BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C12

Length=519
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011091529.1|  PREDICTED: uncharacterized protein LOC105171946    139   2e-35   Sesamum indicum [beniseed]
ref|XP_007051929.1|  ARM repeat superfamily protein isoform 1           139   3e-35   
ref|XP_009777698.1|  PREDICTED: uncharacterized protein LOC104227203    139   3e-35   Nicotiana sylvestris
emb|CDP08887.1|  unnamed protein product                                134   1e-33   Coffea canephora [robusta coffee]
gb|KDO85992.1|  hypothetical protein CISIN_1g008585mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_006445158.1|  hypothetical protein CICLE_v10019530mg             134   2e-33   Citrus clementina [clementine]
gb|KDO85991.1|  hypothetical protein CISIN_1g008585mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_009598446.1|  PREDICTED: uncharacterized protein LOC104094269    133   4e-33   Nicotiana tomentosiformis
gb|KHN27281.1|  U-box domain-containing protein 3                       133   4e-33   Glycine soja [wild soybean]
gb|EYU32054.1|  hypothetical protein MIMGU_mgv1a003927mg                132   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_006587866.1|  PREDICTED: vacuolar protein 8-like isoform X2      132   7e-33   Glycine max [soybeans]
ref|XP_002301324.1|  hypothetical protein POPTR_0002s15500g             132   7e-33   Populus trichocarpa [western balsam poplar]
ref|XP_011023426.1|  PREDICTED: uncharacterized protein LOC105124920    132   7e-33   Populus euphratica
ref|XP_011035297.1|  PREDICTED: uncharacterized protein LOC105133147    132   8e-33   Populus euphratica
ref|XP_006339473.1|  PREDICTED: U-box domain-containing protein 1...    132   9e-33   Solanum tuberosum [potatoes]
ref|XP_010692370.1|  PREDICTED: uncharacterized protein LOC104905499    132   9e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002320763.2|  armadillo/beta-catenin repeat family protein       131   1e-32   
ref|XP_008232880.1|  PREDICTED: vacuolar protein 8                      131   1e-32   Prunus mume [ume]
ref|XP_006339472.1|  PREDICTED: U-box domain-containing protein 1...    132   1e-32   Solanum tuberosum [potatoes]
ref|XP_002511794.1|  ubiquitin-protein ligase, putative                 131   1e-32   Ricinus communis
gb|KJB24668.1|  hypothetical protein B456_004G156500                    131   2e-32   Gossypium raimondii
ref|XP_003521923.1|  PREDICTED: U-box domain-containing protein 1...    131   2e-32   
ref|XP_004229842.1|  PREDICTED: uncharacterized protein LOC101261067    130   3e-32   Solanum lycopersicum
ref|XP_007218963.1|  hypothetical protein PRUPE_ppa003629mg             130   3e-32   Prunus persica
ref|XP_004306843.1|  PREDICTED: uncharacterized protein LOC101294...    130   5e-32   Fragaria vesca subsp. vesca
ref|XP_011469078.1|  PREDICTED: uncharacterized protein LOC101294...    130   5e-32   Fragaria vesca subsp. vesca
ref|XP_007139942.1|  hypothetical protein PHAVU_008G071700g             130   5e-32   Phaseolus vulgaris [French bean]
ref|XP_003529961.1|  PREDICTED: vacuolar protein 8-like isoform X1      130   6e-32   
gb|KHN04617.1|  U-box domain-containing protein 3                       129   6e-32   Glycine soja [wild soybean]
gb|KEH18965.1|  armadillo/beta-catenin-like repeat protein              129   7e-32   Medicago truncatula
gb|KEH18966.1|  armadillo/beta-catenin-like repeat protein              129   9e-32   Medicago truncatula
ref|XP_007139944.1|  hypothetical protein PHAVU_008G071700g             129   1e-31   Phaseolus vulgaris [French bean]
ref|XP_010053654.1|  PREDICTED: U-box domain-containing protein 4...    129   1e-31   Eucalyptus grandis [rose gum]
ref|XP_010092090.1|  U-box domain-containing protein 3                  128   2e-31   Morus notabilis
ref|XP_004144984.1|  PREDICTED: armadillo repeat-containing prote...    127   3e-31   
ref|XP_009343537.1|  PREDICTED: vacuolar protein 8                      127   5e-31   Pyrus x bretschneideri [bai li]
gb|KDP28690.1|  hypothetical protein JCGZ_14461                         126   8e-31   Jatropha curcas
gb|KHN29405.1|  U-box domain-containing protein 4                       126   1e-30   Glycine soja [wild soybean]
ref|XP_003534592.1|  PREDICTED: vacuolar protein 8-like isoform X1      126   1e-30   Glycine max [soybeans]
ref|XP_008460170.1|  PREDICTED: vacuolar protein 8 isoform X2           126   1e-30   Cucumis melo [Oriental melon]
ref|XP_004165303.1|  PREDICTED: armadillo repeat-containing prote...    126   1e-30   
gb|KJB41212.1|  hypothetical protein B456_007G095200                    125   1e-30   Gossypium raimondii
gb|KHG14190.1|  U-box domain-containing 4 -like protein                 126   2e-30   Gossypium arboreum [tree cotton]
ref|XP_008460169.1|  PREDICTED: vacuolar protein 8 isoform X1           126   2e-30   Cucumis melo [Oriental melon]
ref|XP_007134984.1|  hypothetical protein PHAVU_010G092100g             125   2e-30   Phaseolus vulgaris [French bean]
ref|XP_007134983.1|  hypothetical protein PHAVU_010G092100g             125   2e-30   Phaseolus vulgaris [French bean]
ref|XP_010278535.1|  PREDICTED: armadillo repeat-containing prote...    124   4e-30   Nelumbo nucifera [Indian lotus]
ref|XP_004510864.1|  PREDICTED: ARM REPEAT PROTEIN INTERACTING WI...    124   5e-30   Cicer arietinum [garbanzo]
emb|CBI38775.3|  unnamed protein product                                124   5e-30   Vitis vinifera
ref|XP_002269981.1|  PREDICTED: vacuolar protein 8                      124   6e-30   
emb|CAN66207.1|  hypothetical protein VITISV_031028                     123   1e-29   Vitis vinifera
ref|XP_008347119.1|  PREDICTED: vacuolar protein 8-like                 123   2e-29   Malus domestica [apple tree]
ref|XP_010055232.1|  PREDICTED: uncharacterized protein LOC104443...    119   6e-28   Eucalyptus grandis [rose gum]
ref|XP_010055230.1|  PREDICTED: uncharacterized protein LOC104443...    119   7e-28   Eucalyptus grandis [rose gum]
ref|XP_010055229.1|  PREDICTED: uncharacterized protein LOC104443...    119   8e-28   
ref|XP_008438099.1|  PREDICTED: vacuolar protein 8-like                 116   5e-27   Cucumis melo [Oriental melon]
ref|XP_004133883.1|  PREDICTED: vacuolar protein 8-like                 116   5e-27   Cucumis sativus [cucumbers]
gb|KJB49392.1|  hypothetical protein B456_008G116900                    114   2e-26   Gossypium raimondii
ref|XP_006307121.1|  hypothetical protein CARUB_v10008707mg             114   3e-26   
ref|XP_002880193.1|  armadillo/beta-catenin repeat family protein       114   4e-26   
ref|XP_010255531.1|  PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN 1     114   4e-26   Nelumbo nucifera [Indian lotus]
ref|XP_004492685.1|  PREDICTED: vacuolar protein 8-like                 113   6e-26   Cicer arietinum [garbanzo]
ref|XP_010934441.1|  PREDICTED: uncharacterized protein LOC105054594    113   8e-26   Elaeis guineensis
ref|XP_003623840.1|  U-box domain-containing protein                    113   8e-26   Medicago truncatula
ref|XP_006397753.1|  hypothetical protein EUTSA_v10001387mg             111   3e-25   Eutrema salsugineum [saltwater cress]
ref|XP_010479699.1|  PREDICTED: armadillo repeat-containing prote...    111   4e-25   
ref|NP_182096.1|  armadillo/beta-catenin repeat-containing protein      110   4e-25   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006418463.1|  hypothetical protein EUTSA_v10007207mg             110   8e-25   
