps = 26/128 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS--------------  414
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S              
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISDSISR  524

Query  415  -----------NNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                       NN+ G   P  +A+L  L +L+   N LTG++P E+  MTSL  L L  
Sbjct  525  CSSLTSVDLSRNNLVGE-IPRGIAKLKVLSILNFSRNQLTGEIPAEIRYMTSLTTLDLSN  583

Query  562  NYFSGRIP  585
            N F GR+P
Sbjct  584  NNFVGRLP  591


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL G +   +  L  L +L +  N+LSG +PP++SA++ L  L+LS N      P   ++
Sbjct  250  NLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNRLMSLDLSINELTGEIPESFSE  309

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +++LY NNL G +P  V  +  L  L +  N F+  +P
Sbjct  310  LKNLTLVNLYKNNLYGQIPKFVGDLPYLEVLQIWENNFTFELP  352


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P +  L  L++L ++ N+L+G +P   S +  L  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPQLSALNRLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGQ-IPKFVGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  334  LPYLEVLQIWENNFTFELPENLGRNGRLKDLDVTGNHLTGLIP  376


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 57/129 (44%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++  L  + +L +  N ++G +P + S I +L +L L+ N+     P  L++
Sbjct  153  NFNGTLPVELASLKNIKHLHLGGNYITGEIPEDYSEIQSLEYLGLNGNLLTGKLPASLSR  212

Query  457  LAN-------------------------LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L N                         LQVLD+ + NL G +P  +  +  L  L L  
Sbjct  213  LKNLREMYVGYYNSYDGGIPPELGSLSSLQVLDMSSCNLVGPIPTTLSLLKHLYSLFLQV  272

Query  562  NYFSGRIPP  588
            N  SG IPP
Sbjct  273  NRLSGSIPP  281


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L  L +++  L GP+P  +S +  L  L L  N    + P QL+ L  
Sbjct  229  GGIPPELGSLSSLQVLDMSSCNLVGPIPTTLSLLKHLYSLFLQVNRLSGSIPPQLSALNR  288

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  LDL  N LTG++P    ++ +L  ++L  N   G+IP
Sbjct  289  LMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGQIP  328


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCKGGHLKTAILMDNHFFGPIPEELGLCNSLVKIRMMKNTLTGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL +++L +N L+G+LP ++    ++  L L GN+ SG+IPP
Sbjct  430  LPNLIMIELNDNFLSGELPEQI-SGGNIGILTLSGNHISGKIPP  472



>emb|CDP04113.1| unnamed protein product [Coffea canephora]
Length=987

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 73/156 (47%), Positives = 97/156 (62%), Gaps = 3/156 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsglNLSGVLS  297
            + + L+S+K  F   S  SL SWN+S     C W  +TCD    VVSLD+S LNLSG LS
Sbjct  38   QASVLVSVKQKFQTSS-PSLDSWNMSNYMFLCMWNGITCDENRLVVSLDISNLNLSGSLS  96

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P + +L  L+N+S+A N   G   PEI     LR LNLSNN+F      + + L  L+VL
Sbjct  97   PAITELRSLINISVAGNGFFGVFLPEIHKFENLRILNLSNNVFSGNLSWEFSHLQELEVL  156

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            D YNNN +G LP  + ++  L++L+LGGNYFSG+IP
Sbjct  157  DGYNNNFSGPLPFGISQLQKLQYLNLGGNYFSGQIP  192


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G L  L  L +  NQL+G +PP++  +++L+ L+LSNN+     P +L+ L
Sbjct  260  LVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPL  319

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G++P  V ++  L  L L  N F+G IP
Sbjct  320  QELTLLNLFMNRLHGEIPQFVEELPQLEVLKLWQNNFTGSIP  361


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L+++ N+LSGP+P  I   S L+ L L+ N F    P ++  L N+  LD+  NN +
Sbjct  467  LEGLNLSNNRLSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFS  526

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G++P E+ K  SL +L L  N  SG IP
Sbjct  527  GNIPPEIGKCLSLTYLDLSQNQLSGPIP  554


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G+L  LV+L +A   L GP+P E+  +  L  L L  N    + P QL  L
Sbjct  236  FDGGIPSELGKLINLVHLDLANCGLVGPIPAELGHLKMLDTLFLQTNQLNGSIPPQLGNL  295

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A+L+ LDL NN LTG++P E+  +  L  L+L  N   G IP
Sbjct  296  ASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIP  337


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +G L  L +L ++ N L+G +P E+S +  L  LNL  N      P  + +L
Sbjct  284  LNGSIPPQLGNLASLKSLDLSNNVLTGEIPAELSPLQELTLLNLFMNRLHGEIPQFVEEL  343

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L+ NN TG +P ++ +   L  L    N  +G +P
Sbjct  344  PQLEVLKLWQNNFTGSIPQKLGQNGKLIELDFSTNKLTGLVP  385


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 54/101 (53%), Gaps = 1/101 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA-  462
            G L  D+G+   L  + +  N LSG +P     +  L  + L NN+         AQ++ 
Sbjct  406  GPLPDDLGRCKSLSRVRLGQNFLSGSIPHGFLYLPDLSLMELQNNLLAGQLEETNAQVST  465

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L+ L+L NN L+G LP+ + K + L+ L L GN+FSG IP
Sbjct  466  KLEGLNLSNNRLSGPLPISIGKFSGLKILLLNGNHFSGNIP  506


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G+   L  L +  N  SG +P EI ++  +  L++S N F    P ++ + 
Sbjct  477  LSGPLPISIGKFSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFSGNIPPEIGKC  536

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N L+G +PV++ ++  L + ++  N+ S ++P
Sbjct  537  LSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLP  578


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G+   L  L ++ NQLSGP+P +I+ I  L + N+S N      P ++  
Sbjct  524  NFSGNIPPEIGKCLSLTYLDLSQNQLSGPIPVQIAQIHILNYFNISWNHLSQKLPKEIGS  583

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  584  IKSLTSADFSHNNFSGSIP  602


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G L  L  LS+A N  SG +P E   +++L++L L   N F    P +L +
Sbjct  187  FSGQIPASYGGLNQLNFLSLAGNDFSGFIPGEFGNLTSLQWLYLGYFNTFDGGIPSELGK  246

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL N  L G +P E+  +  L  L L  N  +G IPP
Sbjct  247  LINLVHLDLANCGLVGPIPAELGHLKMLDTLFLQTNQLNGSIPP  290


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/104 (33%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAIST-LRFLNLSNNIFGSTFPHQLAQ  456
            LSG +      LP L  + +  N L+G +    + +ST L  LNLSNN      P  + +
Sbjct  428  LSGSIPHGFLYLPDLSLMELQNNLLAGQLEETNAQVSTKLEGLNLSNNRLSGPLPISIGK  487

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + L++L L  N+ +G++P E+  + ++  L +  N FSG IPP
Sbjct  488  FSGLKILLLNGNHFSGNIPSEIGSLGNMLRLDMSKNNFSGNIPP  531



>ref|XP_009418700.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Musa acuminata subsp. malaccensis]
Length=993

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 69/159 (43%), Positives = 103/159 (65%), Gaps = 2/159 (1%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWN-ISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            G  +  AL+ +KAA  A   S+L +W+  S  +C++  V CD    VV+L+ +G+ L+G 
Sbjct  24   GDADLEALIKLKAALVAPGSSALGNWDPASADYCSFTGVACDENSRVVALNFTGVQLNGT  83

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPH-QLAQLANL  468
            L P++G L  LVNL+++ + + GP+P E++A+ +LR LN+SNN F   FPH        L
Sbjct  84   LPPEIGILSGLVNLTVSCSGVVGPLPMELAALPSLRLLNVSNNNFSGAFPHVGPGGFPTL  143

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +V+D YNNN +G LP+ +    SLR+LHLGGNYF+G IP
Sbjct  144  EVIDAYNNNFSGRLPLGLAAAPSLRYLHLGGNYFNGTIP  182


 Score = 81.3 bits (199),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 62/103 (60%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +G LP L NL++ +NQ+SG +PPEI  +  L  LNLS N      P  L + 
Sbjct  465  ITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRC  524

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            ++L ++DL  NNLTG +PV +  +  L  L+L  N  SG IPP
Sbjct  525  SSLVMIDLSRNNLTGAIPVRIPALQILNTLNLSRNQISGVIPP  567


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P++GQL  L  L+++ N LSG +P +++  S+L  ++LS N      P ++  L
Sbjct  489  ISGAIPPEIGQLKQLSKLNLSGNSLSGDIPVDLTRCSSLVMIDLSRNNLTGAIPVRIPAL  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N ++G +P E+ +M SL    L  N  +G IP
Sbjct  549  QILNTLNLSRNQISGVIPPEMQRMRSLTIFDLSYNRLAGVIP  590


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L +L ++ N+L+G VP   + +  L+ L+L  N      P  +A+L
Sbjct  274  LSGSIPPELGGLSMLESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPPFVAEL  333

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VL+L+ NN T  LP  + +   L  L +  N  +G IPP
Sbjct  334  PNLEVLELWENNFTMQLPESLGRNGRLLKLDVASNRITGTIPP  376


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N ++G +PP I ++  L+ L L +N      P ++ QL  L  L+L  N+L+GD+
Sbjct  458  LALSNNLITGSIPPAIGSLPALQNLALDSNQISGAIPPEIGQLKQLSKLNLSGNSLSGDI  517

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            PV++ + +SL  + L  N  +G IP
Sbjct  518  PVDLTRCSSLVMIDLSRNNLTGAIP  542


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/101 (37%), Positives = 55/101 (54%), Gaps = 0/101 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  LV L +A   LSGP+P  + ++  L  L L  N    + P +L  L+ 
Sbjct  228  GGIPPELGMLSSLVRLDMAGCGLSGPIPASLGSLKHLDTLFLQINRLSGSIPPELGGLSM  287

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+ LDL  N LTG++P    ++  L+ L L  N+  G IPP
Sbjct  288  LESLDLSINELTGEVPESFAELKELKLLSLFRNHIRGAIPP  328


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 49/103 (48%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + PD+     L  L +  N   GP+P ++    +L  + L+ N    + P  L  L
Sbjct  370  ITGTIPPDLCASGRLETLVLMENGFFGPIPEKLGECKSLTRVRLAKNFLNGSIPAGLFDL  429

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +  +L+L  N L+GDLP  V     L  L L  N  +G IPP
Sbjct  430  PSNDMLELSENFLSGDLP-PVIAGNKLGMLALSNNLITGSIPP  471



>ref|XP_002300697.2| receptor protein kinase [Populus trichocarpa]
 gb|EEE79970.2| receptor protein kinase [Populus trichocarpa]
Length=973

 Score =   120 bits (302),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/162 (42%), Positives = 103/162 (64%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G +E   LL +K++    + + L  W  S    ++HC +  VTCD    VVSL+LS  +L
Sbjct  21   GYSELEVLLKLKSSMYGHNGTGLEDWVASPTSPSAHCFFSGVTCDESSRVVSLNLSFRHL  80

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL++A + L+G +P EI+ + +LR LN+S N  G  F  ++   +
Sbjct  81   PGSIPPEIGLLNKLVNLTLANDNLTGELPAEIAMLKSLRILNISGNAIGGNFSGKITPGM  140

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VLD+YNNN +G LP+E+  +  L+HLHLGGN+FSG+IP
Sbjct  141  TQLEVLDIYNNNCSGPLPIEIANLKKLKHLHLGGNFFSGKIP  182


 Score = 70.5 bits (171),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L  L  +SI AN +SG +P  +   ++L  ++ S N      P ++ +L
Sbjct  489  LSGEIPDEIFSLEILSKISIRANNISGEIPASMFHCTSLTSVDFSQNSISGEIPKEITKL  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +LDL  N LTG LP E+  MTSL  L+L  N   GRIP
Sbjct  549  KDLSILDLSRNQLTGQLPSEIRYMTSLTTLNLSYNNLFGRIP  590


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++  L  L +L ++ N L+G +P   SA+  L  LNL  N      P  +  
Sbjct  273  NLTGYIPSELSGLISLKSLDLSINNLTGEIPESFSALKNLTLLNLFQNKLHGPIPDFVGD  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              NL+VL ++ NN T +LP ++ +   L +L +  N+ +G +P
Sbjct  333  FPNLEVLQVWGNNFTFELPKQLGRNGKLMYLDVSYNHLTGLVP  375


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L   +G+   L+ L ++ N L+G VP ++     L+ L L NN F  + P ++ Q
Sbjct  345  NFTFELPKQLGRNGKLMYLDVSYNHLTGLVPRDLCKGGKLKTLILMNNFFIGSLPEEIGQ  404

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              +L  + +  N  TG +P  ++ +  +  + L  NYFSG +PP
Sbjct  405  CKSLLKIRIICNLFTGTIPAGIFNLPLVTQIELSHNYFSGELPP  448


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L P++     L +LS++ N+++G +P  I  + +L+FL+L  N      P ++  L
Sbjct  442  FSGELPPEISG-DALGSLSVSDNRITGRIPRAIGNLKSLQFLSLEMNRLSGEIPDEIFSL  500

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  + +  NN++G++P  ++  TSL  +    N  SG IP
Sbjct  501  EILSKISIRANNISGEIPASMFHCTSLTSVDFSQNSISGEIP  542


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +      L  L  L++  N+L GP+P  +     L  L +  N F    P QL +
Sbjct  297  NLTGEIPESFSALKNLTLLNLFQNKLHGPIPDFVGDFPNLEVLQVWGNNFTFELPKQLGR  356

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  LD+  N+LTG +P ++ K   L+ L L  N+F G +P
Sbjct  357  NGKLMYLDVSYNHLTGLVPRDLCKGGKLKTLILMNNFFIGSLP  399


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 57/128 (45%), Gaps = 25/128 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L  ++  L  L +L +  N  SG +P E S I  L FL L+ N      P  L++
Sbjct  152  NCSGPLPIEIANLKKLKHLHLGGNFFSGKIPEEYSEIMILEFLGLNGNDLSGKVPSSLSK  211

Query  457  L-------------------------ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L                         +NL++LD+ + NL G++P  + ++T L  L L  
Sbjct  212  LKNLKSLCIGYYNHYEGGIPPEFGSLSNLELLDMGSCNLNGEIPSTLGQLTHLHSLFLQF  271

Query  562  NYFSGRIP  585
            N  +G IP
Sbjct  272  NNLTGYIP  279



>ref|XP_011004294.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X1 [Populus euphratica]
Length=988

 Score =   121 bits (303),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPP  192


 Score = 70.1 bits (170),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIP  553


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIP  360


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIP  336


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVP  384


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSIP  601


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 55.8 bits (133),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI-STLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +      LP L  + +  N LSG VP +IS   S L  +NL++N      P  +  
Sbjct  427  LTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGN  486

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +NLQ+L L  N  TG++P ++ ++ ++  L +  N  SG IPP
Sbjct  487  FSNLQILLLSGNRFTGEIPSQIGQLKNVFTLDMSRNNLSGNIPP  530


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPP
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPP  289


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q+++ 
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             + L  ++L +N L+G LP  +   ++L+ L L GN F+G IP
Sbjct  463  PSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIP  505



>emb|CBI19895.3| unnamed protein product [Vitis vinifera]
Length=809

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 5/156 (3%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTS----HCTWRRVTCdsllhvvsldlsglNLSGVLSP  300
             LL +++       S L  W   +S    HC++  V+CD    VVSL+LS + L G + P
Sbjct  29   VLLKLRSFMIGPKGSGLEDWVDDSSSLFPHCSFSGVSCDEDSRVVSLNLSFVTLFGSIPP  88

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLANLQVL  477
            ++G L  LVNL++A + L+G +P E++ +++L+ +NLSNN F   FP + L  +  L+VL
Sbjct  89   EIGMLNKLVNLTLACDNLTGKLPMEMAKLTSLKLVNLSNNNFNGQFPGRILVGMKELEVL  148

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            D+YNNN TG LP EV K+  L+H+HLGGNYFSG IP
Sbjct  149  DMYNNNFTGPLPTEVGKLKKLKHMHLGGNYFSGDIP  184


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 42/125 (34%), Positives = 65/125 (52%), Gaps = 22/125 (18%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P +G+L  L +L +  NQLSG +P E+S +  L+ L+LSNN+     P   +Q
Sbjct  251  NLTGEIPPSLGRLKMLHSLFLQLNQLSGHLPQELSGLVNLKSLDLSNNVLTGEIPESFSQ  310

Query  457  LANLQVLDLY----------------------NNNLTGDLPVEVYKMTSLRHLHLGGNYF  570
            L  L +++L+                      NN +TG +P  +  ++SL+ L L  N F
Sbjct  311  LRELTLINLFGNQLRELPAHISGDVLGIFTVSNNLITGKIPPAIGNLSSLQTLALQINRF  370

Query  571  SGRIP  585
            SG IP
Sbjct  371  SGEIP  375


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  +VG+L  L ++ +  N  SG +P   S I +L  L L+ N      P  L +
Sbjct  154  NFTGPLPTEVGKLKKLKHMHLGGNYFSGDIPDVFSDIHSLELLGLNGNNLSGRIPTSLVR  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NLQ L L Y N   G +P E+  ++SLR L LG    +G IPP
Sbjct  214  LSNLQGLFLGYFNIYEGGIPPELGLLSSLRVLDLGSCNLTGEIPP  258


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L  L + +  L+G +PP +  +  L  L L  N      P +L+ L N
Sbjct  230  GGIPPELGLLSSLRVLDLGSCNLTGEIPPSLGRLKMLHSLFLQLNQLSGHLPQELSGLVN  289

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
            L+ LDL NN LTG++P    ++  L  ++L GN
Sbjct  290  LKSLDLSNNVLTGEIPESFSQLRELTLINLFGN  322


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
             +++ N ++G +PP I  +S+L+ L L  N F    P ++  L  L  +++  NNL+G++
Sbjct  339  FTVSNNLITGKIPPAIGNLSSLQTLALQINRFSGEIPGEIFNLKMLSKVNISANNLSGEI  398

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P  +   TSL  +    N  +G IP
Sbjct  399  PACIVSCTSLTSIDFSQNSLNGEIP  423



>ref|XP_002279563.1| PREDICTED: receptor protein kinase CLAVATA1 [Vitis vinifera]
Length=984

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 69/156 (44%), Positives = 100/156 (64%), Gaps = 5/156 (3%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTS----HCTWRRVTCdsllhvvsldlsglNLSGVLSP  300
             LL +++       S L  W   +S    HC++  V+CD    VVSL+LS + L G + P
Sbjct  33   VLLKLRSFMIGPKGSGLEDWVDDSSSLFPHCSFSGVSCDEDSRVVSLNLSFVTLFGSIPP  92

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLANLQVL  477
            ++G L  LVNL++A + L+G +P E++ +++L+ +NLSNN F   FP + L  +  L+VL
Sbjct  93   EIGMLNKLVNLTLACDNLTGKLPMEMAKLTSLKLVNLSNNNFNGQFPGRILVGMKELEVL  152

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            D+YNNN TG LP EV K+  L+H+HLGGNYFSG IP
Sbjct  153  DMYNNNFTGPLPTEVGKLKKLKHMHLGGNYFSGDIP  188


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P +G+L  L +L +  NQLSG +P E+S +  L+ L+LSNN+     P   +Q
Sbjct  255  NLTGEIPPSLGRLKMLHSLFLQLNQLSGHLPQELSGLVNLKSLDLSNNVLTGEIPESFSQ  314

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L +++L+ N L G +P  +  + +L  L +  N F+  +P
Sbjct  315  LRELTLINLFGNQLRGRIPEFIGDLPNLEVLQVWENNFTFELP  357


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 36/100 (36%), Positives = 54/100 (54%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L  L + +  L+G +PP +  +  L  L L  N      P +L+ L N
Sbjct  234  GGIPPELGLLSSLRVLDLGSCNLTGEIPPSLGRLKMLHSLFLQLNQLSGHLPQELSGLVN  293

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN LTG++P    ++  L  ++L GN   GRIP
Sbjct  294  LKSLDLSNNVLTGEIPESFSQLRELTLINLFGNQLRGRIP  333


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 40/105 (38%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  +VG+L  L ++ +  N  SG +P   S I +L  L L+ N      P  L +
Sbjct  158  NFTGPLPTEVGKLKKLKHMHLGGNYFSGDIPDVFSDIHSLELLGLNGNNLSGRIPTSLVR  217

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L+NLQ L L Y N   G +P E+  ++SLR L LG    +G IPP
Sbjct  218  LSNLQGLFLGYFNIYEGGIPPELGLLSSLRVLDLGSCNLTGEIPP  262


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
             +++ N ++G +PP I  +S+L+ L L  N F    P ++  L  L  +++  NNL+G++
Sbjct  464  FTVSNNLITGKIPPAIGNLSSLQTLALQINRFSGEIPGEIFNLKMLSKVNISANNLSGEI  523

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P  +   TSL  +    N  +G IP
Sbjct  524  PACIVSCTSLTSIDFSQNSLNGEIP  548



>ref|XP_001752668.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ82539.1| CLL1B clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=992

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 67/156 (43%), Positives = 104/156 (67%), Gaps = 3/156 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSW--NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E  ALL++K++F AD Q+ L +W  N + + C W  +TC +   VV L+LS +NL+G L 
Sbjct  12   EGLALLAMKSSF-ADPQNHLENWKLNGTATPCLWTGITCSNASSVVGLNLSNMNLTGTLP  70

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             D+G+L  LVN+S+  N  +G +P EI  +  L+++N+SNN F   FP  +++L +L+VL
Sbjct  71   ADLGRLKNLVNISLDLNNFTGVLPAEIVTLLMLQYVNISNNRFNGAFPANVSRLQSLKVL  130

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            D +NN+ +G LP +++ + +L HL LGGNYF G IP
Sbjct  131  DCFNNDFSGSLPDDLWIIATLEHLSLGGNYFEGSIP  166


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 56/104 (54%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  L   +G LP L +  IA N  SGP+PP+I  + +L  L+LS N      P +++ 
Sbjct  449  NLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNELTGLIPQEMSN  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
               L  LD   N LTG++P ++  +  L  L+L  N  SG IPP
Sbjct  509  CKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPP  552


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+   +G L  LV+L ++ N LSG +PP +  +  L  L+L +N F    P  +  +
Sbjct  258  LVGVIPVQIGNLVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIPDFIGDM  317

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQVL L+ N LTG +P  + +  +L  L L  N+ +G IP
Sbjct  318  PNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIP  359


 Score = 64.7 bits (156),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 34/91 (37%), Positives = 48/91 (53%), Gaps = 0/91 (0%)
 Frame = +1

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            LP +  + I  NQ+ GP+P EI     L +L+ SNN   S  P  +  L  LQ   + NN
Sbjct  413  LPNITMVEIQMNQIMGPIPSEIIDSPKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANN  472

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +G +P ++  M SL  L L GN  +G IP
Sbjct  473  HFSGPIPPQICDMQSLNKLDLSGNELTGLIP  503


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 50/103 (49%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N  G +   +G +P L  L + AN+L+GP+P  +     L  L+LS+N    T P  L  
Sbjct  305  NFEGEIPDFIGDMPNLQVLYLWANKLTGPIPEALGQNMNLTLLDLSSNFLNGTIPSDLCA  364

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               LQ + L +N LTG +P       SL  + L  N  +G IP
Sbjct  365  GQKLQWVILKDNQLTGPIPENFGNCLSLEKIRLSNNLLNGSIP  407


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 48/103 (47%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N S  +    G L  LV L +    L+G +PPE+  +  L  + L  N      P Q+  
Sbjct  209  NYSSGIPATFGNLTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGN  268

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL  LDL  NNL+G +P  +  +  L  L L  N F G IP
Sbjct  269  LVNLVSLDLSYNNLSGIIPPALIYLQKLELLSLMSNNFEGEIP  311


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/91 (35%), Positives = 44/91 (48%), Gaps = 0/91 (0%)
 Frame = +1

Query  316  PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNN  495
            P L  L  + N LS  +P  I  + TL+   ++NN F    P Q+  + +L  LDL  N 
Sbjct  438  PKLSYLDFSNNNLSSKLPESIGNLPTLQSFLIANNHFSGPIPPQICDMQSLNKLDLSGNE  497

Query  496  LTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LTG +P E+     L  L    N  +G IPP
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPP  528