ref|XP_010523721.1|  PREDICTED: vacuolar protein 8                      110   8e-25   Tarenaya hassleriana [spider flower]
ref|XP_006293423.1|  hypothetical protein CARUB_v10025291mg             110   8e-25   Capsella rubella
emb|CDY15147.1|  BnaC05g00260D                                          109   1e-24   Brassica napus [oilseed rape]
ref|XP_010540260.1|  PREDICTED: armadillo repeat-containing prote...    109   1e-24   Tarenaya hassleriana [spider flower]
ref|XP_008800804.1|  PREDICTED: protein ARABIDILLO 1-like               109   1e-24   Phoenix dactylifera
emb|CDX90063.1|  BnaA10g00190D                                          109   2e-24   
ref|XP_002889350.1|  hypothetical protein ARALYDRAFT_470092             108   3e-24   
ref|XP_010506527.1|  PREDICTED: U-box domain-containing protein 1...    108   3e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010474811.1|  PREDICTED: armadillo repeat-containing prote...    108   3e-24   Camelina sativa [gold-of-pleasure]
emb|CDY18907.1|  BnaC04g04430D                                          108   4e-24   Brassica napus [oilseed rape]
ref|XP_009119737.1|  PREDICTED: uncharacterized protein LOC103844682    107   6e-24   Brassica rapa
ref|XP_010457072.1|  PREDICTED: armadillo repeat-containing prote...    107   6e-24   Camelina sativa [gold-of-pleasure]
ref|XP_010933887.1|  PREDICTED: uncharacterized protein LOC105054...    107   9e-24   Elaeis guineensis
gb|EPS70823.1|  hypothetical protein M569_03935                         107   1e-23   Genlisea aurea
ref|XP_010508117.1|  PREDICTED: U-box domain-containing protein 1...    107   1e-23   Camelina sativa [gold-of-pleasure]
ref|XP_010933888.1|  PREDICTED: ARM REPEAT PROTEIN INTERACTING WI...    107   1e-23   Elaeis guineensis
emb|CDX74759.1|  BnaA05g05050D                                          106   1e-23   
ref|XP_009143163.1|  PREDICTED: uncharacterized protein LOC103866...    106   2e-23   Brassica rapa
ref|XP_009143162.1|  PREDICTED: uncharacterized protein LOC103866...    106   2e-23   Brassica rapa
gb|AAF78412.1|AC009273_18  Contains similarity to an unknown prot...    106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|NP_563637.1|  armadillo/beta-catenin-like repeat-containing p...    106   2e-23   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008803267.1|  PREDICTED: uncharacterized protein LOC103716867    105   5e-23   
ref|XP_009400038.1|  PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN...    105   7e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009133747.1|  PREDICTED: U-box domain-containing protein 9...    104   1e-22   Brassica rapa
ref|XP_008795377.1|  PREDICTED: ARM REPEAT PROTEIN INTERACTING WI...    103   1e-22   Phoenix dactylifera
ref|XP_010919224.1|  PREDICTED: uncharacterized protein LOC105043395    103   4e-22   Elaeis guineensis
ref|XP_009407953.1|  PREDICTED: vacuolar protein 8-like                 101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009391949.1|  PREDICTED: U-box domain-containing protein 15      101   2e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006857903.1|  hypothetical protein AMTR_s00069p00131410          100   2e-21   
ref|XP_009400720.1|  PREDICTED: vacuolar protein 8-like               99.8    5e-21   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDY53892.1|  BnaA03g56940D                                        98.6    1e-20   Brassica napus [oilseed rape]
ref|XP_009393926.1|  PREDICTED: vacuolar protein 8-like               97.8    2e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009392351.1|  PREDICTED: uncharacterized protein LOC103978317  96.7    6e-20   
ref|XP_004985979.1|  PREDICTED: protein ARABIDILLO 1-like             92.4    2e-18   
ref|XP_010234927.1|  PREDICTED: U-box domain-containing protein 1...  90.9    7e-18   Brachypodium distachyon [annual false brome]
ref|XP_010234926.1|  PREDICTED: vacuolar protein 8 isoform X1         90.9    7e-18   
tpg|DAA42941.1|  TPA: putative ARM repeat-containing protein cont...  90.9    9e-18   
ref|XP_008650123.1|  PREDICTED: protein ARABIDILLO 2-like             90.1    1e-17   Zea mays [maize]
dbj|BAJ95308.1|  predicted protein                                    87.8    8e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACS92633.1|  conserved hypothetical protein                        86.7    2e-16   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002468641.1|  hypothetical protein SORBIDRAFT_01g049470        83.6    2e-15   Sorghum bicolor [broomcorn]
ref|XP_003562185.1|  PREDICTED: uncharacterized protein LOC100846680  83.6    3e-15   Brachypodium distachyon [annual false brome]
gb|ABB47908.1|  Armadillo/beta-catenin-like repeat family protein...  83.2    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|AAM92297.1|  putative arm repeat containing protein                83.2    3e-15   Oryza sativa Japonica Group [Japonica rice]
gb|EEE51288.1|  hypothetical protein OsJ_32200                        83.2    4e-15   Oryza sativa Japonica Group [Japonica rice]
dbj|BAK05920.1|  predicted protein                                    82.4    5e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EEC67332.1|  hypothetical protein OsI_34367                        82.0    6e-15   Oryza sativa Indica Group [Indian rice]
dbj|BAJ93526.1|  predicted protein                                    82.0    7e-15   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001146217.1|  putative ARM repeat-containing protein conta...  82.0    8e-15   Zea mays [maize]
ref|XP_002467629.1|  hypothetical protein SORBIDRAFT_01g031170        82.0    8e-15   
gb|AFW89915.1|  putative ARM repeat-containing protein containing...  82.0    8e-15   
ref|NP_001140766.1|  putative ARM repeat-containing protein conta...  79.0    8e-14   Zea mays [maize]
gb|ACG29266.1|  armadillo-repeat containing protein                   79.0    9e-14   Zea mays [maize]
ref|XP_004983876.1|  PREDICTED: U-box domain-containing protein 1...  78.6    1e-13   Setaria italica
ref|XP_004983875.1|  PREDICTED: U-box domain-containing protein 1...  78.6    1e-13   Setaria italica
tpg|DAA40828.1|  TPA: putative ARM repeat-containing protein cont...  71.2    1e-11   
ref|XP_001772489.1|  predicted protein                                71.2    4e-11   
ref|XP_006649275.1|  PREDICTED: vacuolar protein 8-like               70.5    6e-11   Oryza brachyantha
ref|XP_002966534.1|  hypothetical protein SELMODRAFT_439556           69.3    2e-10   Selaginella moellendorffii
ref|XP_001768690.1|  predicted protein                                69.3    2e-10   
ref|XP_002982376.1|  hypothetical protein SELMODRAFT_421713           68.9    2e-10   
gb|ABF93658.1|  Armadillo/beta-catenin-like repeat family protein     64.3    6e-09   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001048764.1|  Os03g0116900                                     64.3    7e-09   
gb|EAY88286.1|  hypothetical protein OsI_09742                        64.3    7e-09   Oryza sativa Indica Group [Indian rice]
ref|XP_006844544.1|  hypothetical protein AMTR_s00016p00174170        62.0    4e-08   Amborella trichopoda
ref|XP_001756212.1|  predicted protein                                58.9    4e-07   
ref|XP_001758043.1|  predicted protein                                56.6    2e-06   
ref|XP_002966572.1|  hypothetical protein SELMODRAFT_407593           54.3    1e-05   
ref|XP_002982410.1|  hypothetical protein SELMODRAFT_421767           54.3    1e-05   
ref|XP_010250571.1|  PREDICTED: vacuolar protein 8                    51.2    1e-04   Nelumbo nucifera [Indian lotus]