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 56/128 (44%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLR------FLNLSNNI---FGS  432
              G +    G  P L  L +  N L+GP+PPE+  +  L+      F N S+ I   FG+
Sbjct  161  FEGSIPSQYGSFPALKYLGLNGNSLTGPIPPELGKLQALQELYMGYFNNYSSGIPATFGN  220

Query  433  ----------------TFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
                            T P +L  L NL  + L  N L G +PV++  + +L  L L  N
Sbjct  221  LTSLVRLDMGRCGLTGTIPPELGNLGNLDSMFLQLNELVGVIPVQIGNLVNLVSLDLSYN  280

Query  565  YFSGRIPP  588
              SG IPP
Sbjct  281  NLSGIIPP  288


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 42/78 (54%), Gaps = 0/78 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G++  ++     L +L  + N L+G +PP+I  I  L  LNLS+N      P QL  L
Sbjct  498  LTGLIPQEMSNCKKLGSLDFSRNGLTGEIPPQIEYIPDLYLLNLSHNQLSGHIPPQLQML  557

Query  460  ANLQVLDLYNNNLTGDLP  513
              L V D   NNL+G +P
Sbjct  558  QTLNVFDFSYNNLSGPIP  575



>ref|XP_008387933.1| PREDICTED: receptor protein kinase CLAVATA1 [Malus domestica]
Length=973

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 65/152 (43%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            ALL +KAA      S L  WN S+SHC +  V CD    VV+L++S + L G +   +G 
Sbjct  32   ALLKLKAAMVGPKGSGLEDWNSSSSHCFFSGVLCDRDSRVVALNVSNIPLFGTIPAAIGL  91

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QLANLQVLDLYN  489
            L  LVNL I  + L+G +P E++ +++L+ LN+SNN F  +FP ++   + +L+VLD YN
Sbjct  92   LDKLVNLEITDDNLTGRLPAEMANLTSLKHLNISNNAFSGSFPGEIVLGMTDLEVLDAYN  151

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NN  G LP+++  + +++HLHLGGNY +G IP
Sbjct  152  NNFNGTLPIQLVSLKNIKHLHLGGNYITGEIP  183


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L  L  ++I+AN LS  +   IS  S+L  ++LS N      P  +A+L
Sbjct  490  FSGEIPTEIFYLKLLSKINISANNLSSDISESISRCSSLTSVDLSGNNLVGEIPRGIAKL  549

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+   N LTG++P E+  MTSL  L L  N F GR+P
Sbjct  550  KVLSILNFSRNQLTGEIPAEMRSMTSLTTLDLSNNNFVGRLP  591


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            ++SG + P +G L  L  LS+  N+ SG +P EI  +  L  +N+S N   S     +++
Sbjct  465  HISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDISESISR  524

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             ++L  +DL  NNL G++P  + K+  L  L+   N  +G IP
Sbjct  525  CSSLTSVDLSGNNLVGEIPRGIAKLKVLSILNFSRNQLTGEIP  567


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P +  L  L++L ++ N+L+G +P   S +  L  +NL  NN++G   P  +  
Sbjct  275  LSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGP-IPKFVGD  333

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  334  FPHLEVLQIWENNFTFELPENLGRNGRLKDLDVTGNHLTGLIP  376


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +1

Query  337  IAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPV  516
            +  N+LSG +PP++SA++ L  L+LS N      P   ++L NL +++LY NNL G +P 
Sbjct  270  LQVNRLSGSIPPQLSALNMLMSLDLSINELTGEIPESFSELKNLTLVNLYKNNLYGPIPK  329

Query  517  EVYKMTSLRHLHLGGNYFSGRIP  585
             V     L  L +  N F+  +P
Sbjct  330  FVGDFPHLEVLQIWENNFTFELP  352


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 47/85 (55%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N +SG +PP I  + +L+ L+L  N F    P ++  L  L  +++  NNL+ D+
Sbjct  459  LTLSGNHISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFYLKLLSKINISANNLSSDI  518

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
               + + +SL  + L GN   G IP
Sbjct  519  SESISRCSSLTSVDLSGNNLVGEIP  543


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 57/104 (55%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L    +  N   GP+P E+   ++L  + +  N    T P  +  
Sbjct  370  HLTGLIPRDLCKGGNLKTAILMENHFFGPIPEELGLCNSLVKIRMMKNTLTGTIPAGIFS  429

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL +++L +N L+G+LP ++    ++  L L GN+ SG+IPP
Sbjct  430  LPNLIMIELNDNFLSGELPQQI-SGGNIGILTLSGNHISGKIPP  472



>ref|XP_007214567.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
 gb|EMJ15766.1| hypothetical protein PRUPE_ppa000837mg [Prunus persica]
Length=986

 Score =   120 bits (302),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 98/163 (60%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  279
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFICSWAGIHCDNMNISVVSLDISNYN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +LD YNN+  G LP+ V ++  L+ L  GGNYFSG IPP
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPP  190


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD   NN +G +P+EV    SL +L L  N  +G IP
Sbjct  509  LVNVLKLDFSRNNFSGRIPLEVGNCLSLTYLDLSQNQLTGPIP  551


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIPHAIAEL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  341  PKLEVLKLWHNNFTGAIPSKLGQNGKLIDLDLSSNKLTGVVP  382


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP
Sbjct  293  SSLRSLDLSNNALTGDIPAEFSALRKLTLLNLFINKFHGEIP  334


 Score = 59.3 bits (142),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 51/105 (49%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V Q+P L  L    N  SG +PP    +  L +L+++ N      P +L  
Sbjct  159  DFNGSLPLGVTQIPKLKRLDFGGNYFSGNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+ L L Y N   G +P E+ K+ +L HL L      G IPP
Sbjct  219  LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPP  263


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPLEVGNC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG +PV++ ++  L + ++  N+ +  +P
Sbjct  534  LSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLP  575


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 26/79 (33%), Positives = 43/79 (54%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  +VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPLEVGNCLSLTYLDLSQNQLTGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  580

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599



>ref|XP_011004295.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 isoform X2 [Populus euphratica]
Length=893

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 68/158 (43%), Positives = 93/158 (59%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+S  H  C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVSNYHLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD+YNNNL G LP+ V ++  L++L  GGNYF G IPP
Sbjct  155  LDVYNNNLNGTLPLGVTQLGKLKYLDFGGNYFQGTIPP  192


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP
Sbjct  511  LKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIP  553


 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P + + L
Sbjct  259  LSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIP  360


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +++  LDL NN LTGD+P+E   +  L  L+L  N   G IP
Sbjct  295  SSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIP  336


 Score = 65.9 bits (159),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E S +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFSGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVP  384


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPSQIGQLKNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSIP  601


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI-STLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +      LP L  + +  N LSG VP +IS   S L  +NL++N      P  +  
Sbjct  427  LTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGN  486

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +NLQ+L L  N  TG++P ++ ++ ++  L +  N  SG IPP
Sbjct  487  FSNLQILLLSGNRFTGEIPSQIGQLKNVFTLDMSRNNLSGNIPP  530


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  +DL N +L+G +P E+  +  L  L L  N  +G IPP
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLNKLDTLFLQTNELTGPIPP  289


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q+++ 
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             + L  ++L +N L+G LP  +   ++L+ L L GN F+G IP
Sbjct  463  PSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIP  505



>ref|XP_002264952.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Vitis vinifera]
Length=988

 Score =   120 bits (301),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 74/157 (47%), Positives = 98/157 (62%), Gaps = 4/157 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllh-vvsldlsglNLSGVL  294
            + + L+++K AF A    SL SW +S   S C+W  V CD     VVSLD+S  N+SG L
Sbjct  36   QASTLVALKQAFEA-PHPSLNSWKVSNYRSLCSWTGVQCDDTSTWVVSLDISNSNISGAL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  L NLS+  N L+G  PPEI  +S L++LN+SNN F  +   +  QL  L V
Sbjct  95   SPAIMELGSLRNLSVCGNNLAGSFPPEIHKLSRLQYLNISNNQFNGSLNWEFHQLKELAV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LD Y+NN  G LPV V ++  L+HL  GGNYFSG+IP
Sbjct  155  LDAYDNNFLGSLPVGVTQLPKLKHLDFGGNYFSGKIP  191


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++GQL  ++ L +  N  SG +PPEI    +L +L+LS N      P Q+AQ+
Sbjct  500  FTGNIPSEIGQLISILKLDMRRNNFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N++  +LP E+  M SL  +    N FSG IP
Sbjct  560  HILNYLNLSWNHMNQNLPKEIGFMKSLTSVDFSHNNFSGWIP  601


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG++ P++G    L  L ++ NQ+SGP+P +I+ I  L +LNLS N      P ++  
Sbjct  523  NFSGIIPPEIGHCLSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLPKEIGF  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  +D  +NN +G +P
Sbjct  583  MKSLTSVDFSHNNFSGWIP  601


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI-STLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +      LP L  + +  N L+G  P E S + S +  LNLSNN    + P  +  
Sbjct  427  LSGFIPNGFLYLPQLSLMELQNNYLTGGFPEESSKVPSKVGQLNLSNNRLSGSLPTSIGN  486

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             ++LQ+L L  N  TG++P E+ ++ S+  L +  N FSG IPP
Sbjct  487  FSSLQILLLNGNRFTGNIPSEIGQLISILKLDMRRNNFSGIIPP  530


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLV-NLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G    +  ++P  V  L+++ N+LSG +P  I   S+L+ L L+ N F    P ++ Q
Sbjct  451  LTGGFPEESSKVPSKVGQLNLSNNRLSGSLPTSIGNFSSLQILLLNGNRFTGNIPSEIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L ++  LD+  NN +G +P E+    SL +L L  N  SG IP
Sbjct  511  LISILKLDMRRNNFSGIIPPEIGHCLSLTYLDLSQNQISGPIP  553


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G+   L  + +  N LSG +P     +  L  + L NN     FP + +++
Sbjct  403  LFGPLPDDLGRCETLQRVRLGQNYLSGFIPNGFLYLPQLSLMELQNNYLTGGFPEESSKV  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             + +  L+L NN L+G LP  +   +SL+ L L GN F+G IP
Sbjct  463  PSKVGQLNLSNNRLSGSLPTSIGNFSSLQILLLNGNRFTGNIP  505


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  + G +  L  LS+A N L G +P E+  ++ L+ L L   N F    P +L +
Sbjct  186  FSGKIPRNYGGMVQLTYLSLAGNDLGGYIPVELGNLTNLKRLYLGYYNEFDGGIPPELGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL +  L G +P E+  +  L  L L  N  SG IPP
Sbjct  246  LVNLVHLDLSSCGLEGPIPPELGNLKHLDTLFLQTNQLSGSIPP  289


 Score = 54.7 bits (130),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 42/126 (33%), Positives = 62/126 (49%), Gaps = 24/126 (19%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN--------------  417
            L G + P++G L  L  L +  NQLSG +PP++  +S+L+ L+LSN              
Sbjct  259  LEGPIPPELGNLKHLDTLFLQTNQLSGSIPPQLGNLSSLKSLDLSNNGLTGEIPLEFSEL  318

Query  418  ----------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNY  567
                      N F    PH +A+L  L+VL L+ NN TG +P ++ +   L  L L  N 
Sbjct  319  TELTLLQLFINKFHGEIPHFIAELPKLEVLKLWQNNFTGTIPSKLGRNGKLSELDLSTNK  378

Query  568  FSGRIP  585
             +G IP
Sbjct  379  LTGLIP  384


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  LV+L +++  L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  235  FDGGIPPELGKLVNLVHLDLSSCGLEGPIPPELGNLKHLDTLFLQTNQLSGSIPPQLGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LDL NN LTG++P+E  ++T L  L L  N F G IP
Sbjct  295  SSLKSLDLSNNGLTGEIPLEFSELTELTLLQLFINKFHGEIP  336


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 29/102 (28%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L  L +  N+ +G +P EI  + ++  L++  N F    P ++   
Sbjct  476  LSGSLPTSIGNFSSLQILLLNGNRFTGNIPSEIGQLISILKLDMRRNNFSGIIPPEIGHC  535

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N ++G +PV++ ++  L +L+L  N+ +  +P
Sbjct  536  LSLTYLDLSQNQISGPIPVQIAQIHILNYLNLSWNHMNQNLP  577



>gb|ABF99108.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=792

 Score =   119 bits (298),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  P  588
            P
Sbjct  185  P  185


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ +
Sbjct  493  FSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISGM  552

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  553  RILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 61.6 bits (148),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  353


 Score = 61.2 bits (147),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPP  571


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPP  258


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIP  329


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIP  401



>ref|XP_008808401.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=989

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 98/152 (64%), Gaps = 1/152 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            AL+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++ 
Sbjct  31   ALMKLKEGLLGSAGNDLHDWDPSAPTHCSFSGVTCDADARVVALNVSHIRFHRPLPPEIS  90

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            +L  LVNL++A + L+G +PPEI+A+  LRFLN+SNN F   FP        L+VLD YN
Sbjct  91   RLDRLVNLTVACDSLAGRLPPEIAALPALRFLNISNNNFTGHFPDVDGGFLALEVLDAYN  150

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NN +G LP+ + K+  LR++HLGGN+FSG IP
Sbjct  151  NNFSGPLPLGLAKLPHLRYIHLGGNFFSGEIP  182


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/103 (39%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G    L  LS+ +N++SG +PP+I  +  L  LNLS N      P  LA+ 
Sbjct  465  ISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEIPSDLARC  524

Query  460  AN-LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A  L+ +DL  N LTG++P  + K+ +L  L+L  N  SG IP
Sbjct  525  AGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIP  567


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + P++G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  273  HLAGSIPPELGGLDLLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPPFIAD  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+VL ++ NN T +LP  + +   L  L +  N  +G IP
Sbjct  333  LPNLEVLQVWENNFTFELPEGLGRNGRLIKLDVATNRLTGTIP  375


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L +A N++SGP+PP I     L+ L+L +N      P Q+  L  L  L+L  NNLTG++
Sbjct  458  LLLANNRISGPIPPAIGNFRGLQTLSLQSNRISGEIPPQIGDLKQLSNLNLSGNNLTGEI  517

Query  511  PVEVYKMT-SLRHLHLGGNYFSGRIP  585
            P ++ +   +L  + L  N  +G IP
Sbjct  518  PSDLARCAGTLEAVDLSRNRLTGEIP  543


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 37/129 (29%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L++
Sbjct  152  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNGLSGRVPVSLSR  211

Query  457  LANLQV-------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL+                          LD+ N NLTG +P  + ++  L  L L  
Sbjct  212  LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQW  271

Query  562  NYFSGRIPP  588
            N+ +G IPP
Sbjct  272  NHLAGSIPP  280


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
             G + P+ G L  LV L +A   L+G +P  +  +  L  L L  N    + P +L  L 
Sbjct  227  EGGIPPEFGMLTSLVRLDMANCNLTGRIPASLGQLKLLDSLFLQWNHLAGSIPPELGGLD  286

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             L+ LDL  N LTG+LP    ++  L+ L+L  N+F G IPP
Sbjct  287  LLESLDLSINELTGELPESFAELKQLKLLNLFRNHFRGHIPP  328


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 47/82 (57%), Gaps = 1/82 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            NL+G +  D+ +    L  + ++ N+L+G +P  I+ +  L  LNLS N      P  + 
Sbjct  512  NLTGEIPSDLARCAGTLEAVDLSRNRLTGEIPEAITKLQNLNTLNLSRNQLSGEIPADIQ  571

Query  454  QLANLQVLDLYNNNLTGDLPVE  519
            ++ +L  LDL  NNL+G++PVE
Sbjct  572  RMLSLTTLDLSYNNLSGEIPVE  593


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 7/106 (7%)
 Frame = +1

Query  280  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            L+G +  D+   G+L  LV   +  N   GP+P ++    +L  + L+ N    T P  L
Sbjct  370  LTGTIPSDLCASGRLELLV---LMENAFFGPIPEKLGDCKSLLHVRLAKNFLDGTIPAGL  426

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L ++ +L+L +N L+G+LP  +     L  L L  N  SG IPP
Sbjct  427  FDLPSVDMLELSDNYLSGELPARIAG-DKLGMLLLANNRISGPIPP  471



>gb|KDO84901.1| hypothetical protein CISIN_1g002010mg [Citrus sinensis]
Length=982

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            ++   LL +K++      S L +W  S+S   HC++  VTCD    VVSL++S + L G 
Sbjct  27   SDMDVLLKLKSSMIGPKGSGLKNWEPSSSPSAHCSFSGVTCDQDSRVVSLNVSFMPLFGS  86

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            + P++G L  LVNL+I+   L+G +P E++ +++L+  N+S N+F   F  Q+ + +  L
Sbjct  87   IPPEIGLLTKLVNLTISNVNLTGRLPSEMALLTSLKVFNISGNVFQGNFAGQIVRGMTEL  146

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            QVLD YNNN TG LPVE+  + SLRHL  GGNYF+G+IP
Sbjct  147  QVLDAYNNNFTGPLPVEIASLKSLRHLSFGGNYFTGKIP  185


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + +L  L +L +  N+L+G +PP++S + +L+ L+LS N      P   A 
Sbjct  252  NISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAA  311

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L L+ NNL G +P  +    +L  L + GN F+  +P
Sbjct  312  LKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELP  354


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P ++S  ++L  L ++NN      P  +  L
Sbjct  421  LNGTIPAGLFNLPLLNMMELDDNLLSGELPEKMSG-ASLNQLKVANNNITGKIPAAIGNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L L NN L G++PVE + +  +  +++  N  SG IP
Sbjct  480  PSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEIP  521


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + Q   L ++ ++ N L G +PP IS +  L  LNLS N    + P+++  
Sbjct  515  NISGEIPYSISQCHSLTSVDLSRNSLYGKIPPGISKLIDLSILNLSRNGITGSIPNEMRN  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  LDL  NNL G++P
Sbjct  575  MMSLTTLDLSYNNLIGNIP  593


 Score = 52.0 bits (123),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +  L  L +L ++ N L+G +P   +A+  L  L L  N      P  L   
Sbjct  277  LTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDF  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL ++ NN T +LP  + +   L  L +  N+ +G IP
Sbjct  337  PNLEVLQVWGNNFTFELPENLGRNGKLLILDVTSNHLTGTIP  378


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L +  N L GP+P  +     L  L +  N F    P  L + 
Sbjct  301  LTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELPENLGRN  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LD+ +N+LTG +P ++ K   L+ L L  N+F G IP
Sbjct  361  GKLLILDVTSNHLTGTIPRDLCKGGKLKSLILMQNFFIGPIP  402


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++  L  L +LS   N  +G +P   S I +L ++ L+      T P  L++
Sbjct  155  NFTGPLPVEIASLKSLRHLSFGGNYFTGKIPQSYSEIQSLEYIGLNGIGLNGTVPAFLSR  214

Query  457  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL                         QVLD+ + N++G++P  + ++  L  L L  
Sbjct  215  LKNLREMYIGYFNTYTGGIPPGFGALTQLQVLDMASCNISGEIPTSLSRLKLLHSLFLQM  274

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  275  NKLTGHIPP  283


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L +A N ++G +P  I  + +L  L+L NN      P +   L  +  +++ +NN++G++
Sbjct  461  LKVANNNITGKIPAAIGNLPSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEI  520

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P  + +  SL  + L  N   G+IPP
Sbjct  521  PYSISQCHSLTSVDLSRNSLYGKIPP  546


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 44/80 (55%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G +PP   A++ L+ L++++       P  L++L  L  L L  N LTG +P ++ 
Sbjct  227  NTYTGGIPPGFGALTQLQVLDMASCNISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLS  286

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  NY +G IP
Sbjct  287  GLISLKSLDLSLNYLTGEIP  306


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 50/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P  G L  L  L +A+  +SG +P  +S +  L  L L  N      P QL+ L 
Sbjct  230  TGGIPPGFGALTQLQVLDMASCNISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLSGLI  289

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ LDL  N LTG++P     + +L  L L  N   G IP
Sbjct  290  SLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIP  330



>ref|XP_001754727.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
 gb|EDQ80697.1| CLL1A clavata1-like receptor S/T protein kinase protein [Physcomitrella 
patens]
Length=1017

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 3/157 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNI--STSHCTWRRVTCdsllhvvsldlsglNLSGVLS  297
            E+ AL+++KA    D +S L  W +  ++S C W  V C++   VV L LSG+NLSG +S
Sbjct  34   ERLALIALKATID-DPESHLADWEVNGTSSPCLWTGVDCNNSSSVVGLYLSGMNLSGTIS  92

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
             ++G L  LVNLS+  N  +  +P +I  ++ L++LN+S N FG   P   +QL  LQVL
Sbjct  93   SELGNLKNLVNLSLDRNNFTEDLPADIVTLTQLKYLNVSTNSFGGALPSNFSQLQLLQVL  152

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            D +NN  +G LP +++K+++L H+ LGGNYF G IPP
Sbjct  153  DCFNNFFSGPLPPDLWKISTLEHVSLGGNYFEGSIPP  189


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLS  +   +G LP +++  I+ N  +GP+PP+I  +  L  L++S N    + P +++ 
Sbjct  471  NLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDMPNLNKLDMSGNNLSGSIPAEMSN  530

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L +LD+ +N+LTG +PV++  +  L +L+L  N  SG IP
Sbjct  531  CKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIP  573


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   +G L  L +L ++ N+L+G +P  +  +  L  ++L NN    T P  LA L
Sbjct  280  LEGPIPASLGNLVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVPDFLADL  339

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VL L+ N LTG +P  + +  +L  L L  N+ +G IPP
Sbjct  340  PNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPP  382


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            + I  NQ++GP+P EI     L +L+ S N   S+ P  +  L ++    + +N+ TG +
Sbjct  441  VEIQDNQVNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPI  500

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P ++  M +L  L + GN  SG IP
Sbjct  501  PPQICDMPNLNKLDMSGNNLSGSIP  525


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 50/102 (49%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +  ++   P L  L  + N LS  +P  I  + ++    +S+N F    P Q+  +
Sbjct  448  VNGPIPSEIINAPLLSYLDFSKNNLSSSIPESIGNLPSIMSFFISDNHFTGPIPPQICDM  507

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  LD+  NNL+G +P E+     L  L +  N  +G IP
Sbjct  508  PNLNKLDMSGNNLSGSIPAEMSNCKKLGLLDVSHNSLTGVIP  549


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 48/90 (53%), Gaps = 1/90 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++     L  L ++ N L+G +P ++  I  L +LNLS+N      P +LA 
Sbjct  519  NLSGSIPAEMSNCKKLGLLDVSHNSLTGVIPVQMQFIPDLYYLNLSHNELSGAIPSKLAD  578

Query  457  LANLQVLDLYNNNLTGDLPV-EVYKMTSLR  543
            L  L + D   NNL+G +P+ + Y  T+  
Sbjct  579  LPTLSIFDFSYNNLSGPIPLFDSYNATAFE  608


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L G +   +  LP L  L +  NQL+GP+P  +     L  L+LS+N    + P  L  
Sbjct  327  HLEGTVPDFLADLPNLEVLYLWKNQLTGPIPENLGQNMNLTLLDLSSNHLNGSIPPDLCA  386

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
               LQ + L  N LTG +P  +    SL  L LG N  +G I
Sbjct  387  GQKLQWVILLENQLTGSIPESLGHCQSLTKLRLGINSLNGSI  428


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 47/103 (46%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N S  +    G L  LV L +A+  L G +P E+  +  L  L L  N      P  L  
Sbjct  231  NFSSSIPATFGNLTNLVRLDMASCGLVGAIPHELGNLGQLDTLFLMLNSLEGPIPASLGN  290

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+ LDL  N LTG LP  +  +  L  + L  N+  G +P
Sbjct  291  LVNLRSLDLSYNRLTGILPNTLIYLQKLELMSLMNNHLEGTVP  333



>gb|EAY92008.1| hypothetical protein OsI_13698 [Oryza sativa Indica Group]
Length=1029

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  P  588
            P
Sbjct  185  P  185


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  353


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPP  571


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPP  258


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIP  329


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIP  401



>gb|AAP68887.1| putative receptor-like protein kinase 1 [Oryza sativa Japonica 
Group]
 gb|ABF99107.1| Receptor protein kinase CLAVATA1 precursor, putative, expressed 
[Oryza sativa Japonica Group]
Length=1029