>ref|XP_011091529.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091537.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091546.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091555.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091565.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091573.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
 ref|XP_011091581.1| PREDICTED: uncharacterized protein LOC105171946 [Sesamum indicum]
Length=560

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/90 (77%), Positives = 78/90 (87%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGG-ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GKN   ++LS EEWL  AQ LVP+AL++AREVKGFPGRWK I+SKLEQIPS+LSD
Sbjct  1    MVEDGGKNTAVDSLSTEEWLSCAQGLVPKALEKAREVKGFPGRWKTIISKLEQIPSRLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKNALCKEQLQAV +TLNEA E+
Sbjct  61   LSSHPCFSKNALCKEQLQAVSKTLNEANEL  90



>ref|XP_007051929.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051930.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051931.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 ref|XP_007051932.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96086.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96087.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96088.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
 gb|EOX96089.1| ARM repeat superfamily protein isoform 1 [Theobroma cacao]
Length=560

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 70/91 (77%), Positives = 78/91 (86%), Gaps = 3/91 (3%)
 Frame = +1

Query  253  MGEDCGKNG--GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            MGED G NG   +  SAEEWL  AQ+LVP AL +AREVKGFPGRWKMI+SKLEQIPS+LS
Sbjct  1    MGEDTG-NGVLADARSAEEWLSHAQELVPMALVKAREVKGFPGRWKMIMSKLEQIPSRLS  59