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 85/121 (70%), Gaps = 0/121 (0%)
 Frame = +1

Query  226  VTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFL  405
            VTC S   VV LD+SGLNLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +L
Sbjct  65   VTCSSRGAVVGLDVSGLNLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYL  124

Query  406  NLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NLSNN F  +FP  LA+L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IP
Sbjct  125  NLSNNAFNGSFPAALARLRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIP  184

Query  586  P  588
            P
Sbjct  185  P  185


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  492  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  551

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  552  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  594


 Score = 62.0 bits (149),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  252  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  311

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  312  KNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  353


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  469  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  528

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP
Sbjct  529  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPP  571


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  451  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  504

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP
Sbjct  505  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  547


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  154  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  213

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  214  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPP  258


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  229  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  288

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  289  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIP  329


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  L++  N+L G +P  +  + +L  L L  N F    P +L + 
Sbjct  300  LTGEIPASFSELKNLTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVPRRLGRN  359

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+LDL +N LTG LP E+     +  L   GN+  G IP
Sbjct  360  GRLQLLDLSSNRLTGTLPPELCAGGKMHTLIALGNFLFGAIP  401



>ref|XP_006435205.1| hypothetical protein CICLE_v10000156mg [Citrus clementina]
 gb|ESR48445.1| hypothetical protein CICLE_v10000156mg [Citrus clementina]
Length=982

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 68/159 (43%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            ++   LL +K++      S L +W  S+S   HC++  VTCD    VVSL++S + L G 
Sbjct  27   SDMDVLLKLKSSMIGPKGSGLKNWEPSSSPSAHCSFSGVTCDQDSRVVSLNVSFMPLFGS  86

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            + P++G L  LVNL+I+   L+G +P E++ +++L+  N+S N+F   F  Q+ + +  L
Sbjct  87   IPPEIGLLTKLVNLTISNVNLTGRLPSEMALLTSLKVFNISGNVFQGNFAGQIVRGMTEL  146

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            QVLD YNNN TG LPVE+  + SLRHL  GGNYF+G+IP
Sbjct  147  QVLDAYNNNFTGPLPVEIASLKSLRHLSFGGNYFTGKIP  185


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + +L  L +L +  N+L+G +PP++S + +L+ L+LS N      P   A 
Sbjct  252  NISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAA  311

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L L+ NNL G +P  +    +L  L + GN F+  +P
Sbjct  312  LKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELP  354


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P ++S  ++L  L ++NN      P  +  L
Sbjct  421  LNGTIPAGLFNLPLLNMMELDDNLLSGELPEKMSG-ASLNQLKVANNNITGKIPAAIGNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L L NN L G++PVE + +  +  +++  N  SG IP
Sbjct  480  PSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEIP  521


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + Q   L ++ ++ N L G +PP IS +  L  LNLS N    + P+++  
Sbjct  515  NISGEIPYSISQCHSLTSVDLSRNSLYGKIPPGISKLLDLSILNLSRNGITGSIPNEMRN  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  LDL  NNL G++P
Sbjct  575  MMSLTTLDLSYNNLIGNIP  593


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 36/101 (36%), Positives = 52/101 (51%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G +SP+ G L  L  L +A+  +SG +P  +S +  L  L L  N      P QL+ L 
Sbjct  230  TGGISPEFGALTQLQVLDMASCNISGEIPTSLSRLKLLHSLFLQMNKLTGHIPPQLSGLI  289

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ LDL  N LTG++P     + +L  L L  N   G IP
Sbjct  290  SLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIP  330


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +  L  L +L ++ N L+G +P   +A+  L  L L  N      P  L   
Sbjct  277  LTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDF  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL ++ NN T +LP  + +   L  L +  N+ +G IP
Sbjct  337  PNLEVLQVWGNNFTFELPKNLGRNGKLLILDVTSNHLTGTIP  378


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L +  N L GP+P  +     L  L +  N F    P  L + 
Sbjct  301  LTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELPKNLGRN  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LD+ +N+LTG +P ++ K   L+ L L  N+F G IP
Sbjct  361  GKLLILDVTSNHLTGTIPRDLCKGGKLKSLILMQNFFIGPIP  402


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/129 (27%), Positives = 57/129 (44%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++  L  L +LS   N  +G +P   S I +L ++ L+      T P  L++
Sbjct  155  NFTGPLPVEIASLKSLRHLSFGGNYFTGKIPQSYSEIQSLEYIGLNGIGLNGTVPAFLSR  214

Query  457  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL                         QVLD+ + N++G++P  + ++  L  L L  
Sbjct  215  LKNLREMYIGYFNTYTGGISPEFGALTQLQVLDMASCNISGEIPTSLSRLKLLHSLFLQM  274

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  275  NKLTGHIPP  283


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L +A N ++G +P  I  + +L  L+L NN      P +   L  +  +++ +NN++G++
Sbjct  461  LKVANNNITGKIPAAIGNLPSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEI  520

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P  + +  SL  + L  N   G+IPP
Sbjct  521  PYSISQCHSLTSVDLSRNSLYGKIPP  546



>ref|XP_006856744.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
 gb|ERN18211.1| hypothetical protein AMTR_s00055p00012250 [Amborella trichopoda]
Length=1014

 Score =   119 bits (299),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 66/157 (42%), Positives = 92/157 (59%), Gaps = 2/157 (1%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQ--SSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGV  291
            V +   LL +K     + Q  S L  W     HC W  VTC+    VV+L++  + L G 
Sbjct  59   VDDSEVLLKLKRGLILEPQKISFLKDWETGKDHCLWSGVTCNDEARVVALNICFIPLHGR  118

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQ  471
            +  D+G L  LVN++++++ L+G +PP+I  + +LRFLN+SNN      P   + L  L+
Sbjct  119  IFGDIGLLDKLVNVTLSSSNLTGNLPPQIGHLRSLRFLNISNNDLSGDIPTTFSGLQELE  178

Query  472  VLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRI  582
            VLD YNNN +G LP EV  +  LRHL LGGNYFSG I
Sbjct  179  VLDAYNNNFSGPLPHEVASLKGLRHLQLGGNYFSGEI  215


 Score = 72.0 bits (175),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 61/103 (59%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   +GQL FL  L +  N+ SG +P E+S + +++ L+LSNN      P   ++
Sbjct  283  NLSGQIPATLGQLKFLDTLFLQMNRFSGEIPEELSGLKSVKSLDLSNNQLTGELPEGFSE  342

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L +L+L+ NNL G +P  + ++ +L  L L  N F+G +P
Sbjct  343  LRELTLLNLFRNNLHGAVPPFIAELPNLEVLQLWENNFTGSLP  385


 Score = 66.2 bits (160),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +  L  L  LS+  NQ SG +P  I  +  L  LNLSNN F    P  L + 
Sbjct  500  FTGSIPSSISNLTGLQTLSLEGNQFSGEIPQGIGELQQLSKLNLSNNKFSGKIPAALGRC  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +D+ NN L G +P E+  +  L  L+L GN+ SG IP
Sbjct  560  FSLYSVDISNNQLAGTIPDELADLHILNVLNLSGNHLSGEIP  601


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +   +G+L  L  L+++ N+ SG +P  +    +L  +++SNN    T P +LA L
Sbjct  524  FSGEIPQGIGELQQLSKLNLSNNKFSGKIPAALGRCFSLYSVDISNNQLAGTIPDELADL  583

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L VL+L  N+L+G++P ++  M SL  L L  N  SG +P
Sbjct  584  HILNVLNLSGNHLSGEIPAKMKWMQSLTSLDLSYNQLSGIVP  625


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      LP    + +  N LSG +P  ISA   L  L LSNN+F  + P  ++ L
Sbjct  452  LNGSIPEGFLNLPLADMIELTDNYLSGKLPSRISASVVLGELILSNNLFTGSIPSSISNL  511

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ L L  N  +G++P  + ++  L  L+L  N FSG+IP
Sbjct  512  TGLQTLSLEGNQFSGEIPQGIGELQQLSKLNLSNNKFSGKIP  553


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG +  + G    LV L +A+  LSG +P  +  +  L  L L  N F    P +L+ L 
Sbjct  261  SGGIPSEFGLFAKLVRLDLASCNLSGQIPATLGQLKFLDTLFLQMNRFSGEIPEELSGLK  320

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +++ LDL NN LTG+LP    ++  L  L+L  N   G +PP
Sbjct  321  SVKSLDLSNNQLTGELPEGFSELRELTLLNLFRNNLHGAVPP  362


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G +  L  L +  N LSG +P E+S +S LR + L   N +    P +   
Sbjct  211  FSGEILTSYGGVESLEYLGLNGNALSGHIPGELSMLSNLREMYLGYYNSYSGGIPSEFGL  270

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             A L  LDL + NL+G +P  + ++  L  L L  N FSG IP
Sbjct  271  FAKLVRLDLASCNLSGQIPATLGQLKFLDTLFLQMNRFSGEIP  313


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 48/102 (47%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L     +L  L  L++  N L G VPP I+ +  L  L L  N F  + P  L + 
Sbjct  332  LTGELPEGFSELRELTLLNLFRNNLHGAVPPFIAELPNLEVLQLWENNFTGSLPENLGRN  391

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N LTG +P  +      + L L  NYF G IP
Sbjct  392  GRLLKLDLTANRLTGLIPSALCFGGRFQVLILLDNYFFGPIP  433



>gb|KFK42020.1| hypothetical protein AALP_AA2G201900 [Arabis alpina]
Length=974

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 105/160 (66%), Gaps = 5/160 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++ T  + + L  W  STS   HC++  VTC+S   V+SL++S   L G 
Sbjct  30   TDMETLLNLKSSMTGPNGAGLHDWLHSTSPTSHCSFSGVTCNSQSRVISLNISFTPLFGT  89

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNN-IFGSTFPHQL-AQLAN  465
            +SP++G L  LVNL++AAN  SG +P  +  +++L+ LN+SNN     TFP ++   + N
Sbjct  90   ISPEIGNLNHLVNLTLAANNFSGNLPTSLKNLTSLKILNISNNGNLNGTFPGEIFIYMTN  149

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLD YNNN TG LP+++  +  L+HL LGGN+F+G IP
Sbjct  150  LEVLDAYNNNFTGTLPLQIPNLKKLKHLSLGGNFFTGEIP  189


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 36/92 (39%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            +L  L  ++I+ N L+G +P  IS  ++L  ++LS N  G   P ++ Q+ NL  L+L  
Sbjct  506  ELNHLTKVNISGNNLTGEIPGSISRCTSLNSVDLSRNRIGGEIPKEINQVINLGTLNLSG  565

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N LTG +P  +  MTSL  L L  N  SGR+P
Sbjct  566  NQLTGVIPTGIGNMTSLTTLDLSYNDLSGRVP  597


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 31/104 (30%), Positives = 60/104 (58%), Gaps = 2/104 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLA  453
            NL+G++  ++  L  L +L ++ N+L+G +P    ++  +  +NL  NN++G   P  + 
Sbjct  280  NLTGLIPQELSGLISLKSLDLSINRLTGEIPASFISLGNITLINLFRNNLYGQ-IPSFIG  338

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LQV +++ NN T  LP  + +  +L+ L +  N+ +G IP
Sbjct  339  ELPKLQVFEIWENNFTLTLPESLGRNRNLKKLDVSANHLTGVIP  382


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 56/103 (54%), Gaps = 1/103 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+GV+  D+ +   L  L ++ N L GP+P E+    +L  + +  N+   T P  L  
Sbjct  376  HLTGVIPKDLCKGEKLEMLILSNNFLFGPIPEELGQCKSLNKIRIVKNLLNGTIPRGLFN  435

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  + +++L +N  +G+LP+ +     L  ++L  N+F+G IP
Sbjct  436  LPLVTIIELTDNFFSGELPITM-SGDVLDQIYLSNNWFTGEIP  477


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 31/99 (31%), Positives = 49/99 (49%), Gaps = 6/99 (6%)
 Frame = +1

Query  307  GQLPF------LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            G+LP       L  + ++ N  +G +P  I     L+ L+L  N F    P  L +L +L
Sbjct  451  GELPITMSGDVLDQIYLSNNWFTGEIPSAIGNFERLQTLSLDRNRFRGEIPKTLFELNHL  510

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +++  NNLTG++P  + + TSL  + L  N   G IP
Sbjct  511  TKVNISGNNLTGEIPGSISRCTSLNSVDLSRNRIGGEIP  549



>ref|XP_010471715.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X1 [Camelina 
sativa]
 ref|XP_010471716.1| PREDICTED: receptor protein kinase CLAVATA1 isoform X2 [Camelina 
sativa]
Length=991

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 66/163 (40%), Positives = 108/163 (66%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L
Sbjct  34   LAYTDMEVLLNLKSSMIGHNGDGLHDWIHSPSPAAHCSFTGVSCDGEARVISLNVSFTPL  93

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQLAQ-  456
             G +SP++G L  LVNL++AAN  +G +P E+ ++++L+ LN+SNN+    +FP ++ + 
Sbjct  94   FGKISPEIGMLNRLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNVNLSGSFPGEMVKA  153

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L+VLD YNNN TG LP+E+ ++ +L+HL LGGN+F+G IP
Sbjct  154  MVDLEVLDAYNNNFTGTLPLEISELKNLKHLSLGGNFFTGEIP  196


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++ +L  L  ++ +AN ++G +P  IS  +TL  ++LS N      P ++  + N
Sbjct  505  GSIPREIFELKHLSKINTSANNITGVIPDSISRCTTLISVDLSRNRINGDIPKEINNVIN  564

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+L  N LTG +P  +  MTSL  L L  N  SGR+P
Sbjct  565  LGTLNLSGNQLTGSIPTGIGNMTSLTTLDLSFNDLSGRVP  604


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G  P L  L +  N+  G +P EI  +  L  +N S N      P  +++ 
Sbjct  479  FSGEIPPAIGNFPNLQTLFLDRNRFRGSIPREIFELKHLSKINTSANNITGVIPDSISRC  538

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N + GD+P E+  + +L  L+L GN  +G IP
Sbjct  539  TTLISVDLSRNRINGDIPKEINNVINLGTLNLSGNQLTGSIP  580


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 58/104 (56%), Gaps = 2/104 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLA  453
            NL+G + P++  L  L +L ++ NQL+G +P     +     +NL  NN++G   P  + 
Sbjct  287  NLTGHIPPELSGLISLKSLDLSINQLTGEIPQSFIDLGNTTLINLFRNNLYGP-IPEFIG  345

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LQV +++ NN T  LP  + +  +L+ L +  N+ +G IP
Sbjct  346  ELPKLQVFEVWENNFTLQLPANLGRNGNLKKLDVSYNHLTGLIP  389


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L ++ N L GP+P E+    +L  + +  N+   T P  L  
Sbjct  383  HLTGLIPMDLCRGEKLEMLILSNNFLFGPIPEELGKCKSLNKIRIVKNLLNGTVPAGLFN  442

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  + +++L +N  +G+LP  +    +   ++L  N+FSG IPP
Sbjct  443  LPLVTIIELTDNFFSGELPTTMSGAVA-DQIYLSNNWFSGEIPP  485


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G L  ++ +L  L +LS+  N  +G +P     I +L +L L+              
Sbjct  166  NFTGTLPLEISELKNLKHLSLGGNFFTGEIPESYGDIQSLEYLGLNGAGLSGKSPAFLSR  225

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L NLQ+LD+ +  LTG++P  +  +  L  L L  
Sbjct  226  LKNLREMYVGYFNSYTGGVPPEFGGLTNLQILDMASCTLTGEIPTSLSNLKHLHTLFLHI  285

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  286  NNLTGHIPP  294



>ref|XP_002970036.1| hypothetical protein SELMODRAFT_146738 [Selaginella moellendorffii]
 gb|EFJ29160.1| hypothetical protein SELMODRAFT_146738 [Selaginella moellendorffii]
Length=988

 Score =   119 bits (297),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 88/143 (62%), Gaps = 2/143 (1%)
 Frame = +1

Query  166  DSQSSLTSW-NISTSHCTWRRVTCdsllhvvsldlsg-lNLSGVLSPDVGQLPFLVNLSI  339
            DS  SL  W     + C W  +TCD  L  V        NLSG++S  +G+L  L+NL++
Sbjct  3    DSSGSLDDWTETDDTPCLWTGITCDDRLSRVVALDLSNKNLSGIVSSSIGRLTELINLTL  62

Query  340  AANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVE  519
              N  +G +P E++ +  L FLN+S+N F   FP + + L  L+VLD YNNN +G LP+E
Sbjct  63   DVNNFTGNLPGELATLHDLHFLNVSHNAFTGDFPGRFSNLQLLEVLDAYNNNFSGPLPIE  122

Query  520  VYKMTSLRHLHLGGNYFSGRIPP  588
            + ++ +LRHLHLGG+YF G IPP
Sbjct  123  LSRLPNLRHLHLGGSYFEGEIPP  145


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 63/102 (62%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L GV+  ++G L  L +L +  N LSGP+PP++  +  L+ L+LSNN      P +L +L
Sbjct  212  LEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKL  271

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL++L L+ N L+G++P  V  + +L+ L L  N F+G +P
Sbjct  272  QNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELP  313


 Score = 71.6 bits (174),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/103 (42%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + P++G+L  L  L IA+  L G +P E+  +S L  L L  N      P QL  
Sbjct  187  HFTGGIPPELGRLLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPPQLGD  246

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+ LDL NNNLTG +P+E+ K+ +L  L L  N  SG IP
Sbjct  247  LVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIP  289


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 57/104 (55%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG + P +G L  L +L ++ N L+G +P E+  +  L  L+L  N      P  +A 
Sbjct  235  HLSGPIPPQLGDLVNLKSLDLSNNNLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVAD  294

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NLQ L L+ NN TG+LP  + +  +L  L +  N  +G +PP
Sbjct  295  LPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPP  338


 Score = 62.4 bits (150),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  L++  N L GP+PPE+  +  L  L L   N F    P +L +
Sbjct  139  FEGEIPPSYGNMTSLSYLALCGNCLVGPIPPELGYLVGLEELYLGYFNHFTGGIPPELGR  198

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NLQ LD+ +  L G +P E+  +++L  L L  N+ SG IPP
Sbjct  199  LLNLQKLDIASCGLEGVIPAELGNLSNLDSLFLQINHLSGPIPP  242


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V +LP L  L + +N+  G +P E+  +S L  L+L +N      P +LAQ 
Sbjct  427  LQGSIPAGVARLPSLQKLFLHSNRFVGGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQC  486

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            + L  LD+ +N LTG +P E+  M  L  L++  N  SG IPP
Sbjct  487  SKLNYLDVSDNRLTGPIPAELGSMEVLELLNVSRNRLSGGIPP  529


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 32/100 (32%), Positives = 58/100 (58%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++GQL  L++L + +N+LSG +P E++  S L +L++S+N      P +L  +  
Sbjct  453  GGIPVELGQLSHLLHLDLHSNRLSGAIPAELAQCSKLNYLDVSDNRLTGPIPAELGSMEV  512

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L++L++  N L+G +P ++    SL       N FSG +P
Sbjct  513  LELLNVSRNRLSGGIPPQILGQESLTSADFSYNDFSGTVP  552


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 55/104 (53%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++ +L  L  LS+  N LSG +P  ++ +  L+ L L  N F    P +L +
Sbjct  259  NLTGAIPIELRKLQNLELLSLFLNGLSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGE  318

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              NL  LD+ +N LTG LP  + K   L  L L  N  +G IPP
Sbjct  319  NMNLTELDVSSNPLTGPLPPNLCKGGQLEVLVLIENGITGTIPP  362


 Score = 49.3 bits (116),  Expect = 9e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   V  LP L  L +  N  +G +P  +     L  L++S+N      P  L + 
Sbjct  284  LSGEIPAFVADLPNLQALLLWTNNFTGELPQRLGENMNLTELDVSSNPLTGPLPPNLCKG  343

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L  N +TG +P  +    SL  + L GN+ +G IP
Sbjct  344  GQLEVLVLIENGITGTIPPALGHCKSLIKVRLAGNHLTGPIP  385



>ref|XP_009108464.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Brassica rapa]
Length=995

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 71/160 (44%), Positives = 96/160 (60%), Gaps = 5/160 (3%)
 Frame = +1

Query  118  VTEQAALLSIKAAFTADSQSSLTSWNIST--SHCTWRRVTCdsllhvvsldlsg-lNLSG  288
            V +   L SIK +F +    SL SW +    S C+W  V+CD+L   ++      LN+SG
Sbjct  36   VRQAKVLFSIKQSFDS-YDPSLDSWTVPNFNSLCSWTGVSCDNLNQSITRLDISNLNISG  94

Query  289  VLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQLAQLAN  465
             LSP+V +LP LV LS+A+N  SG +P EI  +S L  LN+S N F G   P +  ++  
Sbjct  95   TLSPEVSRLPSLVFLSVASNSFSGKIPKEIHKLSNLEVLNISTNAFEGELAPLEFGEMTQ  154

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  LD YNNN TG LP+ + K+T L +L LGGNYF+G IP
Sbjct  155  LTTLDAYNNNFTGSLPLSLTKLTQLEYLDLGGNYFNGEIP  194


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G L  L  L +  N+L+G VP E+  +++L+ L+LSNN      P +L+ L
Sbjct  262  LKGSIPAELGFLKNLEILFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGL  321

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+ +L+ N L G++P  V  +  L+ L L  N F+G+IP
Sbjct  322  QELQLFNLFFNRLHGEIPEFVAHLPVLQILKLWHNNFTGKIP  363


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  ++G L  L+ + ++ N LSG +PPE     +L +L+LS+N      P Q++++
Sbjct  505  FTGQIPGEIGSLKSLLTIDMSRNNLSGKLPPEFGECQSLTYLDLSHNEISGQIPVQISRI  564

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LPVE+  M SL  +    N FSG +P
Sbjct  565  RILNYLNVSWNSLNQSLPVELGSMKSLTSVDFSHNNFSGSVP  606


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +  G +  D+G+L  LV+L +A   L G +P E+  +  L  L L  N    + P +L  
Sbjct  237  DFHGGIPADLGRLINLVHLDLANCSLKGSIPAELGFLKNLEILFLQTNELTGSVPRELGN  296

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L+ LDL NN L G++P+E+  +  L+  +L  N   G IP
Sbjct  297  MTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFFNRLHGEIP  339


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  ++++ N+L+GP+P  I  + +L+ L L +N F    P ++  L +L  +D+  NNL+
Sbjct  471  LTQINLSNNRLTGPIPSSIRNLRSLQILLLGSNRFTGQIPGEIGSLKSLLTIDMSRNNLS  530

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G LP E  +  SL +L L  N  SG+IP
Sbjct  531  GKLPPEFGECQSLTYLDLSHNEISGQIP  558


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +L G +  ++G +  L  L +   N   G +P ++  +  L  L+L+N     + P +L 
Sbjct  212  DLIGRIPNELGNITTLEKLYLGYYNDFHGGIPADLGRLINLVHLDLANCSLKGSIPAELG  271

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L NL++L L  N LTG +P E+  MTSL+ L L  N+  G IP
Sbjct  272  FLKNLEILFLQTNELTGSVPRELGNMTSLKTLDLSNNFLEGEIP  315


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++G +  L  L ++ N L G +P E+S +  L+  NL  N      P  +A L
Sbjct  286  LTGSVPRELGNMTSLKTLDLSNNFLEGEIPLELSGLQELQLFNLFFNRLHGEIPEFVAHL  345

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+L L++NN TG +P ++     L  + L  N  +G IP
Sbjct  346  PVLQILKLWHNNFTGKIPAKLGLNGKLVEIDLSSNKLTGLIP  387


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/106 (33%), Positives = 56/106 (53%), Gaps = 3/106 (3%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI---SAISTLRFLNLSNNIFGSTFPHQL  450
            L+G L   +  LP +  L +  N L+G +  E    + +S+L  +NLSNN      P  +
Sbjct  430  LTGTLPKGLIYLPNVSLLELQNNFLTGEIAEEEAGNTGLSSLTQINLSNNRLTGPIPSSI  489

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +LQ+L L +N  TG +P E+  + SL  + +  N  SG++PP
Sbjct  490  RNLRSLQILLLGSNRFTGQIPGEIGSLKSLLTIDMSRNNLSGKLPP  535