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            DLSSHPCFSKNALCKEQLQAV +TL EA+E+
Sbjct  60   DLSSHPCFSKNALCKEQLQAVSKTLKEAIEL  90



>ref|XP_009777698.1| PREDICTED: uncharacterized protein LOC104227203 [Nicotiana sylvestris]
 ref|XP_009777699.1| PREDICTED: uncharacterized protein LOC104227203 [Nicotiana sylvestris]
 ref|XP_009777700.1| PREDICTED: uncharacterized protein LOC104227203 [Nicotiana sylvestris]
 ref|XP_009777701.1| PREDICTED: uncharacterized protein LOC104227203 [Nicotiana sylvestris]
Length=559

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 77/89 (87%), Gaps = 0/89 (0%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            M +D G N  + LS EEWL +AQ LVP AL++AREVKGFPGRWKMI+SKLEQIP++LSDL
Sbjct  1    MVDDSGTNMVDILSVEEWLSRAQALVPVALEKAREVKGFPGRWKMIISKLEQIPNRLSDL  60

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSHP FSKNALCKEQLQ VL+TLNEA+++
Sbjct  61   SSHPFFSKNALCKEQLQTVLKTLNEAVDL  89



>emb|CDP08887.1| unnamed protein product [Coffea canephora]
Length=560

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGG-ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G +   + LSAEEWL +AQ+LVP ALK+AREVK FPGRWKMIVSKLEQIP+ LSD
Sbjct  1    MVEDAGMDVSIDMLSAEEWLSRAQELVPVALKKAREVKVFPGRWKMIVSKLEQIPATLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKNALCKEQLQAV +TL EA E+
Sbjct  61   LSSHPCFSKNALCKEQLQAVSKTLYEANEL  90



>gb|KDO85992.1| hypothetical protein CISIN_1g008585mg [Citrus sinensis]
Length=534

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     N+ SA+EWL+ AQ+LVP A+++AR++KGFPGRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGNGALANIQSADEWLLHAQELVPVAVEKARQIKGFPGRWKMIISKLEQIPSHLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKNALC+EQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNALCREQLQAVSKTLKEAIEL  90



>ref|XP_006445158.1| hypothetical protein CICLE_v10019530mg [Citrus clementina]
 ref|XP_006491009.1| PREDICTED: vacuolar protein 8-like [Citrus sinensis]
 gb|ESR58398.1| hypothetical protein CICLE_v10019530mg [Citrus clementina]
Length=560

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     N+ SA+EWL+ AQ+LVP A+++AR++KGFPGRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGNGALANIQSADEWLLHAQELVPVAVEKARQIKGFPGRWKMIISKLEQIPSHLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKNALC+EQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNALCREQLQAVSKTLKEAIEL  90



>gb|KDO85991.1| hypothetical protein CISIN_1g008585mg [Citrus sinensis]
Length=560

 Score =   134 bits (336),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 77/90 (86%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     N+ SA+EWL+ AQ+LVP A+++AR++KGFPGRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGNGALANIQSADEWLLHAQELVPVAVEKARQIKGFPGRWKMIISKLEQIPSHLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKNALC+EQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNALCREQLQAVSKTLKEAIEL  90



>ref|XP_009598446.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598447.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598448.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598449.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598450.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598451.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
 ref|XP_009598452.1| PREDICTED: uncharacterized protein LOC104094269 [Nicotiana tomentosiformis]
Length=559

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 76/89 (85%), Gaps = 0/89 (0%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            M +D G N  + LS EEWL +AQ LVP AL++AR+VKGFPGRW++I+SKLEQIP++LSDL
Sbjct  1    MVDDSGTNMVDILSVEEWLSRAQALVPVALEKARKVKGFPGRWRIIISKLEQIPNRLSDL  60

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSHP FSKNALCKEQLQ V +TLNEA+E+
Sbjct  61   SSHPFFSKNALCKEQLQTVSKTLNEAVEL  89



>gb|KHN27281.1| U-box domain-containing protein 3 [Glycine soja]
Length=565

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            E  S E+WL+ AQ+LVP AL  AREVKGFPGRWKMI+SKLEQIPS+LSDLSSHPCFSKNA
Sbjct  17   EARSTEDWLLHAQELVPVALANAREVKGFPGRWKMIISKLEQIPSRLSDLSSHPCFSKNA  76

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL EA+E+
Sbjct  77   LCKEQLQAVSKTLKEAVEL  95



>gb|EYU32054.1| hypothetical protein MIMGU_mgv1a003927mg [Erythranthe guttata]
Length=554

 Score =   132 bits (333),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 65/89 (73%), Positives = 74/89 (83%), Gaps = 2/89 (2%)
 Frame = +1

Query  253  MGEDCGKNGG--ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            M E+ G+N    +++S EEWL  AQ LVP ALK+AREVKGFP RWKMI+SKLE+IPSKLS
Sbjct  1    MVEEGGQNSAVDDSISTEEWLSCAQALVPTALKKAREVKGFPSRWKMIISKLEKIPSKLS  60

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAM  513
            DLSSHPCFSKNALCKEQL AV  TLNEA+
Sbjct  61   DLSSHPCFSKNALCKEQLHAVSNTLNEAI  89



>ref|XP_006587866.1| PREDICTED: vacuolar protein 8-like isoform X2 [Glycine max]
Length=573

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +1

Query  211  HERFFL*FQQKSEKMGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMI  390
            H RF+     ++E M ED  +   +  S E+WL+ AQ+LVP  + +AREVKGF GRWKMI
Sbjct  4    HRRFY---DYQTEIMVEDGDEVAVDARSTEDWLLHAQELVPVVIDKAREVKGFAGRWKMI  60