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 53/105 (50%), Gaps = 3/105 (3%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA--  453
            L G L  D+GQ   L    +  N L+G +P  +  +  +  L L NN        + A  
Sbjct  406  LFGPLPEDLGQCEPLWRFRLGQNFLTGTLPKGLIYLPNVSLLELQNNFLTGEIAEEEAGN  465

Query  454  -QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L++L  ++L NN LTG +P  +  + SL+ L LG N F+G+IP
Sbjct  466  TGLSSLTQINLSNNRLTGPIPSSIRNLRSLQILLLGSNRFTGQIP  510


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V  LP L  L +  N  +G +P ++     L  ++LS+N      P  L   
Sbjct  334  LHGEIPEFVAHLPVLQILKLWHNNFTGKIPAKLGLNGKLVEIDLSSNKLTGLIPETLCFG  393

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQ+L L+NN L G LP ++ +   L    LG N+ +G +P
Sbjct  394  RRLQILILFNNFLFGPLPEDLGQCEPLWRFRLGQNFLTGTLP  435



>ref|XP_003558681.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Brachypodium distachyon]
Length=1027

 Score =   118 bits (296),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 90/142 (63%), Gaps = 5/142 (4%)
 Frame = +1

Query  178  SLTSW-----NISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQLPFLVNLSIA  342
            +L SW     N S +HC W  VTC     VV LD+ GLNLSG L P + +L  L+ L + 
Sbjct  43   ALASWAAPKKNESAAHCAWAGVTCGPRGTVVGLDVGGLNLSGALPPALSRLRGLLRLDVG  102

Query  343  ANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEV  522
            AN   GPVP  +  +  L  LNLSNN F  + P  LA L  L+VLDLYNNNLT  LP+EV
Sbjct  103  ANAFFGPVPAALGHLQFLTHLNLSNNAFNGSLPPALACLRALRVLDLYNNNLTSPLPLEV  162

Query  523  YKMTSLRHLHLGGNYFSGRIPP  588
             +M  LRHLHLGGN+FSG+IPP
Sbjct  163  AQMPLLRHLHLGGNFFSGQIPP  184


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 56/105 (53%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE    + L++L +S N    T P +L  
Sbjct  153  NLTSPLPLEVAQMPLLRHLHLGGNFFSGQIPPEYGRWARLQYLAVSGNELSGTIPPELGN  212

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L L Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  213  LTSLRELYLGYYNSYSGGLPAELGNLTELVRLDAANCGLSGEIPP  257


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N LSG +P E+  + +L  L+LSNN+     P   ++L
Sbjct  251  LSGEIPPELGKLQKLDTLFLQVNGLSGSIPTELGYLKSLSSLDLSNNVLTGVIPASFSEL  310

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             N+ +L+L+ N L GD+P  V  + SL  L L  N F+G +P
Sbjct  311  KNMTLLNLFRNKLRGDIPDFVGDLPSLEVLQLWENNFTGGVP  352


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG +P EI  +  L   +LS+N      P ++ + 
Sbjct  468  LTGTLPASIGNFSGVQKLLLDRNSFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NNL+GD+P  +  M  L +L+L  N+  G IPP
Sbjct  528  RLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPP  570


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+  ++G+L  L    +++N + G VPPEI     L +L+LS N      P  ++ 
Sbjct  491  SFSGVMPAEIGRLQQLSKADLSSNSIEGGVPPEIGKCRLLTYLDLSRNNLSGDIPPAISG  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  551  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  593


 Score = 58.5 bits (140),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            ++ G + P++G+   L  L ++ N LSG +PP IS +  L +LNLS N      P  +A 
Sbjct  515  SIEGGVPPEIGKCRLLTYLDLSRNNLSGDIPPAISGMRILNYLNLSRNHLDGEIPPSIAT  574

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  +D   NNL+G +PV
Sbjct  575  MQSLTAVDFSYNNLSGLVPV  594



>ref|XP_009415746.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Musa acuminata subsp. malaccensis]
Length=978

 Score =   118 bits (296),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 75/157 (48%), Positives = 97/157 (62%), Gaps = 4/157 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+SIK +F + S+S L SWN S   S C W  V CD+ +HVV       LN+SG L
Sbjct  30   QASVLISIKRSFHS-SESFLPSWNPSNHASLCAWDGVRCDAAMHVVLALDLSNLNISGSL  88

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP +G+L  L  LS+A N LSG  P  +  ++ LR LN+SNN F  T     + +A L+V
Sbjct  89   SPVIGELKGLTYLSVAGNSLSGLFPSSVGKLAGLRHLNVSNNQFNGTLSWSFSYMAELEV  148

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            LD YNN+  G LPV + K+  LRHL LGGNYFSG IP
Sbjct  149  LDAYNNDFFGALPVGLSKLPKLRHLDLGGNYFSGTIP  185


 Score = 73.6 bits (179),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G L  L  L +  NQL+G +PP +  +S+LR+L++SNN      P + A+L
Sbjct  253  LEGEIPPELGNLKKLDTLFLQTNQLTGTIPPHLGNLSSLRYLDISNNALTGEIPKEFAEL  312

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L ++ N   G++P  V ++ +L  L L  N F+G IP
Sbjct  313  HQLSLLHMFMNRFHGEIPRFVAELPNLEVLKLWQNNFTGAIP  354


 Score = 67.0 bits (162),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  ++G L  LV+L +++  L G +PPE+  +  L  L L  N    T P  L  L
Sbjct  229  FDGGIPAELGSLIDLVHLDLSSCGLEGEIPPELGNLKKLDTLFLQTNQLTGTIPPHLGNL  288

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LD+ NN LTG++P E  ++  L  LH+  N F G IP
Sbjct  289  SSLRYLDISNNALTGEIPKEFAELHQLSLLHMFMNRFHGEIP  330


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G ++ +  + P  LV L+++ N+LSGP+P  I   S+L+ L LS N F    P QL  
Sbjct  445  LTGAMAEETAKKPAKLVQLNLSNNRLSGPLPSSIGNFSSLQMLLLSGNQFTGELPSQLGV  504

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L ++  +D+  NN +G +P E+    S+ +L L  N   G IP
Sbjct  505  LKHVLKIDVSRNNFSGGIPPEIGDCISVTYLDLSQNELIGPIP  547


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G    L  LS+A N L G +PPE+  ++TL+ L L   N F    P +L  
Sbjct  180  FSGTIPAAYGGFRALSYLSVAGNDLGGFIPPELGNVTTLKQLYLGYYNEFDGGIPAELGS  239

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L  LDL +  L G++P E+  +  L  L L  N  +G IPP
Sbjct  240  LIDLVHLDLSSCGLEGEIPPELGNLKKLDTLFLQTNQLTGTIPP  283


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G L   +G L  ++ + ++ N  SG +PPEI    ++ +L+LS N      P +L+Q 
Sbjct  494  FTGELPSQLGVLKHVLKIDVSRNNFSGGIPPEIGDCISVTYLDLSQNELIGPIPARLSQA  553

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L+L  N+L+  +P ++  M SL       N FSGRIP
Sbjct  554  RVLSYLNLSWNHLSESIPQDIGSMKSLTSADFSHNDFSGRIP  595


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA  453
            +L G + P++G +  L  L +   N+  G +P E+ ++  L  L+LS+       P +L 
Sbjct  203  DLGGFIPPELGNVTTLKQLYLGYYNEFDGGIPAELGSLIDLVHLDLSSCGLEGEIPPELG  262

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L  L  L L  N LTG +P  +  ++SLR+L +  N  +G IP
Sbjct  263  NLKKLDTLFLQTNQLTGTIPPHLGNLSSLRYLDISNNALTGEIP  306


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L+ + +  N L+G +P     +  L  L L NN        + A+ 
Sbjct  397  LFGSLPDDLGDCTTLLRVRMGQNYLTGSLPKGFLYLPELSLLELQNNYLTGAMAEETAKK  456

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             A L  L+L NN L+G LP  +   +SL+ L L GN F+G +P
Sbjct  457  PAKLVQLNLSNNRLSGPLPSSIGNFSSLQMLLLSGNQFTGELP  499


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    +  L ++ N+L GP+P  +S    L +LNLS N    + P  +  
Sbjct  517  NFSGGIPPEIGDCISVTYLDLSQNELIGPIPARLSQARVLSYLNLSWNHLSESIPQDIGS  576

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  577  MKSLTSADFSHNDFSGRIP  595


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI-STLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L      LP L  L +  N L+G +  E +   + L  LNLSNN      P  +  
Sbjct  421  LTGSLPKGFLYLPELSLLELQNNYLTGAMAEETAKKPAKLVQLNLSNNRLSGPLPSSIGN  480

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             ++LQ+L L  N  TG+LP ++  +  +  + +  N FSG IPP
Sbjct  481  FSSLQMLLLSGNQFTGELPSQLGVLKHVLKIDVSRNNFSGGIPP  524



>ref|XP_004238370.1| PREDICTED: receptor protein kinase CLAVATA1 [Solanum lycopersicum]
Length=986

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/161 (42%), Positives = 104/161 (65%), Gaps = 6/161 (4%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNIST-----SHCTWRRVTCdsllhvvsldlsglNLS  285
            ++  ALL +K +  A   S+L  WN +T     SHC++  +TC++  HV+S++++ + L 
Sbjct  25   SDLEALLKLKESMVAPGTSALLDWNNNTKNYPFSHCSFSGITCNNNSHVISINITNVPLF  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  462
            G + P++G L  L NL+I  + L+G +P E+S +S+++ +NLS N F   FP + L  L 
Sbjct  85   GTIPPEIGLLQNLENLTIFGDNLTGTLPLEMSQLSSIKHVNLSYNNFSGPFPREILLGLI  144

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L+  D+YNNN TG+LP+EV K+ +L  LHLGGNYF G IP
Sbjct  145  KLESFDIYNNNFTGELPIEVVKLKNLETLHLGGNYFHGEIP  185


 Score = 72.4 bits (176),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G + P +G L  LV LS+  N+LSG +P EI++++ L  +NLS N      P  +A  
Sbjct  468  ITGNIPPSLGNLKNLVTLSLDVNRLSGEIPQEIASLNKLVTINLSGNNLTGEIPSSIALC  527

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + L ++DL  N L G++P E+ K+ SL  L+L  N  SG IP
Sbjct  528  SELTLVDLSRNQLVGEVPKEITKLNSLNALNLSRNQLSGAIP  569


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  ++  L  L++  ++ NQL+G +P     +  L  +NL  N      P  +  L
Sbjct  277  LTGHIPSELSGLESLMSFDLSFNQLTGEIPESFVKLQKLTLINLFRNNLHGPIPSFIGDL  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VL ++ NN T +LP  + +   L  L +  N+F+GRIPP
Sbjct  337  PNLEVLQIWGNNFTLELPENLGRNGRLLFLDISINHFTGRIPP  379


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L+ L I+ N  +G +PP++     L+ L L  N F    P QL +
Sbjct  348  NFTLELPENLGRNGRLLFLDISINHFTGRIPPDLCKGGKLKTLILMENYFFGPIPEQLGE  407

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N L G +P   +K+ +L  L L  NYF+G +P
Sbjct  408  CKSLTRIRVRKNYLNGTIPAGFFKLPALDMLELDNNYFTGELP  450


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/104 (31%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G + PD+ +   L  L +  N   GP+P ++    +L  + +  N    T P    +
Sbjct  372  HFTGRIPPDLCKGGKLKTLILMENYFFGPIPEQLGECKSLTRIRVRKNYLNGTIPAGFFK  431

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L +L+L NN  TG+LP E+    +L  L L  N+ +G IPP
Sbjct  432  LPALDMLELDNNYFTGELPTEI-NANNLTKLVLSNNWITGNIPP  474


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 47/103 (46%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAA-NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +   +  LP L  L +   N   G +P E   ISTL+ L+L N       P  L  
Sbjct  204  LTGKIPKSLALLPNLEELRLGYYNSYEGGIPSEFGNISTLKLLDLGNCNLDGEVPPSLGN  263

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  L L  N LTG +P E+  + SL    L  N  +G IP
Sbjct  264  LKKLHSLFLQVNRLTGHIPSELSGLESLMSFDLSFNQLTGEIP  306


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +     +L  L  +++  N L GP+P  I  +  L  L +  N F    P  L + 
Sbjct  301  LTGEIPESFVKLQKLTLINLFRNNLHGPIPSFIGDLPNLEVLQIWGNNFTLELPENLGRN  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LD+  N+ TG +P ++ K   L+ L L  NYF G IP
Sbjct  361  GRLLFLDISINHFTGRIPPDLCKGGKLKTLILMENYFFGPIP  402



>ref|XP_006473681.1| PREDICTED: receptor protein kinase CLAVATA1-like [Citrus sinensis]
Length=982

 Score =   118 bits (295),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 67/159 (42%), Positives = 102/159 (64%), Gaps = 4/159 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            ++   LL +K++      S L +W  S+S   HC++  VTCD    VVSL++S + L G 
Sbjct  27   SDMDVLLKLKSSMIGPKGSGLKNWEPSSSPSAHCSFSGVTCDQDSRVVSLNVSFMPLFGS  86

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ-LANL  468
            + P++G L  LVNL+I+   L+G +P E++ +++L+  N+S N+F   F  Q+ + +  L
Sbjct  87   IPPEIGLLTKLVNLTISNVNLTGRLPSEMALLTSLKVFNISGNVFQGNFAGQIVRGMTEL  146

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            QVLD YNNN TG LPVE+  + SL+HL  GGNYF+G+IP
Sbjct  147  QVLDAYNNNFTGPLPVEIASLKSLKHLSFGGNYFTGKIP  185


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + QL  L +L +  N+L+G +PP++S + +L+ L+LS N      P   A 
Sbjct  252  NISGEIPTSLSQLKLLHSLFLQMNKLTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAA  311

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL +L L+ NNL G +P  +    +L  L + GN F+  +P
Sbjct  312  LKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELP  354


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N LSG +P ++S  ++L  L ++NN      P  +  L
Sbjct  421  LNGTIPAGLFNLPLLNMMELDDNLLSGELPEKMSG-ASLNQLKVANNNITGKIPAAIGNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L L NN L G++PVE + +  +  +++  N  SG IP
Sbjct  480  PSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEIP  521


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G +PPE  A++ L+ L++++       P  L+QL  L  L L  N LTG +P ++ 
Sbjct  227  NTYTGGIPPEFGALTQLQVLDMASCNISGEIPTSLSQLKLLHSLFLQMNKLTGHIPPQLS  286

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  NY +G IP
Sbjct  287  GLISLKSLDLSLNYLTGEIP  306


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 45/79 (57%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N+SG +   + Q   L ++ ++ N L G +PP IS +  L  LNLS N    + P+++  
Sbjct  515  NISGEIPYSISQCHSLTSVDLSRNSLYGKIPPGISKLIDLSILNLSRNGITGSIPNEMRN  574

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  LDL  NNL G++P
Sbjct  575  MMSLTTLDLSYNNLIGNIP  593


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P +  L  L +L ++ N L+G +P   +A+  L  L L  N      P  L   
Sbjct  277  LTGHIPPQLSGLISLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDF  336

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL ++ NN T +LP  + +   L  L +  N+ +G IP
Sbjct  337  PNLEVLQVWGNNFTFELPENLGRNGKLLILDVTSNHLTGTIP  378


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +      L  L  L +  N L GP+P  +     L  L +  N F    P  L + 
Sbjct  301  LTGEIPESFAALKNLTLLQLFKNNLRGPIPSFLGDFPNLEVLQVWGNNFTFELPENLGRN  360

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +LD+ +N+LTG +P ++ K   L+ L L  N+F G IP
Sbjct  361  GKLLILDVTSNHLTGTIPRDLCKGGKLKSLILMQNFFIGPIP  402


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/129 (26%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G L  ++  L  L +LS   N  +G +P   S I +L ++ L+              
Sbjct  155  NFTGPLPVEIASLKSLKHLSFGGNYFTGKIPESYSEIQSLEYIGLNGIGLNGTVPAFLSR  214

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L  LQVLD+ + N++G++P  + ++  L  L L  
Sbjct  215  LKNLREMYIGYFNTYTGGIPPEFGALTQLQVLDMASCNISGEIPTSLSQLKLLHSLFLQM  274

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  275  NKLTGHIPP  283


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 35/101 (35%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            +G + P+ G L  L  L +A+  +SG +P  +S +  L  L L  N      P QL+ L 
Sbjct  230  TGGIPPEFGALTQLQVLDMASCNISGEIPTSLSQLKLLHSLFLQMNKLTGHIPPQLSGLI  289

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L+ LDL  N LTG++P     + +L  L L  N   G IP
Sbjct  290  SLKSLDLSLNYLTGEIPESFAALKNLTLLQLFKNNLRGPIP  330


 Score = 49.7 bits (117),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 46/86 (53%), Gaps = 0/86 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L +A N ++G +P  I  + +L  L+L NN      P +   L  +  +++ +NN++G++
Sbjct  461  LKVANNNITGKIPAAIGNLPSLNILSLQNNRLEGEIPVESFNLKMITSINISDNNISGEI  520

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIPP  588
            P  + +  SL  + L  N   G+IPP
Sbjct  521  PYSISQCHSLTSVDLSRNSLYGKIPP  546



>ref|XP_007040964.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
 gb|EOX96795.1| Leucine-rich receptor-like protein kinase family protein [Theobroma 
cacao]
Length=986

 Score =   118 bits (295),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 72/162 (44%), Positives = 96/162 (59%), Gaps = 6/162 (4%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNIS--TSHCTWRRVTCdsllhvvsldlsg-lN  279
            L + +QA++L S+K  F  DS + L SWN+S   S C+W  V CD L   +        N
Sbjct  30   LSLEKQASILVSLKQEF--DSSTPLRSWNVSHHLSVCSWTGVQCDVLNRSIVSLDISNSN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG LSP + QL  L NLS++ N  SG  P EI  ++ L+FLN+SNN+F        +Q+
Sbjct  88   ISGSLSPVITQLRSLANLSVSGNSFSGDFPQEIHKLTRLQFLNISNNMFSGEPNWDFSQM  147

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L VLD Y+NN  G LP+ V K+  L HL+ GGNYFSG IP
Sbjct  148  KELVVLDAYDNNFNGSLPLGVTKLPKLTHLNFGGNYFSGEIP  189


 Score = 73.2 bits (178),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV+L +A   L GP+PPE+  +  L  L L  N    + P  +  L
Sbjct  233  FDGGIPPEFGKLVNLVHLDLANCSLEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNL  292

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +NL+ LDL NN +TGD+P+E+  +  L  L+L  N F G IP
Sbjct  293  SNLKSLDLSNNMITGDIPLELSGLCELILLNLFVNRFHGEIP  334


 Score = 68.2 bits (165),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 59/102 (58%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G + P++G L  L  L +  N++SG +PP I  +S L+ L+LSNN+     P +L+ L
Sbjct  257  LEGPIPPELGNLKKLDTLFLQTNEISGSIPPHIGNLSNLKSLDLSNNMITGDIPLELSGL  316

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N   G++P  + ++  L  L L  N F+G IP
Sbjct  317  CELILLNLFVNRFHGEIPQFIAELPKLEVLKLWHNNFTGSIP  358


 Score = 65.1 bits (157),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G L  L +L ++ N ++G +P E+S +  L  LNL  N F    P  +A+L
Sbjct  281  ISGSIPPHIGNLSNLKSLDLSNNMITGDIPLELSGLCELILLNLFVNRFHGEIPQFIAEL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++     L  L L  N  +G +P
Sbjct  341  PKLEVLKLWHNNFTGSIPSKLGANGRLVELDLSTNKLTGLVP  382


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +   +G    L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  521  NFSGTIPSKIGNCILLTYLDLSQNQLSGPIPVQIAQIHILNYLNVSWNHLNQSLPKEIGS  580

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  581  IKSLTSADFSHNNFSGSIP  599


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 39/104 (38%), Positives = 52/104 (50%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +    G L  L  LS+A N L G +P E+  ++ L+ L L   N F    P +  +
Sbjct  184  FSGEIPKAYGSLEQLKYLSLAGNDLGGSIPAELGNLTNLKQLFLGYYNEFDGGIPPEFGK  243

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL N +L G +P E+  +  L  L L  N  SG IPP
Sbjct  244  LVNLVHLDLANCSLEGPIPPELGNLKKLDTLFLQTNEISGSIPP  287


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 49/94 (52%), Gaps = 0/94 (0%)
 Frame = +1

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            + +LP L  L +  N  +G +P ++ A   L  L+LS N      P  L     LQ+L L
Sbjct  337  IAELPKLEVLKLWHNNFTGSIPSKLGANGRLVELDLSTNKLTGLVPKSLCFGRRLQILIL  396

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +NN L G LP ++ K  +L  + +G NY +G IP
Sbjct  397  FNNFLFGPLPEDLSKCDTLSRVRMGQNYLTGSIP  430


 Score = 52.4 bits (124),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L  L +++N+ +G  P EI  + ++  L++S N F  T P ++   
Sbjct  474  LSGSLPASIGNFSSLQILLLSSNRFTGEFPSEIGRLKSVLKLDMSRNNFSGTIPSKIGNC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N L+G +PV++ ++  L +L++  N+ +  +P
Sbjct  534  ILLTYLDLSQNQLSGPIPVQIAQIHILNYLNVSWNHLNQSLP  575


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPF-LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +  D G +P  L  L+++ N+LSG +P  I   S+L+ L LS+N F   FP ++ +
Sbjct  449  LSGRIPQDTGMVPTKLGQLNLSNNRLSGSLPASIGNFSSLQILLLSSNRFTGEFPSEIGR  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L ++  LD+  NN +G +P ++     L +L L  N  SG IP
Sbjct  509  LKSVLKLDMSRNNFSGTIPSKIGNCILLTYLDLSQNQLSGPIP  551


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 49/103 (48%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G +   +G    LV L ++ N+L+G VP  +     L+ L L NN      P  L++
Sbjct  352  NFTGSIPSKLGANGRLVELDLSTNKLTGLVPKSLCFGRRLQILILFNNFLFGPLPEDLSK  411

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  + +  N LTG +P     +  L  + L  NY SGRIP
Sbjct  412  CDTLSRVRMGQNYLTGSIPNGFLYLPELSLVELQNNYLSGRIP  454



>gb|KJB29653.1| hypothetical protein B456_005G112100 [Gossypium raimondii]
Length=980

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 102/161 (63%), Gaps = 4/161 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L +W  S+S   HC +  V CD    VV+L++S   L 
Sbjct  25   GSSDLEVLLLLKSSMIGPKGSGLENWEFSSSPSAHCRFSGVQCDEDFSVVALNVSFAPLF  84

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQLA  462
            G + P++G L  LVNL+I+++ L+G +P E+  +++L+  N+SNN+F  +FP ++ A + 
Sbjct  85   GTIPPEIGLLNKLVNLTISSDSLTGRIPVEMGNLTSLKIFNISNNVFQGSFPGEIFAGMT  144

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L++LD YNNN TG LP+EV  +  L+HL  GGN+F G IP
Sbjct  145  HLEILDAYNNNFTGVLPIEVVNLKYLKHLSFGGNFFMGEIP  185


 Score = 70.9 bits (172),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
              SG +  ++  +  L  ++I+ N ++G +PP IS  ++L  ++ S N F    P  + +
Sbjct  491  KFSGEIPGEIFNIKLLSKMNISDNNITGEIPPSISRCTSLTSIDFSRNSFTGEIPDGIDE  550

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L +L+   N LTG++P E+  M SL  L L  NY  GRIP
Sbjct  551  LKDLSILNFSRNQLTGEIPAEIRNMISLTTLDLSYNYLVGRIP  593


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L I+ N +SG +PP I  + +L+ L+L  N F    P ++  +  L  +++ +NN+T
Sbjct  458  LGQLKISNNWISGKIPPAIGNLRSLQVLSLEMNKFSGEIPGEIFNIKLLSKMNISDNNIT  517

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G++P  + + TSL  +    N F+G IP
Sbjct  518  GEIPPSISRCTSLTSIDFSRNSFTGEIP  545


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 55/103 (53%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP L  + +  N  SG +P ++S  ++L  L +SNN      P  +  L
Sbjct  421  LNGTIPAGIFNLPLLSIMELGDNFFSGELPSQMSG-ASLGQLKISNNWISGKIPPAIGNL  479