Query  391  VSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            V+KLEQIP +LSDLSSHPCFSKNALCKEQLQAV +TL EA+E+
Sbjct  61   VAKLEQIPLRLSDLSSHPCFSKNALCKEQLQAVSKTLGEAIEL  103



>ref|XP_002301324.1| hypothetical protein POPTR_0002s15500g [Populus trichocarpa]
 gb|EEE80597.1| hypothetical protein POPTR_0002s15500g [Populus trichocarpa]
Length=560

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GK    ++ S E+WL  AQ+LVP A+ +AREVKGFPGRWKMI+SKLEQIPS+LSD
Sbjct  1    MVEDRGKEVVVDIQSVEDWLCHAQELVPVAVDKAREVKGFPGRWKMIISKLEQIPSRLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN+LCKEQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNSLCKEQLQAVSKTLKEAIEL  90



>ref|XP_011023426.1| PREDICTED: uncharacterized protein LOC105124920 [Populus euphratica]
 ref|XP_011023427.1| PREDICTED: uncharacterized protein LOC105124920 [Populus euphratica]
Length=560

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GK    ++ S E+WL  AQ+LVP A+ +AREVKGFPGRWKMI+SKLEQIPS+LSD
Sbjct  1    MVEDRGKEVVVDIQSVEDWLCHAQELVPVAVDKAREVKGFPGRWKMIISKLEQIPSRLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN+LCKEQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNSLCKEQLQAVSKTLKEAIEL  90



>ref|XP_011035297.1| PREDICTED: uncharacterized protein LOC105133147 [Populus euphratica]
 ref|XP_011035305.1| PREDICTED: uncharacterized protein LOC105133147 [Populus euphratica]
 ref|XP_011035313.1| PREDICTED: uncharacterized protein LOC105133147 [Populus euphratica]
Length=560

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 64/90 (71%), Positives = 76/90 (84%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GK    ++ S E+WL  AQ+LVP A+ +AREVKGFPGRWKMI+SKLEQIPS+LSD
Sbjct  1    MVEDRGKEVVVDIQSVEDWLCHAQELVPVAVDKAREVKGFPGRWKMIISKLEQIPSRLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN+LCKEQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNSLCKEQLQAVSKTLKEAIEL  90



>ref|XP_006339473.1| PREDICTED: U-box domain-containing protein 12-like isoform X2 
[Solanum tuberosum]
 ref|XP_006339474.1| PREDICTED: U-box domain-containing protein 12-like isoform X3 
[Solanum tuberosum]
Length=555

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +1

Query  274  NGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFS  453
            N G NLS EEWL +AQ+ VP AL++AREVKGFPGRW+MI+SKLEQIP++LSDLSSHP FS
Sbjct  5    NSG-NLSVEEWLSRAQEFVPVALEKAREVKGFPGRWRMIISKLEQIPNRLSDLSSHPFFS  63

Query  454  KNALCKEQLQAVLQTLNEAMEM  519
            KNALCKEQLQ V +TLNEA+E+
Sbjct  64   KNALCKEQLQTVSKTLNEAVEL  85



>ref|XP_010692370.1| PREDICTED: uncharacterized protein LOC104905499 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010692372.1| PREDICTED: uncharacterized protein LOC104905499 [Beta vulgaris 
subsp. vulgaris]
Length=562

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEEWL+ AQ+LVP AL +A++VKGFPGRWKMI+SKLEQIPS+LSDLSSHPCFSKN LCK
Sbjct  15   TAEEWLLHAQELVPVALNKAKQVKGFPGRWKMIISKLEQIPSRLSDLSSHPCFSKNMLCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TLNEA E+
Sbjct  75   EQLQAVAKTLNEANEL  90



>ref|XP_002320763.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
 gb|EEE99078.2| armadillo/beta-catenin repeat family protein [Populus trichocarpa]
Length=540

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/90 (72%), Positives = 75/90 (83%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GK    ++ S E+WL  AQ+LVP AL +AREVKGFPGRWKMI+SKLEQIPS+LSD
Sbjct  1    MVEDRGKEVLVDIQSVEDWLSHAQELVPVALDKAREVKGFPGRWKMIISKLEQIPSRLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCF KNALCKEQLQAV +TL EA+E+
Sbjct  61   LSSHPCFFKNALCKEQLQAVSKTLKEAIEL  90



>ref|XP_008232880.1| PREDICTED: vacuolar protein 8 [Prunus mume]
 ref|XP_008232882.1| PREDICTED: vacuolar protein 8 [Prunus mume]
Length=560

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 5/88 (6%)
 Frame = +1

Query  271  KNGGENL-----SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLS  435
            +NGG  +     SAEEWL  A++LVP AL +AREVKGFPGRWKMI+SKLEQIPS+LSDLS
Sbjct  3    ENGGNEVLTGTRSAEEWLSHARELVPLALNKAREVKGFPGRWKMIISKLEQIPSRLSDLS  62

Query  436  SHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SHPCFSKNALCKEQLQ+V +TL E +E+
Sbjct  63   SHPCFSKNALCKEQLQSVSKTLKEVIEL  90



>ref|XP_006339472.1| PREDICTED: U-box domain-containing protein 12-like isoform X1 
[Solanum tuberosum]
Length=589

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 73/82 (89%), Gaps = 1/82 (1%)
 Frame = +1

Query  274  NGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFS  453
            N G NLS EEWL +AQ+ VP AL++AREVKGFPGRW+MI+SKLEQIP++LSDLSSHP FS
Sbjct  39   NSG-NLSVEEWLSRAQEFVPVALEKAREVKGFPGRWRMIISKLEQIPNRLSDLSSHPFFS  97

Query  454  KNALCKEQLQAVLQTLNEAMEM  519
            KNALCKEQLQ V +TLNEA+E+
Sbjct  98   KNALCKEQLQTVSKTLNEAVEL  119



>ref|XP_002511794.1| ubiquitin-protein ligase, putative [Ricinus communis]
 gb|EEF50463.1| ubiquitin-protein ligase, putative [Ricinus communis]
Length=561

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/91 (74%), Positives = 74/91 (81%), Gaps = 2/91 (2%)
 Frame = +1

Query  253  MGEDCGKNGGEN--LSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            M ED GK   E    S E+WL  AQ+LVP AL +AREVKGFPGRWKMI+SKLEQIPS LS
Sbjct  1    MVEDRGKAVIEEDIQSVEDWLSHAQELVPLALDKAREVKGFPGRWKMIISKLEQIPSHLS  60

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            DLSSHPCFSKNALCKEQLQAV +TL EA+E+
Sbjct  61   DLSSHPCFSKNALCKEQLQAVSKTLKEAIEL  91



>gb|KJB24668.1| hypothetical protein B456_004G156500 [Gossypium raimondii]
Length=560

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 71/79 (90%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            EN SAE+WL  AQ+LVP A+ +AREVKGFPGRWK+I+SKLE+IPS LSDLS+HPCFSKNA
Sbjct  12   ENRSAEDWLSHAQKLVPMAVDKAREVKGFPGRWKVIISKLERIPSCLSDLSTHPCFSKNA  71

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAVL+TL E +E+
Sbjct  72   LCKEQLQAVLKTLKEVIEL  90



>ref|XP_003521923.1| PREDICTED: U-box domain-containing protein 12-like isoform X1 
[Glycine max]
 ref|XP_006576362.1| PREDICTED: U-box domain-containing protein 12-like isoform X2 
[Glycine max]
 ref|XP_006576363.1| PREDICTED: U-box domain-containing protein 12-like isoform X3 
[Glycine max]
Length=565

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            E  S E+WL+ AQ+LVP AL  AREVKGFPGRWKMI+S LEQIPS+LSDLSSHPCFSKNA
Sbjct  17   EARSTEDWLLHAQELVPVALANAREVKGFPGRWKMIISNLEQIPSRLSDLSSHPCFSKNA  76

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL EA+E+
Sbjct  77   LCKEQLQAVSKTLKEAVEL  95



>ref|XP_004229842.1| PREDICTED: uncharacterized protein LOC101261067 [Solanum lycopersicum]
 ref|XP_004229843.1| PREDICTED: uncharacterized protein LOC101261067 [Solanum lycopersicum]
 ref|XP_004229844.1| PREDICTED: uncharacterized protein LOC101261067 [Solanum lycopersicum]
 ref|XP_010325944.1| PREDICTED: uncharacterized protein LOC101261067 [Solanum lycopersicum]
 ref|XP_010325950.1| PREDICTED: uncharacterized protein LOC101261067 [Solanum lycopersicum]
Length=555

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/89 (71%), Positives = 75/89 (84%), Gaps = 5/89 (6%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            M +D G     NLS EEWL +AQ+LVP AL++AREVKGFP RW+MI+SKLEQIP++LSDL
Sbjct  2    MVDDSG-----NLSVEEWLSRAQELVPVALEKAREVKGFPSRWRMIISKLEQIPNRLSDL  56

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSHP FSKNALCKEQLQ V +TLNEA+E+
Sbjct  57   SSHPFFSKNALCKEQLQTVSKTLNEAVEL  85



>ref|XP_007218963.1| hypothetical protein PRUPE_ppa003629mg [Prunus persica]
 gb|EMJ20162.1| hypothetical protein PRUPE_ppa003629mg [Prunus persica]
Length=560

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 5/88 (6%)
 Frame = +1

Query  271  KNGGENL-----SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLS  435
            +NGG  +     SAEEW   A++LVP AL +AREVKGFPGRWKMI+SKLEQIPS+LSDLS
Sbjct  3    ENGGHEVLTGTRSAEEWSSHARELVPLALNKAREVKGFPGRWKMIISKLEQIPSRLSDLS  62

Query  436  SHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SHPCFSKNALCKEQLQ+V +TL EA+E+
Sbjct  63   SHPCFSKNALCKEQLQSVSKTLKEAIEL  90



>ref|XP_004306843.1| PREDICTED: uncharacterized protein LOC101294980 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=560

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +A++LVP AL +AREVKGFPGRWKMI+SKLE IPS+LSDLSSHPCFSKNALCK
Sbjct  15   SAEEWLSQARELVPLALTKAREVKGFPGRWKMIISKLELIPSRLSDLSSHPCFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TL EA+E+
Sbjct  75   EQLQSVSKTLKEAIEL  90



>ref|XP_011469078.1| PREDICTED: uncharacterized protein LOC101294980 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=581

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 70/76 (92%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +A++LVP AL +AREVKGFPGRWKMI+SKLE IPS+LSDLSSHPCFSKNALCK
Sbjct  36   SAEEWLSQARELVPLALTKAREVKGFPGRWKMIISKLELIPSRLSDLSSHPCFSKNALCK  95

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TL EA+E+
Sbjct  96   EQLQSVSKTLKEAIEL  111



>ref|XP_007139942.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
 ref|XP_007139943.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
 gb|AER13165.1| armadillo [Phaseolus vulgaris]
 gb|ESW11936.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
 gb|ESW11937.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
Length=556

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL+ AQ+LVP  L++AREVKGF GRWKMI++KLEQIPS+LSDLSSHPCFSKNALCK
Sbjct  12   STEEWLLHAQELVPVVLEKAREVKGFAGRWKMIIAKLEQIPSRLSDLSSHPCFSKNALCK  71