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +LQVL L  N  +G++P E++ +  L  +++  N  +G IPP
Sbjct  480  RSLQVLSLEMNKFSGEIPGEIFNIKLLSKMNISDNNITGEIPP  522


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 36/128 (28%), Positives = 57/128 (45%), Gaps = 25/128 (20%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +GVL  +V  L +L +LS   N   G +P E S I +L +L L+              
Sbjct  155  NFTGVLPIEVVNLKYLKHLSFGGNFFMGEIPEEYSEIQSLEYLGLNGIGLTGKTPSFLAR  214

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L+ L++LD+ + N+TG++P  +  +  L  L L  
Sbjct  215  LTNLKYLVIGYFNAYDGGIPPEYGSLSQLELLDMASCNITGEIPSSLSNLKHLHSLFLQL  274

Query  562  NYFSGRIP  585
            N  +GRIP
Sbjct  275  NRLTGRIP  282


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            L+G +   +  L  L +L ++ N+L+G +P   SA++ +  +NL  NN++GS  P  +  
Sbjct  277  LTGRIPSQLSGLISLKSLDLSINELTGEIPDSFSALNKITLINLFKNNLYGS-IPSFVGD  335

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+V  ++ NN T +LP  + +   L  L +  N+ +G IP
Sbjct  336  YPHLEVFQVWGNNFTFELPQNLGRNGKLYKLDVASNHLTGLIP  378


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 30/104 (29%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L +  N   GP+P E+    +L  + +  N+   T P  +  
Sbjct  372  HLTGLIPRDLCKGGRLETLIMMENFFFGPLPEELGNCKSLTKIRIMKNLLNGTIPAGIFN  431

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L +++L +N  +G+LP ++    SL  L +  N+ SG+IPP
Sbjct  432  LPLLSIMELGDNFFSGELPSQM-SGASLGQLKISNNWISGKIPP  474



>ref|XP_010428620.1| PREDICTED: receptor protein kinase CLAVATA1-like [Camelina sativa]
Length=993

 Score =   117 bits (294),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  39   TDMDVLLTLKSSMIGPNGDGLHDWIHSPSPAAHCSFTGVSCDGEARVISLNVSFTPLFGK  98

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQLA-QLAN  465
            +SP++G L  LVNL++AAN  +G +P E+ ++++L+ LN+SNN+    +FP ++   + +
Sbjct  99   ISPEIGMLNRLVNLTLAANNFTGELPLEMKSLTSLKVLNISNNVNLSGSFPGEIVIAMVD  158

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLD YNNN TG LP+E+ K+ +L+HL LGGN+F+G IP
Sbjct  159  LEVLDAYNNNFTGTLPLEIAKLKNLKHLSLGGNFFTGEIP  198


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++ +L  L  ++ +AN ++G +P  IS  +TL  ++LS N      P ++  + N
Sbjct  507  GSIPREIFELKHLSKINTSANNITGVIPDSISRCTTLISVDLSRNRINGEIPKEINNVIN  566

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+L  N LTG +P  +  MTSL  L L  N  SGR+P
Sbjct  567  LGTLNLSGNQLTGSIPTGIGNMTSLTTLDLSFNDLSGRVP  606


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLA  453
            NL+G + P++  L  L +L ++ NQL+G +P     +  +  +NL  NN++G   P  + 
Sbjct  289  NLTGHIPPELSGLISLKSLDLSINQLTGEIPQSFIDLGNITLINLFRNNLYGP-IPEFIG  347

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LQV +++ NN T  LP  + +  +L+ L +  N+ +G IP
Sbjct  348  ELPKLQVFEVWENNFTLQLPANLGRNGNLKKLDVSYNHLTGLIP  391


 Score = 51.6 bits (122),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L ++ N   GP+P E+    +L  + +  N+   T P  L  
Sbjct  385  HLTGLIPMDLCRGEKLEMLILSNNFFFGPIPEELGKCKSLNKIRIVKNLLNGTVPAGLFN  444

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  + +++L +N  +G+LP ++    +   ++L  N+FSG IPP
Sbjct  445  LPLVTIIELTDNIFSGELPTKMSGAVA-DQIYLSNNWFSGEIPP  487


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G L  ++ +L  L +LS+  N  +G +P     I +L +L L+              
Sbjct  168  NFTGTLPLEIAKLKNLKHLSLGGNFFTGEIPESYGDIQSLEYLGLNGAGLSGKSPAFLSR  227

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L NLQ+LD+ +  LTG++P  +  +  L  L L  
Sbjct  228  LKNLREMYVGYFNSYTGGVPPEFGGLTNLQILDMASCTLTGEIPTSLSNLKHLHTLFLHI  287

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  288  NNLTGHIPP  296



>gb|EEE60014.1| hypothetical protein OsJ_12761 [Oryza sativa Japonica Group]
Length=979

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/104 (57%), Positives = 73/104 (70%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG L  ++  L  L+ LS+ AN  SGP+P  +  +  L +LNLSNN F  +FP  LA+
Sbjct  56   NLSGALPAELTGLRGLMRLSVGANAFSGPIPASLGRLQFLTYLNLSNNAFNGSFPAALAR  115

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  L+VLDLYNNNLT  LP+EV +M  LRHLHLGGN+FSG IPP
Sbjct  116  LRGLRVLDLYNNNLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPP  159


 Score = 63.2 bits (152),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L  L +  N L+G +P E+  + +L  L+LSNN+     P   ++L
Sbjct  226  LSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLKSLSSLDLSNNVLTGEIPASFSEL  285

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL +L+L+ N L GD+P  V  + SL  L L  N  +G +PP
Sbjct  286  KNLTLLNLFRNKLRGDIPDFVGDLPSLELLDLSSNRLTGTLPP  328


 Score = 62.8 bits (151),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SGV+ P++G+L  L    +++N L G VPPEI     L +L+LS N      P  ++ 
Sbjct  442  SFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPPAISG  501

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  L  L+L  N+L G++P  +  M SL  +    N  SG +P
Sbjct  502  MRILNYLNLSRNHLDGEIPPSIATMQSLTAVDFSYNNLSGLVP  544


 Score = 61.6 bits (148),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G L   +G    +  L +  N  SG VPPEI  +  L   +LS+N      P ++ + 
Sbjct  419  LTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRLQKLSKADLSSNALEGGVPPEIGKC  478

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L  LDL  NN++G +P  +  M  L +L+L  N+  G IPP
Sbjct  479  RLLTYLDLSRNNISGKIPPAISGMRILNYLNLSRNHLDGEIPP  521


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 56/103 (54%), Gaps = 6/103 (6%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG  +P++G++      S++ NQL+G +P  I   S ++ L L  N F    P ++ +L
Sbjct  401  VSGAAAPNLGEI------SLSNNQLTGALPASIGNFSGVQKLLLDRNSFSGVVPPEIGRL  454

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L   DL +N L G +P E+ K   L +L L  N  SG+IPP
Sbjct  455  QKLSKADLSSNALEGGVPPEIGKCRLLTYLDLSRNNISGKIPP  497


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 36/105 (34%), Positives = 54/105 (51%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+  L  +V Q+P L +L +  N  SG +PPE      +++L +S N      P +L  
Sbjct  128  NLTSPLPMEVVQMPLLRHLHLGGNFFSGEIPPEYGRWGRMQYLAVSGNELSGKIPPELGN  187

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L +L+ L + Y N+ +G LP E+  +T L  L       SG IPP
Sbjct  188  LTSLRELYIGYYNSYSGGLPPELGNLTELVRLDAANCGLSGEIPP  232


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/101 (40%), Positives = 53/101 (52%), Gaps = 0/101 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
            SG L P++G L  LV L  A   LSG +PPE+  +  L  L L  N      P +L  L 
Sbjct  203  SGGLPPELGNLTELVRLDAANCGLSGEIPPELGKLQNLDTLFLQVNSLAGGIPSELGYLK  262

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LDL NN LTG++P    ++ +L  L+L  N   G IP
Sbjct  263  SLSSLDLSNNVLTGEIPASFSELKNLTLLNLFRNKLRGDIP  303



>ref|XP_008225951.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Prunus mume]
Length=986

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 71/163 (44%), Positives = 97/163 (60%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALL-SIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lN  279
            L +  QA++L S+K +F A S  SL SWN+S     C+W  + CD++   V        N
Sbjct  29   LSLRRQASILVSVKQSFEA-SNPSLNSWNVSNYMFLCSWAGIHCDNMNISVVSLDISNYN  87

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG LSP + +L  LVNLS++ N  SG  PPEI  ++ L++LN+SNN F      + AQL
Sbjct  88   LSGSLSPAITELRTLVNLSVSGNGFSGIFPPEIHKLARLQYLNISNNGFSGNLSWEFAQL  147

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +LD YNN+  G LP+ V ++  L+ L  GGNYFS  IPP
Sbjct  148  KELILLDAYNNDFNGSLPLGVTQIPKLKRLDFGGNYFSRNIPP  190


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            L+G L  +  ++P  L  L++++N+LSGP+P  I   S+L+ L LS N F    P  + +
Sbjct  449  LTGQLLEEASKVPSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGR  508

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD   NN +G +P EV    SL +L L  N  +G IP
Sbjct  509  LVNVLKLDFSRNNFSGRIPPEVGNCLSLTYLDLSQNQLTGPIP  551


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  233  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKQLDTLFLQTNQLSGSIPAQLGNL  292

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP
Sbjct  293  SSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIP  334


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E SA+  L  LNL  N F    PH +A+L
Sbjct  281  LSGSIPAQLGNLSSLRSLDLSNNALTGDMPAEFSALRELTLLNLFINKFHGEIPHAIAEL  340

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  341  PKLEVLKLWHNNFTGAIPSKLGQNGKLIELDLSSNKLTGVVP  382


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  D+G+L  ++ L  + N  SG +PPE+    +L +L+LS N      P Q+ Q+
Sbjct  498  FTGEIPSDIGRLVNVLKLDFSRNNFSGRIPPEVGNCLSLTYLDLSQNQLTGPIPFQIVQI  557

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L   ++  N+L   LP E+  M SL       N FSG IP
Sbjct  558  HILNYFNVSWNHLNQSLPRELGSMKSLTSADFSHNSFSGSIP  599


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V Q+P L  L    N  S  +PP    +  L +L+++ N      P +L  
Sbjct  159  DFNGSLPLGVTQIPKLKRLDFGGNYFSRNIPPSYGNMVQLNYLSVAGNDLSGFIPSELGN  218

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+ L L Y N   G +P E+ K+ +L HL L      G IPP
Sbjct  219  LTNLKQLFLGYYNEFEGGIPPEIGKLINLFHLDLANCGLEGPIPP  263


 Score = 55.5 bits (132),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L NL ++ NQ +G +P +I  +  +  L+ S N F    P ++   
Sbjct  474  LSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRNNFSGRIPPEVGNC  533

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  LDL  N LTG +P ++ ++  L + ++  N+ +  +P
Sbjct  534  LSLTYLDLSQNQLTGPIPFQIVQIHILNYFNVSWNHLNQSLP  575


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P+VG    L  L ++ NQL+GP+P +I  I  L + N+S N    + P +L  
Sbjct  521  NFSGRIPPEVGNCLSLTYLDLSQNQLTGPIPFQIVQIHILNYFNVSWNHLNQSLPRELGS  580

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +N+ +G +P
Sbjct  581  MKSLTSADFSHNSFSGSIP  599


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 59/128 (46%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  387
            L G L  D+G+   LV + +  N L+G +P      PE+S +                  
Sbjct  401  LFGPLPNDLGKCDTLVRVRMGQNYLTGSIPQGFLYLPELSLVELQNNYLTGQLLEEASKV  460

Query  388  -STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
             S L  LNLS+N      P  +   ++LQ L L  N  TG++P ++ ++ ++  L    N
Sbjct  461  PSKLSQLNLSSNRLSGPLPTSIGNFSSLQNLLLSGNQFTGEIPSDIGRLVNVLKLDFSRN  520

Query  565  YFSGRIPP  588
             FSGRIPP
Sbjct  521  NFSGRIPP  528



>ref|XP_010935096.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Elaeis guineensis]
Length=987

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 67/151 (44%), Positives = 95/151 (63%), Gaps = 1/151 (1%)
 Frame = +1

Query  136  LLSIKAAFTADSQSSLTSWNIST-SHCTWRRVTCdsllhvvsldlsglNLSGVLSPDVGQ  312
            L+ +K      + + L  W+ S  +HC++  VTCD+   VV+L++S +     L P++G 
Sbjct  30   LMKLKDGLHGPAGNDLHDWDPSGPTHCSFSGVTCDADARVVALNVSYIRFHRPLPPEIGL  89

Query  313  LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNN  492
            L  LVNL++A N L+G +PPEI A+  LRFLN+SNN F   FP        L VLD YNN
Sbjct  90   LDRLVNLTVACNFLTGQLPPEIGALPALRFLNISNNNFTGRFPDVDGGFPALVVLDAYNN  149

Query  493  NLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N +G LP+ + K+  LR++HLGGN+FSG IP
Sbjct  150  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIP  180


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/104 (37%), Positives = 59/104 (57%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G + PD+G L  L +L ++ N+L+G +P   + +  L+ LNL  N F    P  +A 
Sbjct  271  HLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAGLKQLKLLNLFRNHFRGRIPPFIAD  330

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+VL L+ NN T +LP  + +   L  L +  N  +G IPP
Sbjct  331  LPNLEVLQLWENNFTFELPGGLGRNGRLLKLDVATNRLTGTIPP  374


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
             G + P+ G L  LV L +A   LSG +P  +  +  L  L L  N    + P  L  L 
Sbjct  225  EGGIPPEFGMLTSLVRLDMAYCNLSGRIPASLGQLKLLDSLFLQWNHLTGSIPPDLGGLD  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             LQ LDL  N LTG+LP     +  L+ L+L  N+F GRIPP
Sbjct  285  RLQSLDLSINELTGELPESFAGLKQLKLLNLFRNHFRGRIPP  326


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   +GQL  L +L +  N L+G +PP++  +  L+ L+LS N      P   A 
Sbjct  247  NLSGRIPASLGQLKLLDSLFLQWNHLTGSIPPDLGGLDRLQSLDLSINELTGELPESFAG  306

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L++L+L+ N+  G +P  +  + +L  L L  N F+  +P
Sbjct  307  LKQLKLLNLFRNHFRGRIPPFIADLPNLEVLQLWENNFTFELP  349


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G L  L  LS+ +N++SG +P +I  +  L  L L  N      P  LA+ 
Sbjct  463  ISGPIPPAIGNLRGLQTLSLESNRISGEIPAQIGDLKQLSRLYLRGNNLTGEIPPDLARC  522

Query  460  AN-LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A  L+V+DL  N+L G +P  + ++ +L  L+L  N  SG IP
Sbjct  523  AGTLEVVDLSRNHLIGVIPDAITELQNLNTLNLSRNQLSGEIP  565


 Score = 56.2 bits (134),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L   + +LP L  + +  N  SG +P     I +L +L L+ N      P  L+Q
Sbjct  150  NFSGPLPLGLAKLPHLRYIHLGGNFFSGEIPESYGGIGSLEYLGLNGNALSGRVPVSLSQ  209

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L NL+ + + Y +   G +P E   +TSL  L +     SGRIP
Sbjct  210  LTNLREMYIGYYSTYEGGIPPEFGMLTSLVRLDMAYCNLSGRIP  253


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + PD+     L  L +  N   GP+P ++    +L  + L+ N    T P  L  L
Sbjct  368  LTGTIPPDLCASGRLEQLVLMQNAFFGPIPEKLGDCKSLLHVRLAKNFLNGTIPAGLFDL  427

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             ++ +L+L +N L+G+LP  +     L  L L  N+ SG IPP
Sbjct  428  PSVDMLELSDNYLSGELPGRIAG-DKLGELLLSNNWISGPIPP  469


 Score = 51.2 bits (121),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/89 (35%), Positives = 48/89 (54%), Gaps = 1/89 (1%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L  L ++ N +SGP+PP I  +  L+ L+L +N      P Q+  L  L  L L  NNLT
Sbjct  453  LGELLLSNNWISGPIPPAIGNLRGLQTLSLESNRISGEIPAQIGDLKQLSRLYLRGNNLT  512

Query  502  GDLPVEVYKMT-SLRHLHLGGNYFSGRIP  585
            G++P ++ +   +L  + L  N+  G IP
Sbjct  513  GEIPPDLARCAGTLEVVDLSRNHLIGVIP  541



>ref|XP_006300675.1| hypothetical protein CARUB_v10019714mg [Capsella rubella]
 gb|EOA33573.1| hypothetical protein CARUB_v10019714mg [Capsella rubella]
Length=990

 Score =   117 bits (293),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 68/163 (42%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++        L  W  S S   HC++  V+CD    V+SL++S   L
Sbjct  33   LAYTDMDVLLTLKSSMIGPKGDGLHDWTHSPSPAAHCSFSGVSCDGERRVISLNVSFTPL  92

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  456
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN      FP + L  
Sbjct  93   FGTISPEIGMLNRLVNLTLAANNFSGELPLEMKSLTSLKVLNISNNANLNGRFPGEILKA  152

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L+VLD YNNN TG LP+E+ ++ +L+HL LGGN+F+G IP
Sbjct  153  MVDLEVLDAYNNNFTGTLPLEIPELKNLKHLSLGGNFFTGEIP  195


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++ +L  L  ++ +AN ++G +P  +S  +TL  ++LS N      P ++  + N
Sbjct  504  GNIPREIFELKHLTKINTSANNITGVIPDSVSRCTTLISVDLSRNRINGEIPKEINNVIN  563

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+L  N LTG +P  +  MTSL  L L  N  SGR+P
Sbjct  564  LGTLNLSGNQLTGSIPTGIGNMTSLTTLDLSYNDLSGRVP  603


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 59/104 (57%), Gaps = 2/104 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLA  453
            NL+G + P++  L  L +L ++ NQL+G +P     +  +  +NL  NN++G   P  + 
Sbjct  286  NLTGHIPPELSGLISLKSLDLSINQLTGEIPQSFIDLGNITLINLFRNNLYGP-IPDFIG  344

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +L  LQV +++ NN T  LP  + +  +L+ L +  N+ +G IP
Sbjct  345  ELPKLQVFEVWENNFTLQLPANLGRNGNLKKLDVSSNHLTGLIP  388


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L  L +++N L+G +P ++     L  L LSNN F    P +L Q
Sbjct  358  NFTLQLPANLGRNGNLKKLDVSSNHLTGLIPMDLCRGEKLEMLVLSNNFFFGPIPEELGQ  417

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N L G +P  ++ +  +  + L  N+FSG +P
Sbjct  418  CKSLNKIRIVKNLLNGTVPAGLFNLPLVTIIELNDNFFSGELP  460


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/106 (30%), Positives = 57/106 (54%), Gaps = 5/106 (5%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L ++ N   GP+P E+    +L  + +  N+   T P  L  
Sbjct  382  HLTGLIPMDLCRGEKLEMLVLSNNFFFGPIPEELGQCKSLNKIRIVKNLLNGTVPAGLFN  441

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTS--LRHLHLGGNYFSGRIPP  588
            L  + +++L +N  +G+LP    KM+   L  ++L  N+FSG IPP
Sbjct  442  LPLVTIIELNDNFFSGELPA---KMSGDVLDQIYLSNNWFSGEIPP  484


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 25/80 (31%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N++GV+   V +   L+++ ++ N+++G +P EI+ +  L  LNLS N    + P  +  
Sbjct  525  NITGVIPDSVSRCTTLISVDLSRNRINGEIPKEINNVINLGTLNLSGNQLTGSIPTGIGN  584

Query  457  LANLQVLDLYNNNLTGDLPV  516
            + +L  LDL  N+L+G +P+
Sbjct  585  MTSLTTLDLSYNDLSGRVPL  604



>ref|XP_008221401.1| PREDICTED: receptor protein kinase CLAVATA1 [Prunus mume]
Length=896

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCT----WRRVTCdsllhvvsldlsglNL  282
            G ++  ALL +K+A      S L  WN S+   +    +  V+CD    VV+L++S   L
Sbjct  25   GYSDLHALLKLKSAMIGPKGSGLEDWNTSSLSPSSHCSFSGVSCDRDFRVVALNVSNQPL  84

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G L P++G L  LVNL+IA + ++G +P +++ ++ LR LN+SNN+F   FP  +  Q+
Sbjct  85   LGTLPPEIGLLNKLVNLTIAGDNITGRLPMQMANLTALRHLNISNNVFRGRFPGNITLQM  144

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQVLD YNNN TG LP+E+  + +L+HL LGGNYF+G IP
Sbjct  145  TELQVLDAYNNNFTGTLPLEIVNLKNLKHLQLGGNYFTGNIP  186


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/92 (40%), Positives = 52/92 (57%), Gaps = 0/92 (0%)
 Frame = +1

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
             L  L  ++I+ N LSG +P  IS  S+L F +LS N      P  + +L  L +L+L +
Sbjct  422  DLESLSKINISDNNLSGEIPASISQCSSLAFADLSRNNLIGEIPRGIYKLRVLSILNLSS  481

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            N  TG++P E+  MTSL  L L  N F G+IP
Sbjct  482  NQFTGEIPNEIRNMTSLTTLDLSDNNFIGKIP  513


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N L+G +P   S +  +  +NL  NN++G   P  +  
Sbjct  278  LSGGIPPELSGLVSLMSLDLSINDLTGEIPQSFSELKNITLINLYKNNLYGP-IPRFVGD  336

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  337  FPHLEVLQVWENNFTFELPENLGRNGRLKDLDITGNHITGLIP  379


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++  L  L +L +  N+LSG +PPE+S + +L  L+LS N      P   ++
Sbjct  253  NLSGTIPTNLSLLKNLNSLFLQVNRLSGGIPPELSGLVSLMSLDLSINDLTGEIPQSFSE  312

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ +++LY NNL G +P  V     L  L +  N F+  +P
Sbjct  313  LKNITLINLYKNNLYGPIPRFVGDFPHLEVLQVWENNFTFELP  355


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 41/79 (52%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   + Q   L    ++ N L G +P  I  +  L  LNLS+N F    P+++  
Sbjct  435  NLSGEIPASISQCSSLAFADLSRNNLIGEIPRGIYKLRVLSILNLSSNQFTGEIPNEIRN  494

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L  LDL +NN  G +P
Sbjct  495  MTSLTTLDLSDNNFIGKIP  513



>ref|XP_007225356.1| hypothetical protein PRUPE_ppa000916mg [Prunus persica]
 gb|EMJ26555.1| hypothetical protein PRUPE_ppa000916mg [Prunus persica]
Length=963

 Score =   117 bits (292),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 102/162 (63%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTSHCT----WRRVTCdsllhvvsldlsglNL  282
            G ++  ALL +K+A      S L  WN S+   +    +  V+CD    VV+L++S   L
Sbjct  11   GYSDLHALLKLKSAMIGPKGSGLEDWNTSSLSPSSHCSFSGVSCDRDFRVVALNVSNQPL  70

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G L P++G L  LVNL+IA + ++G +P +++ ++ LR LN+SNN+F   FP  +  Q+
Sbjct  71   LGTLPPEIGLLNKLVNLTIAGDNITGRLPMQMANLTALRHLNISNNVFRGRFPGNITLQM  130

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQVLD YNNN TG LP+E+  + +L+HL LGGNYF+G IP
Sbjct  131  TELQVLDAYNNNFTGTLPLEIVNLKNLKHLQLGGNYFTGNIP  172


 Score = 72.8 bits (177),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G L  L  LS+  N+ SG +P EI  + +L  +N+S N   S  P  ++Q 
Sbjct  455  ISGKIPPAIGNLKSLQTLSLEMNRFSGEIPTEIFDLKSLSKINISANNLSSEIPASISQC  514

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L + DL  NNL G++P ++YK+  L  L+L  N  +G IP
Sbjct  515  SSLALADLSRNNLIGEIPRDIYKLRVLSILNLSSNQLTGEIP  556


 Score = 66.6 bits (161),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L  L  ++I+AN LS  +P  IS  S+L   +LS N      P  + +L
Sbjct  479  FSGEIPTEIFDLKSLSKINISANNLSSEIPASISQCSSLALADLSRNNLIGEIPRDIYKL  538

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L +N LTG++P E+  MTSL  L L  N F G+IP
Sbjct  539  RVLSILNLSSNQLTGEIPNEIRNMTSLTTLDLSDNNFIGKIP  580


 Score = 58.9 bits (141),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 59/103 (57%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNL-SNNIFGSTFPHQLAQ  456
            LSG + P++  L  L++L ++ N L+G +P   S +  +  +NL  NN++G   P  +  
Sbjct  264  LSGGIPPELSGLVSLMSLDLSINDLTGEIPQSFSELKNITLINLYKNNLYGP-IPRFVGD  322

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L+VL ++ NN T +LP  + +   L+ L + GN+ +G IP
Sbjct  323  FPHLEVLQVWENNFTFELPENLGRNGRLKDLDITGNHITGLIP  365


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++  L  L +L +  N+LSG +PPE+S + +L  L+LS N      P   ++
Sbjct  239  NLSGTIPTNLSLLKNLNSLFLQVNRLSGGIPPELSGLVSLMSLDLSINDLTGEIPQSFSE  298

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ +++LY NNL G +P  V     L  L +  N F+  +P
Sbjct  299  LKNITLINLYKNNLYGPIPRFVGDFPHLEVLQVWENNFTFELP  341


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/103 (26%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L +L I  N ++G +P ++     L+   L +N F    P +L +
Sbjct  335  NFTFELPENLGRNGRLKDLDITGNHITGLIPRDLCKGGQLKTAILMDNHFFGPIPEELGR  394

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N LTG +P  ++ + ++  + L  NY SG++P
Sbjct  395  CKSLVKIRMMKNTLTGTIPAGIFSLPNVSMIELNDNYLSGQLP  437



>ref|XP_009399076.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM1 [Musa acuminata subsp. malaccensis]
Length=1021

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 91/155 (59%), Positives = 115/155 (74%), Gaps = 1/155 (1%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglNLSGVLSPD  303
            E  ALLS+K+  + +  ++L +W  +T HC+W  VTC S   VV+LDLSG NLSG L P 
Sbjct  28   EHRALLSLKSELS-NPGAALAAWEAATDHCSWPGVTCGSSGAVVALDLSGRNLSGPLPPA  86

Query  304  VGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDL  483
            VG+L  L+ LS+AAN LSGP+PPE++ +  LR LNLSNN+   +FP  LA+LA+L++LDL
Sbjct  87   VGRLRSLLRLSVAANFLSGPIPPELALLPDLRHLNLSNNLLNGSFPVALARLADLRLLDL  146

Query  484  YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            YNNNLTG LP EV  MT LRHLHLGGN+FSG IPP
Sbjct  147  YNNNLTGPLPQEVAAMTLLRHLHLGGNFFSGSIPP  181


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G+L  L ++ ++ N L+G +PP  S +S L  LNL  N    T P  +  L
Sbjct  272  LSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIPEFVGDL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L+VL ++ NN TG +P  +     L+ L L  N  +G +PP
Sbjct  332  PELEVLQMWENNFTGSIPRRLGTNGQLQLLDLSSNKLTGSLPP  374


 Score = 64.7 bits (156),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++G L  L  L +  N LSG +PPE+  + +L+ ++LSNN      P   + L
Sbjct  248  LSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRSLKSMDLSNNALTGQIPPSFSGL  307

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +NL +L+L+ N L G +P  V  +  L  L +  N F+G IP
Sbjct  308  SNLTLLNLFRNKLFGTIPEFVGDLPELEVLQMWENNFTGSIP  349


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + SG + P+V +L  L  L  + N+ SGP+ PEIS    L F++LS N      P  +A 
Sbjct  489  SFSGSIPPEVRRLQQLSKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVPSDIAA  548

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  L+L  N+L G +P  +  M SL  +    N  SG +P
Sbjct  549  LRILNYLNLSRNHLEGQIPSAISTMQSLTAVDFSYNNLSGLVP  591


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 49/99 (49%), Gaps = 3/99 (3%)
 Frame = +1

Query  298  PDVGQL---PFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            PD G     P L  + ++ N+L GP+PP I   S L+ L LS N F  + P ++ +L  L
Sbjct  445  PDTGDSSISPSLGQICLSNNRLVGPLPPSIGNFSGLQKLLLSQNSFSGSIPPEVRRLQQL  504

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LD   N  +G +  E+ K   L  + L  N  SG +P
Sbjct  505  SKLDFSGNRFSGPITPEISKCKLLTFVDLSRNEISGNVP  543


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P++G L  L+ L  A   LSG +P E+  +  L  L L  N      P +L +L +
Sbjct  226  GGVPPEIGNLSALLRLDAANCGLSGGIPSEMGNLRNLDTLFLQVNGLSGEIPPELGRLRS  285

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ +DL NN LTG +P     +++L  L+L  N   G IP
Sbjct  286  LKSMDLSNNALTGQIPPSFSGLSNLTLLNLFRNKLFGTIP  325



>gb|KDP36903.1| hypothetical protein JCGZ_08194 [Jatropha curcas]
Length=977

 Score =   117 bits (292),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 66/162 (41%), Positives = 99/162 (61%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCds-llhvvsldlsglNL  282
            G ++   LL +K++    +   L  W  S S   HC++  VTCD  L  V     S   L
Sbjct  19   GYSDMEVLLKMKSSMIGPNGRGLDDWTPSPSPSAHCSFTGVTCDEGLRVVSLSLSSHYGL  78

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL+I +  L+G +P E++ ++++R  N+SNN+F   FP ++   +
Sbjct  79   FGFIPPEIGFLNKLVNLTITSLNLTGRLPLELAKLTSIRIFNISNNVFVGNFPGEIILGM  138

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            A L+VLD+YNNN +G LP E+  + +L+HLHLGGNYFSG IP
Sbjct  139  AQLEVLDIYNNNFSGSLPAELRHLRNLKHLHLGGNYFSGPIP  180


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  ++  L FL  ++++AN LSG +PP IS  ++L  ++ S N      P  +A L
Sbjct  487  FSGEIPSEIFNLKFLTTINLSANNLSGEIPPSISHCNSLTSVDFSRNSLHGEIPKGIANL  546

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +L++  N LTG +P ++  MTSL  L L  N   GRIP
Sbjct  547  KDLSILNISQNQLTGQIPGDIRYMTSLTTLDLTHNNLLGRIP  588


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 60/103 (58%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P +GQL  L +L +  N LSG +PPE+S + +L+ L+LS N      P   ++
Sbjct  247  NLTGEIPPTLGQLKSLDSLFLQMNNLSGHIPPELSGLISLKSLDLSINNLTGEIPDSFSE  306

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+ ++ L+ NN+ G +P  +    +L  LH+  N F+  +P
Sbjct  307  LKNITLIHLFKNNMYGQIPEFIGDFPNLEVLHVWVNNFTLELP  349


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 42/129 (33%), Positives = 59/129 (46%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L  ++  L  L +L +  N  SGP+P   S I +L +L L+ N      P  LA+
Sbjct  150  NFSGSLPAELRHLRNLKHLHLGGNYFSGPIPESYSEIQSLEYLGLNGNGLSGKVPPSLAK  209

Query  457  LANL-------------------------QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL                         +VLD+ + NLTG++P  + ++ SL  L L  
Sbjct  210  LKNLKRLYLGYYSSYEGGIPPEFGSLSSLEVLDMASCNLTGEIPPTLGQLKSLDSLFLQM  269

Query  562  NYFSGRIPP  588
            N  SG IPP
Sbjct  270  NNLSGHIPP  278


 Score = 58.5 bits (140),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L  L ++ N L+G +PP++     L+ L L NN F    P QL Q
Sbjct  343  NFTLELPKNLGRNGKLKMLDVSFNHLTGAIPPDLCKEEKLKELILMNNFFIGPLPEQLGQ  402

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + + NN L+G LP  ++ +  +  + L  NYFS  +P
Sbjct  403  CKSLTKIRIMNNLLSGSLPAGIFNLPLVTVVELNDNYFSEELP  445


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L +A+  L+G +PP +  + +L  L L  N      P +L+ L +
Sbjct  226  GGIPPEFGSLSSLEVLDMASCNLTGEIPPTLGQLKSLDSLFLQMNNLSGHIPPELSGLIS  285

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL  NNLTG++P    ++ ++  +HL  N   G+IP
Sbjct  286  LKSLDLSINNLTGEIPDSFSELKNITLIHLFKNNMYGQIP  325



>ref|XP_011035024.1| PREDICTED: receptor protein kinase CLAVATA1-like [Populus euphratica]
Length=779

 Score =   116 bits (290),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 99/162 (61%), Gaps = 5/162 (3%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNIS----TSHCTWRRVTCdsllhvvsldlsglNL  282
            G +E   LL +K++    + + L  W  S    ++HC +  VTCD    VVSL+LS  +L
Sbjct  21   GYSELEVLLKLKSSMYGHNGTGLEDWVASPISPSAHCFFSGVTCDESSRVVSLNLSFRHL  80

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLA-QL  459
             G + P++G L  LVNL++A + LSG +P EI+ +  LR LN+S N  G  F  +    +
Sbjct  81   PGSIPPEIGLLNKLVNLTLANDNLSGELPAEIAMLKFLRILNISGNAIGGNFSGKTTLGM  140

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VLD+YNNN  G LP+E+  +  L+HLHLGGN+FSG IP
Sbjct  141  TELEVLDIYNNNCWGPLPIEIANLKKLKHLHLGGNFFSGNIP  182


 Score = 69.7 bits (169),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +  ++  L  L  +SI AN +SG +P  +   ++L  ++ S N      P ++ +L
Sbjct  489  LSGEIPDEIFSLEILSKISIRANNISGEIPASMFHCTSLASVDFSQNSISGEIPKEITKL  548

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L +LDL  N LTG LP E+  MTSL  L+L  N   GRIP
Sbjct  549  KDLSILDLSRNQLTGQLPSEIRYMTSLSTLNLSYNNLFGRIP  590


 Score = 57.4 bits (137),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +  ++  L  L +L ++ N L+G +P   SA+  L  +NL  N      P  +  
Sbjct  273  NLTGYIPSELSGLISLKSLDLSINNLTGEIPESFSALKNLTLINLFQNKLHGPIPDFVGD  332

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              NL+VL ++ NN T +LP ++ +   L +L +  N+ +G +P
Sbjct  333  FPNLEVLQVWGNNFTFELPKQLGRNGKLMYLDVSYNHLTGLVP  375


 Score = 56.2 bits (134),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +1

Query  322  LVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLT  501
            L +LS++ N+++G +PP I  + +L+FL+L  N      P ++  L  L  + +  NN++
Sbjct  455  LGSLSVSDNRITGRIPPAIGNLKSLQFLSLEMNRLSGEIPDEIFSLEILSKISIRANNIS  514

Query  502  GDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            G++P  ++  TSL  +    N  SG IP
Sbjct  515  GEIPASMFHCTSLASVDFSQNSISGEIP  542


 Score = 53.1 bits (126),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 51/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +      L  L  +++  N+L GP+P  +     L  L +  N F    P QL +
Sbjct  297  NLTGEIPESFSALKNLTLINLFQNKLHGPIPDFVGDFPNLEVLQVWGNNFTFELPKQLGR  356

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  LD+  N+LTG +P ++ K   L+ L L  N+F G +P
Sbjct  357  NGKLMYLDVSYNHLTGLVPRDLCKGAKLKTLILMNNFFIGSLP  399


 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
             SG +  D  ++  L  L +  N LSG VP  +S +  L+ L +   N +    P +   
Sbjct  177  FSGNIPEDYSEIMSLEFLGLNGNVLSGKVPSSLSKLKNLKSLCIGYYNHYEGGIPPEFGS  236

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+NL++LD+ + NL G++P  + ++T L  L L  N  +G IP
Sbjct  237  LSNLELLDMSSCNLNGEIPSTLGQLTHLHSLFLQFNNLTGYIP  279



>ref|XP_004499483.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3-like [Cicer arietinum]
Length=987

 Score =   116 bits (291),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 79/166 (48%), Positives = 108/166 (65%), Gaps = 7/166 (4%)
 Frame = +1

Query  109  PLGVTEQAALL-SIKAAFTADSQSSLTSWNIST--SHCT-WRRVTCd-sllhvvsldlsg  273
            PL +  QA++L S+K  F A S SSL++WNIS   S CT W  + CD + + V+SLD+S 
Sbjct  24   PLSLKNQASILVSMKQDFEA-SNSSLSTWNISNYMSLCTNWYGIQCDHNKIFVMSLDISN  82

Query  274  lNLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIF-GSTFPHQL  450
            LN+SG LSP + +L  LVN+SI  N   G  P  I  +  L+FLN+SNN+F G+    + 
Sbjct  83   LNISGSLSPLITKLTTLVNVSIQGNSFCGEFPINIHNLQNLKFLNISNNMFSGNLSSMEF  142

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +L  L+VLD+YNN   G LP  V ++ +L+HL+ GGNYF GRIPP
Sbjct  143  NKLKELEVLDVYNNAFNGSLPHGVTQLLNLKHLNFGGNYFYGRIPP  188


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (54%), Gaps = 1/102 (1%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQLA  462
            G + P  G++  L  LS+A N LSG +P E+  ++ L +L L   N F    PH+  +L 
Sbjct  184  GRIPPSYGKMKNLKFLSLAGNDLSGFLPSELGNLTNLEYLYLGYYNQFEGGIPHEFGKLE  243

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            NL  LDL N  L G +P E+ K+  L  L L  N  +G IPP
Sbjct  244  NLVHLDLANCLLKGSIPNELGKLYKLDTLFLQTNQLTGFIPP  285


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +  ++G+L  L  L +  NQL+G +PPE+  +S L  L+LS N      P++ + L
Sbjct  255  LKGSIPNELGKLYKLDTLFLQTNQLTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNL  314

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +L+L+ N L G++P  V +  +L  L L  N F+G IPP
Sbjct  315  HQLSLLNLFINRLHGEIPEFVSEFPNLEVLKLWRNNFTGVIPP  357


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L  L ++ N L+G +P E S +  L  LNL  N      P  +++ 
Sbjct  279  LTGFIPPELGNLSRLNALDLSLNNLTGGIPNEFSNLHQLSLLNLFINRLHGEIPEFVSEF  338

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL L+ NN TG +P ++ +   +  L L  N  +G +P
Sbjct  339  PNLEVLKLWRNNFTGVIPPKLGRNGKITELDLSTNKLTGLVP  380


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +GV+ P +G+   +  L ++ N+L+G VP  +   + L+ L L NN      P++L Q
Sbjct  350  NFTGVIPPKLGRNGKITELDLSTNKLTGLVPKSLCFGNRLKILILLNNFLFGNLPYELGQ  409

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               LQ + +  N LTG +P     + +L  L L  NY SG IP
Sbjct  410  CYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIP  452


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG L   +G  P L  L +  N+ SG +P +I  +  +  L+ ++N F  T P+++ + 
Sbjct  475  FSGSLPNSIGNFPNLQILQLYGNRFSGEIPSDIGRLKNILKLDFNSNNFSGTIPNEIGKC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N  +G +P++V ++  L H ++  N+ +  IP
Sbjct  535  NLLTYLDLSQNQFSGPIPIQVSQIHILNHFNVSWNHLNQTIP  576


 Score = 57.8 bits (138),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 36/103 (35%), Positives = 49/103 (48%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G L   V QL  L +L+   N   G +PP    +  L+FL+L+ N      P +L  L
Sbjct  158  FNGSLPHGVTQLLNLKHLNFGGNYFYGRIPPSYGKMKNLKFLSLAGNDLSGFLPSELGNL  217

Query  460  ANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+ L L Y N   G +P E  K+ +L HL L      G IP
Sbjct  218  TNLEYLYLGYYNQFEGGIPHEFGKLENLVHLDLANCLLKGSIP  260


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 28/79 (35%), Positives = 42/79 (53%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG +  ++G+   L  L ++ NQ SGP+P ++S I  L   N+S N    T P +L  
Sbjct  522  NFSGTIPNEIGKCNLLTYLDLSQNQFSGPIPIQVSQIHILNHFNVSWNHLNQTIPKELGN  581

Query  457  LANLQVLDLYNNNLTGDLP  513
            L  L   D  +NN +G +P
Sbjct  582  LKGLTSADFSHNNFSGSIP  600


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 36/106 (34%), Positives = 52/106 (49%), Gaps = 4/106 (4%)
 Frame = +1

Query  280  LSGVLSPDVGQ----LPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ  447
            LSG++    GQ       L   +++ N+ SG +P  I     L+ L L  N F    P  
Sbjct  447  LSGLIPQQKGQKENTTSKLEQCNLSNNRFSGSLPNSIGNFPNLQILQLYGNRFSGEIPSD  506

Query  448  LAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L N+  LD  +NN +G +P E+ K   L +L L  N FSG IP
Sbjct  507  IGRLKNILKLDFNSNNFSGTIPNEIGKCNLLTYLDLSQNQFSGPIP  552


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 38/130 (29%), Positives = 58/130 (45%), Gaps = 28/130 (22%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVP------PEISAI------------------  387
            L G L  ++GQ   L  + I  N L+G +P      P +S +                  
Sbjct  399  LFGNLPYELGQCYTLQRVRIGQNYLTGSIPHGFLYLPNLSLLELQNNYLSGLIPQQKGQK  458

Query  388  ----STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHL  555
                S L   NLSNN F  + P+ +    NLQ+L LY N  +G++P ++ ++ ++  L  
Sbjct  459  ENTTSKLEQCNLSNNRFSGSLPNSIGNFPNLQILQLYGNRFSGEIPSDIGRLKNILKLDF  518

Query  556  GGNYFSGRIP  585
              N FSG IP
Sbjct  519  NSNNFSGTIP  528


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +   V + P L  L +  N  +G +PP++     +  L+LS N      P  L   
Sbjct  327  LHGEIPEFVSEFPNLEVLKLWRNNFTGVIPPKLGRNGKITELDLSTNKLTGLVPKSLCFG  386

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L++L L NN L G+LP E+ +  +L+ + +G NY +G IP
Sbjct  387  NRLKILILLNNFLFGNLPYELGQCYTLQRVRIGQNYLTGSIP  428


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 49/102 (48%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G +  + G+L  LV+L +A   L G +P E+  +  L  L L  N      P +L  L
Sbjct  231  FEGGIPHEFGKLENLVHLDLANCLLKGSIPNELGKLYKLDTLFLQTNQLTGFIPPELGNL  290

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + L  LDL  NNLTG +P E   +  L  L+L  N   G IP
Sbjct  291  SRLNALDLSLNNLTGGIPNEFSNLHQLSLLNLFINRLHGEIP  332



>emb|CDX73202.1| BnaC06g36500D [Brassica napus]
Length=987

 Score =   116 bits (291),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 69/160 (43%), Positives = 103/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  STS   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVHSTSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLD YNNN TG LP E+  +  LRHL LGGN+ +G IP
Sbjct  153  LEVLDAYNNNFTGPLPPEIPGLKKLRHLSLGGNFLTGEIP  192


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  L+L  N LTG +P+ + KMTSL  L L  N  SGR+P
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTSLTTLDLSFNDLSGRVP  600


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ NQL+G +P    ++  +  +NL  N      P  +  
Sbjct  283  NLTGNIPPELSGLISLKSLDLSINQLTGEIPQSFISLWNITLINLFRNNLHGPIPEFIGD  342

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + NLQVL ++ NN T +LP  + +  +L+ L +  N+ +G IP
Sbjct  343  MPNLQVLQVWENNFTLELPANLGRNGNLKKLDVSDNHLTGLIP  385


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G++ P +G    L +L +  N+ SG +P E+  +  L  +N S N      P  +++ 
Sbjct  475  FTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHLTKINTSANNLTGDIPDSISRC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +DL  N + GD+P +++ + +L  L+L GN  +G IP
Sbjct  535  TSLISVDLSRNRIGGDIPKDIHDVINLGTLNLSGNQLTGSIP  576


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G VPPE   ++ L  L++++       P  L+ L +L  L L+ NNLTG++P E+ 
Sbjct  234  NSYTGGVPPEFGELTNLEVLDMASCTLTGEIPTTLSNLKHLHTLFLHINNLTGNIPPELS  293

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  N  +G IP
Sbjct  294  GLISLKSLDLSINQLTGEIP  313


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (51%), Gaps = 6/99 (6%)
 Frame = +1

Query  307  GQLP------FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            G+LP       L ++ ++ N  +G +PP I     L+ L L  N F    P ++ +L +L
Sbjct  454  GELPGEMSGDLLDHIYLSNNWFTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHL  513

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              ++   NNLTGD+P  + + TSL  + L  N   G IP
Sbjct  514  TKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIP  552



>ref|XP_002304615.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE79594.1| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   116 bits (290),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 66/158 (42%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S++ +F +    S  SWN+S     C+W  + CD     V        N+SG L
Sbjct  36   QASILVSVRQSFES-YDPSFDSWNVSNYPLLCSWTGIQCDDKNRSVVAIDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLS+  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSLQGNSFSDGFPREIHRLIRLQFLNISNNLFSGQLDWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD YNNNL G LP+ V ++  L+HL  GGNYF G IPP
Sbjct  155  LDGYNNNLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPP  192


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 61/102 (60%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G++ P++G L  L  L +  N+L+GP+PPE+  +S+++ L+LSNN      P + + L
Sbjct  259  LRGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNLSSIKSLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  319  HRLTLLNLFLNKLHGQIPHFIAELPELEVLKLWHNNFTGVIP  360


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LS  +    G++P  L  +++A N LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSEQVPQQTGKIPSKLEQMNLADNHLSGPLPASIGNFSDLQMLLLSGNRFTGEIPPQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP
Sbjct  511  LKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIP  553


 Score = 65.1 bits (157),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 36/102 (35%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  + +L ++ N L+G +P E S +  L  LNL  N      PH +A+L
Sbjct  283  LTGPIPPELGNLSSIKSLDLSNNALTGDIPLEFSGLHRLTLLNLFLNKLHGQIPHFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGVIPAKLGENGRLIELDLSSNKLTGLVP  384


 Score = 63.5 bits (153),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV+L +A   L G +PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHLDLANCSLRGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++++ LDL NN LTGD+P+E   +  L  L+L  N   G+IP
Sbjct  295  SSIKSLDLSNNALTGDIPLEFSGLHRLTLLNLFLNKLHGQIP  336


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +GQL  ++ L ++ N LSG +P EI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSIP  601


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 50/105 (48%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L   V QL  L +L    N   G +PP   ++  L +L+L  N      P +L  
Sbjct  161  NLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLIPRELGN  220

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+ L L Y N   G +P E  K+ +L HL L      G IPP
Sbjct  221  LTNLEQLYLGYYNEFDGGIPPEFGKLINLVHLDLANCSLRGLIPP  265


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 46/79 (58%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++G  P L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q  ++
Sbjct  403  LFGPLPDDLGHCDSLRRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKI  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + L+ ++L +N+L+G LP  +   + L+ L L GN F+G IPP
Sbjct  463  PSKLEQMNLADNHLSGPLPASIGNFSDLQMLLLSGNRFTGEIPP  506


 Score = 55.1 bits (131),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L   +G    L  L ++ N+ +G +PP+I  +  +  L++S N      P ++  
Sbjct  475  HLSGPLPASIGNFSDLQMLLLSGNRFTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEIGD  534

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  LDL  N L+G +PV + ++  L +L++  N+ +  +P
Sbjct  535  CPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLP  577


 Score = 52.0 bits (123),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 50/104 (48%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  ++ L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPRELGNLTNLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL N +L G +P E+  +  L  L L  N  +G IPP
Sbjct  246  LINLVHLDLANCSLRGLIPPELGNLNKLDTLFLQTNELTGPIPP  289



>ref|XP_010246813.1| PREDICTED: receptor protein kinase CLAVATA1-like [Nelumbo nucifera]
Length=994

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 72/163 (44%), Positives = 102/163 (63%), Gaps = 4/163 (2%)
 Frame = +1

Query  109  PLGVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglN  279
            P   T+   L+ IK A      S L  W +S+S   HC +  V+CD    VVSL++S + 
Sbjct  32   PTSSTDLIVLMKIKTAMIGPKGSGLDDWIVSSSRASHCLFSGVSCDENSRVVSLNVSFVP  91

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL-AQ  456
            L G ++P++G L  LVNL+++ N L+G  P EI+ +++L+ LNLSNNI     P  +   
Sbjct  92   LFGTIAPEIGLLNNLVNLTLSCNNLTGKFPAEIANLTSLKLLNLSNNIMYGHVPESIFGG  151