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  72   EQLQAVSKTLGEAIEL  87



>ref|XP_003529961.1| PREDICTED: vacuolar protein 8-like isoform X1 [Glycine max]
 ref|XP_006583348.1| PREDICTED: vacuolar protein 8-like isoform X2 [Glycine max]
 ref|XP_006583349.1| PREDICTED: vacuolar protein 8-like isoform X3 [Glycine max]
Length=565

 Score =   130 bits (326),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            E  S E+WL+ AQ+LVP AL  AREVKGFPGRWKMI+SKLEQIP +LSDLSSHPCFS+NA
Sbjct  17   EARSTEDWLLHAQELVPVALANAREVKGFPGRWKMIISKLEQIPLRLSDLSSHPCFSRNA  76

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL EA+E+
Sbjct  77   LCKEQLQAVSKTLREAIEL  95



>gb|KHN04617.1| U-box domain-containing protein 3 [Glycine soja]
Length=560

 Score =   129 bits (325),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 60/79 (76%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            E  S E+WL+ AQ+LVP AL  AREVKGFPGRWKMI+SKLEQIP +LSDLSSHPCFS+NA
Sbjct  17   EARSTEDWLLHAQELVPVALANAREVKGFPGRWKMIISKLEQIPLRLSDLSSHPCFSRNA  76

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL EA+E+
Sbjct  77   LCKEQLQAVSKTLREAIEL  95



>gb|KEH18965.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula]
Length=561

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            +  S EEWL+ +Q+LVP AL +AREVKGF GRWKMI+SKLEQ+PSKLSDLSSHPCFSKNA
Sbjct  12   DTCSTEEWLLNSQELVPIALTKAREVKGFQGRWKMIISKLEQVPSKLSDLSSHPCFSKNA  71

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL E +E+
Sbjct  72   LCKEQLQAVSKTLREGIEL  90



>gb|KEH18966.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula]
Length=584

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 59/79 (75%), Positives = 69/79 (87%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            +  S EEWL+ +Q+LVP AL +AREVKGF GRWKMI+SKLEQ+PSKLSDLSSHPCFSKNA
Sbjct  35   DTCSTEEWLLNSQELVPIALTKAREVKGFQGRWKMIISKLEQVPSKLSDLSSHPCFSKNA  94

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL E +E+
Sbjct  95   LCKEQLQAVSKTLREGIEL  113



>ref|XP_007139944.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
 gb|ESW11938.1| hypothetical protein PHAVU_008G071700g [Phaseolus vulgaris]
Length=598

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/76 (78%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL+ AQ+LVP  L++AREVKGF GRWKMI++KLEQIPS+LSDLSSHPCFSKNALCK
Sbjct  54   STEEWLLHAQELVPVVLEKAREVKGFAGRWKMIIAKLEQIPSRLSDLSSHPCFSKNALCK  113

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  114  EQLQAVSKTLGEAIEL  129



>ref|XP_010053654.1| PREDICTED: U-box domain-containing protein 41-like [Eucalyptus 
grandis]
 ref|XP_010053655.1| PREDICTED: U-box domain-containing protein 41-like [Eucalyptus 
grandis]
 gb|KCW77995.1| hypothetical protein EUGRSUZ_D02240 [Eucalyptus grandis]
Length=560

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENLSA-EEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED      E+L A E+WL+ AQ+LVP AL +AREVKGFP RWKMI+SKLEQIPS LSD
Sbjct  1    MVEDSTNEVPEDLRATEDWLIHAQELVPLALSKAREVKGFPSRWKMIISKLEQIPSCLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCF+KNALCKEQLQAV +TL E++E+
Sbjct  61   LSSHPCFTKNALCKEQLQAVSETLRESLEL  90



>ref|XP_010092090.1| U-box domain-containing protein 3 [Morus notabilis]
 gb|EXB50103.1| U-box domain-containing protein 3 [Morus notabilis]
Length=560

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 70/79 (89%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            + LSAE+WL +AQQL+P AL +A+ VKGFPGRWKMI+SKLE IPS+LSDLSSHPCFSKN 
Sbjct  12   DTLSAEDWLSRAQQLIPLALSKAKVVKGFPGRWKMIISKLELIPSRLSDLSSHPCFSKNT  71

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LCKEQLQAV +TL E++E+
Sbjct  72   LCKEQLQAVSRTLKESIEL  90



>ref|XP_004144984.1| PREDICTED: armadillo repeat-containing protein 3-like [Cucumis 
sativus]
 ref|XP_004153606.1| PREDICTED: armadillo repeat-containing protein 3-like [Cucumis 
sativus]
 gb|KGN46202.1| hypothetical protein Csa_6G074550 [Cucumis sativus]
Length=565

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  268  GKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPC  447
            G    E  SAEEWL++AQ+LVP AL++A EVK FPGRWKMIVSKLEQ+PS+LSDLSSHPC
Sbjct  12   GGTDSEAESAEEWLLQAQKLVPVALEKALEVKVFPGRWKMIVSKLEQLPSRLSDLSSHPC  71

Query  448  FSKNALCKEQLQAVLQTLNEAMEM  519
            FSKN LCKEQLQAVL +L E +E+
Sbjct  72   FSKNVLCKEQLQAVLNSLKETVEL  95



>ref|XP_009343537.1| PREDICTED: vacuolar protein 8 [Pyrus x bretschneideri]
Length=560

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/76 (76%), Positives = 68/76 (89%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL  A++LVP AL +AREVKGFPGRWK I+SKLEQIPS+LSDLSSHPCFSKNALCK
Sbjct  15   SAEEWLSHARELVPLALNKAREVKGFPGRWKTIISKLEQIPSRLSDLSSHPCFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +T+ E +E+
Sbjct  75   EQLQSVSKTVKEVIEL  90