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+V D+YNNN +G LP+E+ K+  L+HLHLGGNYFSG IP
Sbjct  152  LLELEVFDIYNNNFSGPLPIELVKLKRLKHLHLGGNYFSGEIP  194


 Score = 62.0 bits (149),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/103 (36%), Positives = 57/103 (55%), Gaps = 2/103 (2%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
             SG + P +  L  L  ++I+ N ++G +P  I+   +L  ++ S NN+FG   P  +A+
Sbjct  501  FSGEIPPQIFDLKKLSKMNISNNNITGKIPTTIAHCKSLTLVDFSSNNLFGE-IPRAIAK  559

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L  L+L  N L G +P+E+  MTSL  L L  N  SG +P
Sbjct  560  LEILSTLNLSRNQLEGQIPIEIRSMTSLTILDLSYNNLSGPVP  602


 Score = 61.2 bits (147),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +G+L  L  L +  N+LSG +P E+S + +L+ L+LSNN      P   ++
Sbjct  261  NLTGEIPASLGRLKLLHTLFLQLNRLSGLIPAELSGLVSLKSLDLSNNELTGEIPKGFSE  320

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L +L+L+ N+L G +P  +  +  L  L L  N F+  +P
Sbjct  321  LKQLTLLNLFRNHLHGRIPSFIADLPYLEVLQLWENNFTFELP  363


 Score = 61.2 bits (147),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            ++G +   +  L  L  LS+  NQ SG +PP+I  +  L  +N+SNN      P  +A  
Sbjct  477  ITGNVPAAIANLTNLQTLSLELNQFSGEIPPQIFDLKKLSKMNISNNNITGKIPTTIAHC  536

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L ++D  +NNL G++P  + K+  L  L+L  N   G+IP
Sbjct  537  KSLTLVDFSSNNLFGEIPRAIAKLEILSTLNLSRNQLEGQIP  578


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 52/102 (51%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P    LP +  L  + N  +G +P EIS    L  L LSNN      P  +A L
Sbjct  430  FNGTIPPGFFNLPLVDMLEFSDNYFTGKLPDEISG-GILGLLTLSNNRITGNVPAAIANL  488

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NLQ L L  N  +G++P +++ +  L  +++  N  +G+IP
Sbjct  489  TNLQTLSLELNQFSGEIPPQIFDLKKLSKMNISNNNITGKIP  530


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG++  ++  L  L +L ++ N+L+G +P   S +  L  LNL  N      P  +A L
Sbjct  286  LSGLIPAELSGLVSLKSLDLSNNELTGEIPKGFSELKQLTLLNLFRNHLHGRIPSFIADL  345

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L+ NN T +LPV +     L  L +  N+ +G IP
Sbjct  346  PYLEVLQLWENNFTFELPVNLGSNGKLTKLDVATNHLTGMIP  387


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 52/100 (52%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G + P+ G L  L  L + +  L+G +P  +  +  L  L L  N      P +L+ L +
Sbjct  240  GGIPPEFGSLSSLRMLDMGSCNLTGEIPASLGRLKLLHTLFLQLNRLSGLIPAELSGLVS  299

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+ LDL NN LTG++P    ++  L  L+L  N+  GRIP
Sbjct  300  LKSLDLSNNELTGEIPKGFSELKQLTLLNLFRNHLHGRIP  339


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 27/85 (32%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L+++ N+++G VP  I+ ++ L+ L+L  N F    P Q+  L  L  +++ NNN+TG +
Sbjct  470  LTLSNNRITGNVPAAIANLTNLQTLSLELNQFSGEIPPQIFDLKKLSKMNISNNNITGKI  529

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P  +    SL  +    N   G IP
Sbjct  530  PTTIAHCKSLTLVDFSSNNLFGEIP  554



>ref|XP_010416487.1| PREDICTED: receptor protein kinase CLAVATA1-like [Camelina sativa]
Length=992

 Score =   116 bits (290),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 66/160 (41%), Positives = 106/160 (66%), Gaps = 5/160 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  + S   HC++  V+CD    V+SL++S   L G 
Sbjct  38   TDMDVLLTLKSSMIGPNGDGLHDWIHTPSPAAHCSFTGVSCDGESRVISLNVSFTPLFGK  97

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    +FP + L  + +
Sbjct  98   ISPEIGMLNRLVNLTLAANNFSGELPLEMKSLTSLKVLNISNNVNLNGSFPGEILKAMLD  157

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLD YNNN TG LP+E+ ++ +L+HL LGGN+F+G IP
Sbjct  158  LEVLDAYNNNFTGTLPLEISELKNLKHLSLGGNFFTGEIP  197


 Score = 60.8 bits (146),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/100 (35%), Positives = 55/100 (55%), Gaps = 0/100 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +  ++ +L  L  ++ +AN ++G +P  IS  +TL  ++LS N      P ++  + N
Sbjct  506  GSIPREIFELKHLSKINTSANNITGVIPDSISRCTTLISVDLSRNRINGDIPKEINNVIN  565

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L+L  N LTG +P  +  MTSL  L L  N  SGR+P
Sbjct  566  LGTLNLSGNQLTGSIPTGIGNMTSLTTLDLSFNDLSGRVP  605


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/102 (32%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG + P +G  P L  L +  N+  G +P EI  +  L  +N S N      P  +++ 
Sbjct  480  FSGEIPPAIGNFPILQTLFLDRNRFRGSIPREIFELKHLSKINTSANNITGVIPDSISRC  539

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  +DL  N + GD+P E+  + +L  L+L GN  +G IP
Sbjct  540  TTLISVDLSRNRINGDIPKEINNVINLGTLNLSGNQLTGSIP  581


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 55/103 (53%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ NQL+G +P     +  +  +NL  N      P  + +
Sbjct  288  NLTGHIPPELSGLISLKSLDLSINQLTGEIPQSFIDLGNITLINLFRNKLYGPIPEFIGE  347

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  LQV +++ NN T  LP  + +  +L+ L +  N+ +G IP
Sbjct  348  LPKLQVFEVWENNFTLQLPSNLGRNGNLKKLDVSYNHLTGLIP  390


 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 33/95 (35%), Positives = 51/95 (54%), Gaps = 3/95 (3%)
 Frame = +1

Query  301  DVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLD  480
            D+G +  L+NL    N+L GP+P  I  +  L+   +  N F    P  L +  NL+ LD
Sbjct  323  DLGNIT-LINL--FRNKLYGPIPEFIGELPKLQVFEVWENNFTLQLPSNLGRNGNLKKLD  379

Query  481  LYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +  N+LTG +P+++ +   L  L L  N+F G IP
Sbjct  380  VSYNHLTGLIPMDLCRGEKLEMLILSNNFFFGPIP  414


 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L ++ N   GP+P E+    +L  + +  N+   T P  L  
Sbjct  384  HLTGLIPMDLCRGEKLEMLILSNNFFFGPIPEELGKCKSLNKIRIIKNLLNGTVPAGLFN  443

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  + +++L +N  +G+LP  +    +   ++L  N+FSG IPP
Sbjct  444  LPLVTIIELTDNFFSGELPTTMSGAVA-DQIYLSNNWFSGEIPP  486


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 34/129 (26%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-------------  417
            N +G L  ++ +L  L +LS+  N  +G +P     I +L +L L+              
Sbjct  167  NFTGTLPLEISELKNLKHLSLGGNFFTGEIPESYGDIQSLEYLGLNGAGLSGKSPAFLSR  226

Query  418  ------------NIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
                        N +    P +   L NLQ+LD+ +  LTG++P  +  +  L  L L  
Sbjct  227  LKNLREMYVGYFNSYTGGVPPEFGGLTNLQILDMASCTLTGEIPTSLSNLKHLHTLFLHI  286

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  287  NNLTGHIPP  295


 Score = 50.4 bits (119),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 52/103 (50%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L  L ++ N L+G +P ++     L  L LSNN F    P +L +
Sbjct  360  NFTLQLPSNLGRNGNLKKLDVSYNHLTGLIPMDLCRGEKLEMLILSNNFFFGPIPEELGK  419

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N L G +P  ++ +  +  + L  N+FSG +P
Sbjct  420  CKSLNKIRIIKNLLNGTVPAGLFNLPLVTIIELTDNFFSGELP  462



>emb|CDX87661.1| BnaA07g32120D [Brassica napus]
Length=965

 Score =   115 bits (289),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 105/163 (64%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    + + L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLTLKSSMVGPNGNGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  456
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L+VLD YNNN TG LP E+  +  LRHL LGGN+ +G IP
Sbjct  150  MVDLEVLDAYNNNFTGPLPPEIPGLKKLRHLSLGGNFLTGEIP  192


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  477  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  536

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  L+L  N LTG +P+ + KMTSL  L L  N  SGR+P
Sbjct  537  MNLGTLNLSGNQLTGSIPIGIGKMTSLTTLDLSFNDLSGRVP  578


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 35/105 (33%), Positives = 59/105 (56%), Gaps = 2/105 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ NQL+G +P    ++  +  +NL  N      P  +  
Sbjct  283  NLTGNIPPELSGLISLKSLDLSINQLTGEIPQSFISLGNITLINLFRNNLHGPIPDFIGD  342

Query  457  LANLQV--LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + NLQV  LD+ +N+LTG +P+++ +   L  L L  N+F G IP
Sbjct  343  MPNLQVLQLDVSDNHLTGLIPMDLCRGGKLETLVLSNNFFFGSIP  387


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 31/102 (30%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG++ P +G    L +L +  N+ SG +P E+  +  L  +N S N      P  +++ 
Sbjct  453  FSGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHLTKINTSANNLTGDIPDSISRC  512

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +DL  N + GD+P +++ + +L  L+L GN  +G IP
Sbjct  513  TSLISVDLSRNRIGGDIPKDIHDVMNLGTLNLSGNQLTGSIP  554


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G VPPE   +S L  L++++       P  L+ L +L  L L+ NNLTG++P E+ 
Sbjct  234  NSYTGGVPPEFGELSNLEVLDMASCTLTGEIPTTLSNLKHLHTLFLHINNLTGNIPPELS  293

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  N  +G IP
Sbjct  294  GLISLKSLDLSINQLTGEIP  313


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 2/105 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFL--VNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            NL G +   +G +P L  + L ++ N L+G +P ++     L  L LSNN F  + P +L
Sbjct  331  NLHGPIPDFIGDMPNLQVLQLDVSDNHLTGLIPMDLCRGGKLETLVLSNNFFFGSIPEKL  390

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             Q  +L  + +  N L G +P  ++ +  +  + L  N+FSG +P
Sbjct  391  GQCKSLNKIRIVKNLLNGTVPEGLFNLPLVTIIELTDNFFSGELP  435


 Score = 53.5 bits (127),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 35/102 (34%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +S DV     L ++ ++ N  SG +PP I     L+ L L  N F    P ++ +L
Sbjct  434  LPGEMSGDV-----LDHIYLSNNWFSGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFEL  488

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  ++   NNLTGD+P  + + TSL  + L  N   G IP
Sbjct  489  KHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIP  530



>ref|XP_008808621.1| PREDICTED: leucine-rich repeat receptor-like kinase protein FLORAL 
ORGAN NUMBER1 [Phoenix dactylifera]
Length=987

 Score =   115 bits (288),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 67/152 (44%), Positives = 94/152 (62%), Gaps = 1/152 (1%)
 Frame = +1

Query  133  ALLSIKAAFTADSQSSLTSWNISTS-HCTWRRVTCdsllhvvsldlsglNLSGVLSPDVG  309
            ALL +K      + + L  W+ S S HC++  +TCD+   VV+L++S +     L P+VG
Sbjct  29   ALLKLKHGLIGPAGNGLHDWDPSASTHCSFSGITCDADDRVVALNISNVRFHRALPPEVG  88

Query  310  QLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYN  489
            +L  LVNL+IA + ++G +P EI  +  LR LN+SNN F   FP        L+VLD YN
Sbjct  89   RLDRLVNLTIACDSIAGRLPAEIVGLPALRLLNISNNNFTGLFPDVDGGFPALEVLDAYN  148

Query  490  NNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            NN +G LP  + K+  LR+LHLGGN+FSG IP
Sbjct  149  NNFSGPLPRCLAKLPGLRYLHLGGNFFSGEIP  180


 Score = 67.4 bits (163),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLA  462
             G + P+ G L  LV L +A   LSGP+P  +  +  L  L L  N    T P +L  L 
Sbjct  225  EGGIPPEFGMLTSLVRLDMANCNLSGPIPASLGRLKLLDSLFLQWNRLAGTIPPELGGLD  284

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             LQ LDL  N LTG+LP     +  L+ L++  N+  GRIPP
Sbjct  285  RLQSLDLSINELTGELPESFAGLKQLKLLNIFRNHLRGRIPP  326


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/103 (37%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLS-NNIFGSTFPHQLAQ  456
            +SG + P +G L  L  LS+ +N ++G +PP+I  +  L  LNLS NN+ G   P     
Sbjct  463  ISGPIPPAIGNLRGLQTLSLESNWIAGEIPPQIGDLKQLSKLNLSGNNLIGEIPPDLARC  522

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L+ +DL  N LTG++P  + ++ +L  L+L  N+ SG IP
Sbjct  523  TGTLEAVDLSRNGLTGEIPAAITELQNLNTLNLSRNHLSGEIP  565


 Score = 63.9 bits (154),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  L +L ++ N+L+G +P   + +  L+ LN+  N      P  +A L
Sbjct  272  LAGTIPPELGGLDRLQSLDLSINELTGELPESFAGLKQLKLLNIFRNHLRGRIPPFIADL  331

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             NL+VL ++ NN T +LP  + +   L  L +  N  +G IPP
Sbjct  332  PNLEVLQVWENNFTFELPEGLGRNGRLMKLDVATNRLTGTIPP  374


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/103 (32%), Positives = 58/103 (56%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +   +G+L  L +L +  N+L+G +PPE+  +  L+ L+LS N      P   A 
Sbjct  247  NLSGPIPASLGRLKLLDSLFLQWNRLAGTIPPELGGLDRLQSLDLSINELTGELPESFAG  306

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L  L++L+++ N+L G +P  +  + +L  L +  N F+  +P
Sbjct  307  LKQLKLLNIFRNHLRGRIPPFIADLPNLEVLQVWENNFTFELP  349


 Score = 53.9 bits (128),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 30/86 (35%), Positives = 48/86 (56%), Gaps = 1/86 (1%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L ++ N +SGP+PP I  +  L+ L+L +N      P Q+  L  L  L+L  NNL G++
Sbjct  456  LILSNNWISGPIPPAIGNLRGLQTLSLESNWIAGEIPPQIGDLKQLSKLNLSGNNLIGEI  515

Query  511  PVEVYKMT-SLRHLHLGGNYFSGRIP  585
            P ++ + T +L  + L  N  +G IP
Sbjct  516  PPDLARCTGTLEAVDLSRNGLTGEIP  541


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 51/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  LP    L ++ N LSG +P  ++    L  L LSNN      P  +  L
Sbjct  416  LNGAIPAGLFDLPSADMLELSDNYLSGELPARMAG-DKLGMLILSNNWISGPIPPAIGNL  474

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              LQ L L +N + G++P ++  +  L  L+L GN   G IPP
Sbjct  475  RGLQTLSLESNWIAGEIPPQIGDLKQLSKLNLSGNNLIGEIPP  517


 Score = 50.1 bits (118),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 53/106 (50%), Gaps = 7/106 (7%)
 Frame = +1

Query  280  LSGVLSPDV---GQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQL  450
            L+G + PD+   G+L  LV   +  N   GP+P ++    +L  + L+ N      P  L
Sbjct  368  LTGTIPPDLCAGGRLELLV---LMENAFFGPIPEKLGDCKSLVRVRLAKNFLNGAIPAGL  424

Query  451  AQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
              L +  +L+L +N L+G+LP  +     L  L L  N+ SG IPP
Sbjct  425  FDLPSADMLELSDNYLSGELPARMAG-DKLGMLILSNNWISGPIPP  469


 Score = 49.3 bits (116),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 36/129 (28%), Positives = 55/129 (43%), Gaps = 25/129 (19%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG L   + +LP L  L +  N  SG +P    +I +L +L L+ +      P  L++
Sbjct  150  NFSGPLPRCLAKLPGLRYLHLGGNFFSGEIPESYGSIESLEYLGLNGDALSGRVPVSLSR  209

Query  457  LANLQV-------------------------LDLYNNNLTGDLPVEVYKMTSLRHLHLGG  561
            L NL+                          LD+ N NL+G +P  + ++  L  L L  
Sbjct  210  LTNLREMYIGYYSMYEGGIPPEFGMLTSLVRLDMANCNLSGPIPASLGRLKLLDSLFLQW  269

Query  562  NYFSGRIPP  588
            N  +G IPP
Sbjct  270  NRLAGTIPP  278



>ref|XP_009106236.1| PREDICTED: receptor protein kinase CLAVATA1 [Brassica rapa]
Length=987

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 69/163 (42%), Positives = 104/163 (64%), Gaps = 5/163 (3%)
 Frame = +1

Query  112  LGVTEQAALLSIKAAFTADSQSSLTSWNIS---TSHCTWRRVTCdsllhvvsldlsglNL  282
            L  T+   LL++K++    +   L  W  S   T+HC++  V+CD    V+SL++S   L
Sbjct  30   LASTDMDHLLNLKSSMVGPNGHGLHDWVHSPSPTAHCSFSGVSCDGDARVISLNVSFTPL  89

Query  283  SGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQ  456
             G +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  
Sbjct  90   FGTISPEIGMLNRLVNLTLAANNFSGTLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTP  149

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + +L+VLD YNNN TG LP E+  +  LRHL LGGN+ +G IP
Sbjct  150  MVDLEVLDAYNNNFTGPLPPEIPGLKKLRHLSLGGNFLTGEIP  192


 Score = 68.6 bits (166),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  L+L  N LTG +P+ + KMTSL  L L  N  SGR+P
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTSLTTLDLSFNDLSGRVP  600


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ NQL+G +P    ++  +  +NL  N      P  +  
Sbjct  283  NLTGNIPPELSGLISLKSLDLSINQLTGEIPQSFISLGNITLINLFRNNLHGPIPDFIGD  342

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + NLQVL ++ NN T +LP  + +  +L+ L +  N+ +G IP
Sbjct  343  MPNLQVLQVWENNFTLELPANLGRNGNLKKLDVSDNHLTGLIP  385


 Score = 57.0 bits (136),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G++ P +G    L +L +  N+ SG +P E+  +  L  +N S N      P  +++ 
Sbjct  475  FTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHLTKINTSANNLTGDIPDSISRC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +DL  N + GD+P +++ + +L  L+L GN  +G IP
Sbjct  535  TSLISVDLSRNRIGGDIPKDIHDVINLGTLNLSGNQLTGSIP  576


 Score = 54.7 bits (130),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G VPPE   ++ L  L++++       P  L+ L +L  L L+ NNLTG++P E+ 
Sbjct  234  NSYTGGVPPEFGELTNLEVLDMASCTLTGEIPTTLSNLKHLHTLFLHINNLTGNIPPELS  293

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  N  +G IP
Sbjct  294  GLISLKSLDLSINQLTGEIP  313


 Score = 52.4 bits (124),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 52/102 (51%), Gaps = 5/102 (5%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G +S DV     L ++ ++ N  +G +PP I     L+ L L  N F    P ++ +L
Sbjct  456  LPGEMSGDV-----LDHIYLSNNWFTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFEL  510

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  ++   NNLTGD+P  + + TSL  + L  N   G IP
Sbjct  511  KHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIP  552


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 53/103 (51%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +  L  ++G+   L  L ++ N L+G +P ++     L  L LSNN F  + P +L Q
Sbjct  355  NFTLELPANLGRNGNLKKLDVSDNHLTGLIPMDLCRGGKLETLVLSNNFFFGSIPEKLGQ  414

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  N L G +P  ++ +  +  + L  N+FSG +P
Sbjct  415  CKSLNKIRIVKNLLNGTVPEGLFNLPLVTIIELTDNFFSGELP  457


 Score = 49.7 bits (117),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 29/104 (28%), Positives = 56/104 (54%), Gaps = 1/104 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +L+G++  D+ +   L  L ++ N   G +P ++    +L  + +  N+   T P  L  
Sbjct  379  HLTGLIPMDLCRGGKLETLVLSNNFFFGSIPEKLGQCKSLNKIRIVKNLLNGTVPEGLFN  438

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L  + +++L +N  +G+LP E+     L H++L  N+F+G IPP
Sbjct  439  LPLVTIIELTDNFFSGELPGEMSG-DVLDHIYLSNNWFTGLIPP  481



>gb|KJB59753.1| hypothetical protein B456_009G269700 [Gossypium raimondii]
Length=607

 Score =   114 bits (285),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 64/161 (40%), Positives = 98/161 (61%), Gaps = 4/161 (2%)
 Frame = +1

Query  115  GVTEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLS  285
            G ++   LL +K++      S L  W  S+S   HC +  V CD    VV+L++S   L 
Sbjct  12   GYSDLEVLLKLKSSMIGPKASGLDDWEFSSSPSAHCHFSGVKCDEDHRVVALNVSFTPLY  71

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQ-LAQLA  462
            G +SP++G L  LVNL+I+  +L+G +P ++  +++L+  N+SNN F  +FP + L  + 
Sbjct  72   GTISPEIGLLNKLVNLTISKVELTGNIPTDMRNLTSLKTFNISNNYFRGSFPGEILTGMT  131

Query  463  NLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             L++LD YNNN TG LPVE+  +  L HL  GGNYF+G +P
Sbjct  132  QLEILDAYNNNFTGLLPVELANLKHLNHLSFGGNYFTGEVP  172


 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            +SG + P +G L  L  L +A N+LSG +PP IS  ++L  ++ S N      P  + +L
Sbjct  448  ISGEIPPAIGNLRSLQVLELARNKLSGEIPPSISRCTSLTSIDFSQNSLSGEIPKGINKL  507

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  L++  N LTG++P E+  MTSL  L +  N   GR+P
Sbjct  508  EHLSNLNVSRNRLTGEIPAEIENMTSLATLDVSDNNLIGRVP  549


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/103 (30%), Positives = 56/103 (54%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N +G L  ++G+   L NL +++N L+G +P ++    TL+ L L +N F      +L  
Sbjct  328  NFTGELPENLGRNGKLCNLDVSSNYLTGSIPLDLCKGGTLQELILMDNFFFGPLSEKLGN  387

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              +L  + +  NNL G +P  ++ + SL  + L  N+F+G +P
Sbjct  388  CNSLTKIRIKKNNLNGTIPAGIFNLPSLSFVELDDNFFAGELP  430


 Score = 58.5 bits (140),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 34/103 (33%), Positives = 54/103 (52%), Gaps = 1/103 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G +   +  LP L  + +  N  +G +P  +S   +L  L +SNN+     P  +  
Sbjct  400  NLNGTIPAGIFNLPSLSFVELDDNFFAGELPQRMSG-DSLEMLKISNNLISGEIPPAIGN  458

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +LQVL+L  N L+G++P  + + TSL  +    N  SG IP
Sbjct  459  LRSLQVLELARNKLSGEIPPSISRCTSLTSIDFSQNSLSGEIP  501


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 32/102 (31%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +   +  L  L +L ++ N+L+G +P   SA+  +  + L  N    + P  +  L
Sbjct  257  LTGRIPSQLAGLTSLKDLDLSLNELTGEIPESFSALQNISMIILFKNKLHGSIPSYVGDL  316

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L VL L+ NN TG+LP  + +   L +L +  NY +G IP
Sbjct  317  PQLAVLKLWENNFTGELPENLGRNGKLCNLDVSSNYLTGSIP  358


 Score = 53.1 bits (126),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 26/85 (31%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +1

Query  331  LSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDL  510
            L I+ N +SG +PP I  + +L+ L L+ N      P  +++  +L  +D   N+L+G++
Sbjct  441  LKISNNLISGEIPPAIGNLRSLQVLELARNKLSGEIPPSISRCTSLTSIDFSQNSLSGEI  500

Query  511  PVEVYKMTSLRHLHLGGNYFSGRIP  585
            P  + K+  L +L++  N  +G IP
Sbjct  501  PKGINKLEHLSNLNVSRNRLTGEIP  525



>ref|XP_002297907.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
 gb|EEE82712.2| leucine-rich repeat transmembrane protein kinase [Populus trichocarpa]
Length=988

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K +  +    SL SWN+      C+W  + CD +   V        N+SG L
Sbjct  36   QASILVSLKQSLES-YDPSLDSWNVPNYQLLCSWTGIQCDDMNRSVVALDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLSI  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSIQGNSFSDEFPREIHKLIRLQFLNISNNLFSGELAWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD+YNNN  G LP+ V ++  L++L  GGNYF G IPP
Sbjct  155  LDVYNNNFNGTLPLGVTQLAKLKYLDFGGNYFQGTIPP  192


 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV++ +A   LSGP+PPE+  +S L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHIDLANCSLSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            +++  LDL NN LTGD+P+E Y +  L  L+L  N   G IP
Sbjct  295  SSIISLDLSNNALTGDIPLEFYGLRRLTLLNLFLNKLHGEIP  336


 Score = 69.3 bits (168),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 59/103 (57%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LSG +   + + P  L  +++A N+LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIPSQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP
Sbjct  511  LNNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIP  553


 Score = 68.9 bits (167),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (59%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG + P++G L  L  L +  N+L+GP+PPE+  +S++  L+LSNN      P +   L
Sbjct  259  LSGPIPPELGGLSKLDTLFLQTNELTGPIPPELGNLSSIISLDLSNNALTGDIPLEFYGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G++P  + ++  L  L L  N F+G IP
Sbjct  319  RRLTLLNLFLNKLHGEIPYFIAELPELEVLKLWHNNFTGAIP  360


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +   +GQL  +  L ++ N LSG +PPEI    TL +L+LS N      P Q+ Q+
Sbjct  500  FTGEIPSQIGQLNNVFTLDMSRNNLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVQITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSIP  601


 Score = 64.3 bits (155),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G + P++G L  +++L ++ N L+G +P E   +  L  LNL  N      P+ +A+L
Sbjct  283  LTGPIPPELGNLSSIISLDLSNNALTGDIPLEFYGLRRLTLLNLFLNKLHGEIPYFIAEL  342

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  343  PELEVLKLWHNNFTGAIPAKLGENGRLTELDLSSNKLTGLVP  384


 Score = 60.8 bits (146),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 47/79 (59%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG + P++G    L  L ++ NQLSGP+P +I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPPEIGDCRTLTYLDLSQNQLSGPIPVQITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP  513
            + +L   D  +NN +G +P
Sbjct  583  MKSLTSADFSHNNFSGSIP  601


 Score = 55.5 bits (132),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 55/104 (53%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAI-STLRFLNLSNNIFGSTFPHQLAQ  456
            L+G +      LP L  + +  N LSG VP +IS   S L  +NL++N      P  +  
Sbjct  427  LTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKTPSKLAQMNLADNRLSGPLPASIGN  486

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             +NLQ+L L  N  TG++P ++ ++ ++  L +  N  SG IPP
Sbjct  487  FSNLQILLLSGNRFTGEIPSQIGQLNNVFTLDMSRNNLSGNIPP  530


 Score = 53.5 bits (127),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 53/104 (51%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  +++L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTSLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  +DL N +L+G +P E+  ++ L  L L  N  +G IPP
Sbjct  246  LINLVHIDLANCSLSGPIPPELGGLSKLDTLFLQTNELTGPIPP  289


 Score = 52.8 bits (125),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 52/103 (50%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q+++ 
Sbjct  403  LFGPLPDDLGHCDTLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSGQVPQQISKT  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             + L  ++L +N L+G LP  +   ++L+ L L GN F+G IP
Sbjct  463  PSKLAQMNLADNRLSGPLPASIGNFSNLQILLLSGNRFTGEIP  505



>ref|XP_011022287.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Populus euphratica]
Length=988

 Score =   115 bits (288),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 90/158 (57%), Gaps = 4/158 (3%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S++ +F +    S  SWN++     C+W  + CD     V        N+SG L
Sbjct  36   QASILVSVRQSFES-YDPSFDSWNVANYSLLCSWTGIQCDDKNRSVVAIDISNSNISGTL  94

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVNLS+  N  S   P EI  +  L+FLN+SNN+F      + +QL  LQV
Sbjct  95   SPAITELRSLVNLSLQGNSFSDRFPREIHRLIRLQFLNISNNLFSGQLNWEFSQLKELQV  154

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD YNNNL G LP+ V ++  L+HL  GGNYF G IPP
Sbjct  155  LDGYNNNLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPP  192


 Score = 71.2 bits (173),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 62/102 (61%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG++ P++G L  L  L +  N+L+GP+PPE+  +S+++ L+LSNN      P + + L
Sbjct  259  LSGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNLSSIKSLDLSNNALTGDIPLEFSGL  318

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L +L+L+ N L G +P  + ++  L  L L  N F+G IP
Sbjct  319  HRLTLLNLFLNKLHGQIPHFIAELPELEVLKLWHNNFTGVIP  360


 Score = 68.2 bits (165),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/103 (40%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLP-FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            LS  +    G++P  L  +++A N LSGP+P  I   S L+ L LS N F    P Q+ Q
Sbjct  451  LSEQVPQQTGKIPSKLEQMNLADNHLSGPLPASIGNFSNLQMLLLSGNRFTGEIPPQIGQ  510

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L N+  LD+  NNL+G++P E+    +L +L L  N  SG IP
Sbjct  511  LKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIP  553


 Score = 65.1 bits (157),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P+ G+L  LV+L +A   LSG +PPE+  ++ L  L L  N      P +L  L
Sbjct  235  FDGGIPPEFGKLINLVHLDLANCSLSGLIPPELGNLNKLDTLFLQTNELTGPIPPELGNL  294

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++++ LDL NN LTGD+P+E   +  L  L+L  N   G+IP
Sbjct  295  SSIKSLDLSNNALTGDIPLEFSGLHRLTLLNLFLNKLHGQIP  336


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 53/102 (52%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G + P +GQL  ++ L ++ N LSG +P EI    TL +L+LS N      P  + Q+
Sbjct  500  FTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQI  559

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  L++  N+L   LP E+  M SL       N FSG IP
Sbjct  560  HILNYLNISWNHLNQSLPKEIGSMKSLTSADFSHNNFSGSIP  601


 Score = 62.4 bits (150),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 51/105 (49%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G L   V QL  L +L    N   G +PP   ++  L +L+L  N      P +L  
Sbjct  161  NLNGTLPLGVTQLAKLKHLDFGGNYFQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGN  220

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL+ L L Y N   G +P E  K+ +L HL L     SG IPP
Sbjct  221  LTNLEQLYLGYYNEFDGGIPPEFGKLINLVHLDLANCSLSGLIPP  265


 Score = 60.5 bits (145),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/104 (34%), Positives = 57/104 (55%), Gaps = 5/104 (5%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG +  ++G  P L  L ++ NQLSGP+P  I+ I  L +LN+S N    + P ++  
Sbjct  523  NLSGNIPSEIGDCPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLPKEIGS  582

Query  457  LANLQVLDLYNNNLTGDLP----VEVYKMTS-LRHLHLGGNYFS  573
            + +L   D  +NN +G +P       +  TS + + HL G+Y +
Sbjct  583  MKSLTSADFSHNNFSGSIPEFGQYSFFNSTSFMGNPHLCGSYLN  626


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 33/104 (32%), Positives = 54/104 (52%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G L  D+G    L  + +  N L+G +P     +  L  + L NN      P Q  ++
Sbjct  403  LFGPLPDDLGHCDSLWRVRLGQNYLTGSIPSGFLYLPELSLMELQNNYLSEQVPQQTGKI  462

Query  460  -ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
             + L+ ++L +N+L+G LP  +   ++L+ L L GN F+G IPP
Sbjct  463  PSKLEQMNLADNHLSGPLPASIGNFSNLQMLLLSGNRFTGEIPP  506


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 54/103 (52%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            +LSG L   +G    L  L ++ N+ +G +PP+I  +  +  L++S N      P ++  
Sbjct  475  HLSGPLPASIGNFSNLQMLLLSGNRFTGEIPPQIGQLKNVLTLDMSRNNLSGNIPSEIGD  534

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
               L  LDL  N L+G +PV + ++  L +L++  N+ +  +P
Sbjct  535  CPTLTYLDLSQNQLSGPIPVHITQIHILNYLNISWNHLNQSLP  577


 Score = 52.8 bits (125),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 36/104 (35%), Positives = 51/104 (49%), Gaps = 1/104 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSN-NIFGSTFPHQLAQ  456
              G + P  G +  L  LS+  N L G +P E+  ++ L  L L   N F    P +  +
Sbjct  186  FQGTIPPSYGSMQQLNYLSLKGNDLRGLIPGELGNLTNLEQLYLGYYNEFDGGIPPEFGK  245

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  LDL N +L+G +P E+  +  L  L L  N  +G IPP
Sbjct  246  LINLVHLDLANCSLSGLIPPELGNLNKLDTLFLQTNELTGPIPP  289



>ref|XP_010690942.1| PREDICTED: probable LRR receptor-like serine/threonine-protein 
kinase At3g47570 [Beta vulgaris subsp. vulgaris]
Length=1030

 Score =   114 bits (286),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 66/156 (42%), Positives = 93/156 (60%), Gaps = 1/156 (1%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsll-hvvsldlsglNLSGVLS  297
            T+Q ALL +K+  T D    ++SWN +   CTW  VTCD +   V++LDL   NL+G++S
Sbjct  29   TDQKALLEMKSKITHDPLGVMSSWNDNLPFCTWHGVTCDRVHHRVIALDLQSSNLTGIIS  88

Query  298  PDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVL  477
            P +G L FL  L I  N L G +PPEI  +  LR + L NN  G   P  ++  ++L  L
Sbjct  89   PYLGNLSFLRELHIENNNLQGTIPPEIGRLHRLRVMWLVNNSIGGKIPRDISGCSSLVSL  148

Query  478  DLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +Y N L GD+P E+  ++ LR+LHLG N  +G IP
Sbjct  149  YIYRNKLVGDIPFELSLLSDLRYLHLGYNNLTGNIP  184


 Score = 58.2 bits (139),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 49/102 (48%), Gaps = 1/102 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG+L  +VG L  L  L +  N  SG +P  I     L  L L  N F    P  L  L
Sbjct  498  LSGLLPQEVGLLNNLAGLDLTRNMFSGEIPHTIGQCIALEELYLGRNYFQGAIPDALQML  557

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              LQVLDL  NNL+G++P +      L  L+L  N   G +P
Sbjct  558  KGLQVLDLSQNNLSGEIP-KFLGSLPLHLLNLSYNSLKGEVP  598


 Score = 49.3 bits (116),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/97 (34%), Positives = 51/97 (53%), Gaps = 2/97 (2%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEI-SAISTLRFLNLSNNIFGSTFPHQLA  453
            NL G + P +  L  L  L +  N L G +P  + + +S LRF ++  N F    P  L+
Sbjct  226  NLVGEVPPSIFNLSLLRILDLGDNGLEGNLPSSLGNMLSYLRFFSIYINQFTGKIPTSLS  285

Query  454  QLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
              +NL++L L  N+L G +P  ++ +  L  LHLG N
Sbjct  286  NASNLELLQLGENHLQGQVP-SLHNLQRLTRLHLGSN  321



>gb|AAP49010.1| CLV1-like receptor kinase [Brassica napus]
Length=978

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 68/160 (43%), Positives = 102/160 (64%), Gaps = 5/160 (3%)
 Frame = +1

Query  121  TEQAALLSIKAAFTADSQSSLTSWNISTS---HCTWRRVTCdsllhvvsldlsglNLSGV  291
            T+   LL++K++    +   L  W  S S   HC++  V+CD    V+SL++S   L G 
Sbjct  33   TDMDHLLTLKSSMVGPNGHGLHDWVRSPSPSAHCSFSGVSCDGDARVISLNVSFTPLFGT  92

Query  292  LSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNI-FGSTFPHQ-LAQLAN  465
            +SP++G L  LVNL++AAN  SG +P E+ ++++L+ LN+SNN+    TFP + L  + +
Sbjct  93   ISPEIGMLDRLVNLTLAANNFSGMLPLEMKSLTSLKVLNISNNVNLNGTFPGEILTPMVD  152

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L+VLD YNNN TG LP E+  +  LRHL LGGN+ +G IP
Sbjct  153  LEVLDAYNNNFTGPLPPEIPGLKKLRHLSLGGNFLTGEIP  192


 Score = 68.6 bits (166),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             SG +  +V +L  L  ++ +AN L+G +P  IS  ++L  ++LS N  G   P  +  +
Sbjct  499  FSGNIPREVFELKHLTKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIPKDIHDV  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL  L+L  N LTG +P+ + KMTSL  L L  N  SGR+P
Sbjct  559  INLGTLNLSGNQLTGSIPIGIGKMTSLTTLDLSFNDLSGRVP  600


 Score = 59.3 bits (142),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 57/103 (55%), Gaps = 0/103 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NL+G + P++  L  L +L ++ NQL+G +P    ++  +  +NL  N      P  +  
Sbjct  283  NLTGNIPPELSGLISLKSLDLSINQLTGEIPQSFISLWNITLVNLFRNNLHGPIPEFIGD  342

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            + NLQVL ++ NN T +LP  + +  +L+ L +  N+ +G IP
Sbjct  343  MPNLQVLQVWENNFTLELPANLGRNGNLKKLDVSDNHLTGLIP  385


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 55/102 (54%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G++ P +G    L +L +  N+ SG +P E+  +  L  +N S N      P  +++ 
Sbjct  475  FTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHLTKINTSANNLTGDIPDSISRC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             +L  +DL  N + GD+P +++ + +L  L+L GN  +G IP
Sbjct  535  TSLISVDLSRNRIGGDIPKDIHDVINLGTLNLSGNQLTGSIP  576


 Score = 55.1 bits (131),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +1

Query  346  NQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVY  525
            N  +G VPPE   ++ L  L++++       P  L+ L +L  L L+ NNLTG++P E+ 
Sbjct  234  NSYTGGVPPEFGELTNLEVLDMASCTLTGEIPTTLSNLKHLHTLFLHINNLTGNIPPELS  293

Query  526  KMTSLRHLHLGGNYFSGRIP  585
             + SL+ L L  N  +G IP
Sbjct  294  GLISLKSLDLSINQLTGEIP  313


 Score = 52.4 bits (124),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 50/99 (51%), Gaps = 6/99 (6%)
 Frame = +1

Query  307  GQLP------FLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANL  468
            G+LP       L ++ ++ N  +G +PP I     L+ L L  N F    P ++ +L +L
Sbjct  454  GELPGEMSGDLLDHIYLSNNWFTGLIPPAIGNFKNLQDLFLDRNRFSGNIPREVFELKHL  513

Query  469  QVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              ++   NNLTGD+P  + + TSL  + L  N   G IP
Sbjct  514  TKINTSANNLTGDIPDSISRCTSLISVDLSRNRIGGDIP  552



>ref|XP_009345734.1| PREDICTED: putative receptor-like protein kinase At3g47110 [Pyrus 
x bretschneideri]
Length=996

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 63/163 (39%), Positives = 90/163 (55%), Gaps = 1/163 (1%)
 Frame = +1

Query  103  GKPLGVTEQAALLSIKAAFTADSQSSLTSWNISTSHCTWRRVTCdsllhvvsldlsglN-  279
            G P    ++ +LL+ KA    D++  L+SWN S   C WR +TC      V++     + 
Sbjct  20   GLPGNEVDRLSLLAFKAEIVNDTRGILSSWNESLDFCEWRGITCGRRHRRVTVMDLRSSA  79

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L G LSP++G L FL  L +  N     +P EI  +  L+ + L NN F    P  +++ 
Sbjct  80   LEGQLSPNIGNLSFLRTLRLENNSFGHTIPSEIGRLFRLQRIRLHNNSFNGAIPSNISRC  139

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            +NLQ L LY NNL+G LP E+  ++ LR L LG N FSG+IPP
Sbjct  140  SNLQYLLLYGNNLSGKLPTEIASLSKLRVLDLGSNNFSGQIPP  182


 Score = 64.7 bits (156),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 37/104 (36%), Positives = 54/104 (52%), Gaps = 0/104 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            NLSG L  ++  L  L  L + +N  SG +PP    +S+L  L L +N      P+ L Q
Sbjct  151  NLSGKLPTEIASLSKLRVLDLGSNNFSGQIPPSFGNLSSLEKLYLDHNNLHGGIPNSLGQ  210

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NL  L L  NNL G +P  +Y ++S+ +  +  N   G +PP
Sbjct  211  LKNLAYLVLGTNNLNGTIPPSIYNLSSITYFSVLINQLRGTLPP  254


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 56/102 (55%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            L+G +  +VG L  L +L ++ N+LSG +P  + + ++L  L LS N    T P  L+ L
Sbjct  462  LTGSIPAEVGNLVHLDSLIVSDNRLSGEIPRSLGSCTSLTTLYLSGNSLQGTIPESLSSL  521

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              ++  D+  NNL+G +P  +     L +L+L  N F G +P
Sbjct  522  RGIENFDISRNNLSGRIPNYLESFRVLLNLNLSFNDFEGALP  563


 Score = 56.6 bits (135),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/103 (34%), Positives = 58/103 (56%), Gaps = 1/103 (1%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTL-RFLNLSNNIFGSTFPHQLAQ  456
            L G +   +G+   L+ L ++ N LSG +P ++  +S+L + LNLS N    + P ++  
Sbjct  413  LQGNIPRSLGECGKLLLLVLSENNLSGSIPKQVIGLSSLSQGLNLSGNQLTGSIPAEVGN  472

Query  457  LANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            L +L  L + +N L+G++P  +   TSL  L+L GN   G IP
Sbjct  473  LVHLDSLIVSDNRLSGEIPRSLGSCTSLTTLYLSGNSLQGTIP  515



>ref|XP_009368577.1| PREDICTED: leucine-rich repeat receptor-like serine/threonine-protein 
kinase BAM3 [Pyrus x bretschneideri]
Length=987

 Score =   114 bits (285),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/158 (41%), Positives = 94/158 (59%), Gaps = 3/158 (2%)
 Frame = +1

Query  124  EQAALLSIKAAFTADSQSSLTSWNISTSH--CTWRRVTCdsllhvvsldlsg-lNLSGVL  294
            + + L+S+K  F      SL++WN+S     C+W  + CDSL   V        NLSG L
Sbjct  34   QASILVSLKQNFEDSKNPSLSTWNVSNYMFLCSWAGIKCDSLNRSVVSLDISNYNLSGTL  93

Query  295  SPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLANLQV  474
            SP + +L  LVN+S++ N  SG  PP I  ++ L+ LN+SNN FG +   + ++L  L +
Sbjct  94   SPVITELRTLVNVSVSGNGFSGIFPPGIHKLAELQNLNISNNRFGGSLDLEFSKLEELVM  153

Query  475  LDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            LD YNN+  G LP+ V ++  L+ L+ GGNYFSG IPP
Sbjct  154  LDAYNNDFNGSLPLGVTQLPRLKRLNFGGNYFSGSIPP  191


 Score = 61.6 bits (148),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 41/102 (40%), Positives = 57/102 (56%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
              G + P++G+L  L +L +A   L GP+PPE+  +  L  L L  N    + P QL  L
Sbjct  234  FEGGIPPEIGKLINLFHLDLANCGLEGPIPPELGNLKKLDTLFLQTNQLSGSVPAQLGNL  293

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
            ++L+ LDL NN LTGD+P E   +  L  L+L  N F G IP
Sbjct  294  SSLRSLDLSNNALTGDIPAEFSSLRELTLLNLFINKFHGEIP  335


 Score = 60.1 bits (144),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 58/102 (57%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG +   +G L  L +L ++ N L+G +P E S++  L  LNL  N F    P  +A+L
Sbjct  282  LSGSVPAQLGNLSSLRSLDLSNNALTGDIPAEFSSLRELTLLNLFINKFHGEIPRSIAEL  341

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
             NL+VL L++NN TG +P ++ +   L  L L  N  +G +P
Sbjct  342  PNLEVLKLWHNNFTGAIPSKLGQNGKLIELDLSSNKLTGVVP  383


 Score = 59.7 bits (143),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 34/102 (33%), Positives = 51/102 (50%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
             +G +  D+G+L   + L ++ N  SG +PPEI     L +L+LS N      P Q+ Q+
Sbjct  499  FTGEIPSDIGRLQSFLKLDVSRNNFSGTIPPEIGNCIALTYLDLSQNQLSGPIPVQIVQI  558

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L   ++  N+L   LP E+  + SL       N FSG IP
Sbjct  559  HILNYFNVSWNHLNQSLPKELGSLKSLTSADFSHNNFSGPIP  600


 Score = 58.9 bits (141),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 29/79 (37%), Positives = 44/79 (56%), Gaps = 0/79 (0%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            N SG + P++G    L  L ++ NQLSGP+P +I  I  L + N+S N    + P +L  
Sbjct  522  NFSGTIPPEIGNCIALTYLDLSQNQLSGPIPVQIVQIHILNYFNVSWNHLNQSLPKELGS  581

Query  457  LANLQVLDLYNNNLTGDLP  513
            L +L   D  +NN +G +P
Sbjct  582  LKSLTSADFSHNNFSGPIP  600


 Score = 55.8 bits (133),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 30/102 (29%), Positives = 54/102 (53%), Gaps = 0/102 (0%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQL  459
            LSG L   +G    L  L ++ NQ +G +P +I  + +   L++S N F  T P ++   
Sbjct  475  LSGRLPASIGNFSSLQILLLSGNQFTGEIPSDIGRLQSFLKLDVSRNNFSGTIPPEIGNC  534

Query  460  ANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIP  585
              L  LDL  N L+G +PV++ ++  L + ++  N+ +  +P
Sbjct  535  IALTYLDLSQNQLSGPIPVQIVQIHILNYFNVSWNHLNQSLP  576


 Score = 54.3 bits (129),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 38/128 (30%), Positives = 59/128 (46%), Gaps = 25/128 (20%)
 Frame = +1

Query  280  LSGVLSPDVGQLPFLVNLSIAANQLSGPVPP------EISAI------------------  387
            L G L  D+G+   LV + +  N L+G +PP      E+S +                  
Sbjct  402  LFGPLPDDLGKCDTLVRVRMGQNYLTGSIPPGFLYLPELSLVELQNNYLTGQLLQERSKQ  461

Query  388  -STLRFLNLSNNIFGSTFPHQLAQLANLQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGN  564
             S L  +NLS+N      P  +   ++LQ+L L  N  TG++P ++ ++ S   L +  N
Sbjct  462  PSKLSQVNLSSNRLSGRLPASIGNFSSLQILLLSGNQFTGEIPSDIGRLQSFLKLDVSRN  521

Query  565  YFSGRIPP  588
             FSG IPP
Sbjct  522  NFSGTIPP  529


 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/101 (33%), Positives = 51/101 (50%), Gaps = 0/101 (0%)
 Frame = +1

Query  286  GVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQLAN  465
            G +   + +LP L  L +  N  +G +P ++     L  L+LS+N      P  L     
Sbjct  332  GEIPRSIAELPNLEVLKLWHNNFTGAIPSKLGQNGKLIELDLSSNKLTGVVPKSLCFGRR  391

Query  466  LQVLDLYNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L++L L NN L G LP ++ K  +L  + +G NY +G IPP
Sbjct  392  LEILILLNNFLFGPLPDDLGKCDTLVRVRMGQNYLTGSIPP  432


 Score = 50.8 bits (120),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 38/105 (36%), Positives = 52/105 (50%), Gaps = 1/105 (1%)
 Frame = +1

Query  277  NLSGVLSPDVGQLPFLVNLSIAANQLSGPVPPEISAISTLRFLNLSNNIFGSTFPHQLAQ  456
            + +G L   V QLP L  L+   N  SG +PP    +  L +L+++ N      P +L  
Sbjct  160  DFNGSLPLGVTQLPRLKRLNFGGNYFSGSIPPSYGNMVQLDYLSIAGNDLSGYIPSELGN  219

Query  457  LANLQVLDL-YNNNLTGDLPVEVYKMTSLRHLHLGGNYFSGRIPP  588
            L NLQ L L Y N   G +P E+ K+ +L HL L      G I