>gb|KDP28690.1| hypothetical protein JCGZ_14461 [Jatropha curcas]
Length=560

 Score =   126 bits (317),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/90 (70%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGEN-LSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED GK    + LS E+WL  AQ+LVP  L  A+EVKGFPGRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDRGKEVVRDILSVEDWLSHAQELVPLTLAAAKEVKGFPGRWKMIISKLEQIPSHLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN LC EQLQAV +TL EA+E+
Sbjct  61   LSSHPCFSKNTLCNEQLQAVSKTLKEAIEL  90



>gb|KHN29405.1| U-box domain-containing protein 4 [Glycine soja]
Length=559

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            M ED  +   +  S E+WL+ AQ+LVP  + +AREVKGF GRWKMIV+KLEQIP +LSDL
Sbjct  1    MVEDGDEVAVDARSTEDWLLHAQELVPVVIDKAREVKGFAGRWKMIVAKLEQIPLRLSDL  60

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSHPCFSKNALCKEQLQAV +TL EA+E+
Sbjct  61   SSHPCFSKNALCKEQLQAVSKTLGEAIEL  89



>ref|XP_003534592.1| PREDICTED: vacuolar protein 8-like isoform X1 [Glycine max]
 ref|XP_006587867.1| PREDICTED: vacuolar protein 8-like isoform X3 [Glycine max]
Length=559

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            M ED  +   +  S E+WL+ AQ+LVP  + +AREVKGF GRWKMIV+KLEQIP +LSDL
Sbjct  1    MVEDGDEVAVDARSTEDWLLHAQELVPVVIDKAREVKGFAGRWKMIVAKLEQIPLRLSDL  60

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSHPCFSKNALCKEQLQAV +TL EA+E+
Sbjct  61   SSHPCFSKNALCKEQLQAVSKTLGEAIEL  89



>ref|XP_008460170.1| PREDICTED: vacuolar protein 8 isoform X2 [Cucumis melo]
Length=565

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 2/93 (2%)
 Frame = +1

Query  247  EKMGEDCGKNG--GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSK  420
            E++  D G  G   E  S EEWL++AQ+LVP AL++A EVK FPGRWKMIVSKLEQ+PS+
Sbjct  3    EEVSVDRGSGGTDSEAESVEEWLLQAQKLVPVALEKALEVKVFPGRWKMIVSKLEQLPSR  62

Query  421  LSDLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSDLSSHPCFSKN LCKEQLQAVL +L E +E+
Sbjct  63   LSDLSSHPCFSKNVLCKEQLQAVLNSLKETVEL  95



>ref|XP_004165303.1| PREDICTED: armadillo repeat-containing protein 3-like [Cucumis 
sativus]
Length=565

 Score =   126 bits (316),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +1

Query  268  GKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPC  447
            G    E  SAE+WL++AQ+LVP AL++A EVK FPGRWKMIVSKLEQ+PS+LSDLSSHPC
Sbjct  12   GGTDSEAESAEKWLLQAQKLVPVALEKALEVKVFPGRWKMIVSKLEQLPSRLSDLSSHPC  71

Query  448  FSKNALCKEQLQAVLQTLNEAMEM  519
            FSKN LCKEQLQAVL +L E +E+
Sbjct  72   FSKNVLCKEQLQAVLNSLKETVEL  95



>gb|KJB41212.1| hypothetical protein B456_007G095200 [Gossypium raimondii]
 gb|KJB41213.1| hypothetical protein B456_007G095200 [Gossypium raimondii]
 gb|KJB41214.1| hypothetical protein B456_007G095200 [Gossypium raimondii]
 gb|KJB41215.1| hypothetical protein B456_007G095200 [Gossypium raimondii]
Length=560

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +1

Query  253  MGEDCGKNG--GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            MGE  G NG   +  SAEEWL  AQ+LVP AL +AR+VKGFPGRWK+I+ KLEQ+PS+LS
Sbjct  1    MGEGTG-NGVLADGKSAEEWLWHAQELVPMALDKARKVKGFPGRWKIIIFKLEQVPSRLS  59

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            DLSSHP FSKNALCKEQLQAV +TL EA+E+
Sbjct  60   DLSSHPFFSKNALCKEQLQAVSKTLKEAIEL  90



>gb|KHG14190.1| U-box domain-containing 4 -like protein [Gossypium arboreum]
Length=601

 Score =   126 bits (317),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/91 (70%), Positives = 75/91 (82%), Gaps = 3/91 (3%)
 Frame = +1

Query  253  MGEDCGKNG--GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            MGE  G NG   +  SAEEWL  AQ+LVP AL +AR+VKGFPGRWK+I+ KLEQ+PS+LS
Sbjct  1    MGEGTG-NGVLADGKSAEEWLWHAQELVPMALDKARKVKGFPGRWKIIIFKLEQVPSRLS  59

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            DLSSHP FSKNALCKEQLQAV +TL EA+E+
Sbjct  60   DLSSHPFFSKNALCKEQLQAVSKTLKEAIEL  90



>ref|XP_008460169.1| PREDICTED: vacuolar protein 8 isoform X1 [Cucumis melo]
Length=580

 Score =   126 bits (316),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 2/93 (2%)
 Frame = +1

Query  247  EKMGEDCGKNG--GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSK  420
            E++  D G  G   E  S EEWL++AQ+LVP AL++A EVK FPGRWKMIVSKLEQ+PS+
Sbjct  18   EEVSVDRGSGGTDSEAESVEEWLLQAQKLVPVALEKALEVKVFPGRWKMIVSKLEQLPSR  77

Query  421  LSDLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSDLSSHPCFSKN LCKEQLQAVL +L E +E+
Sbjct  78   LSDLSSHPCFSKNVLCKEQLQAVLNSLKETVEL  110



>ref|XP_007134984.1| hypothetical protein PHAVU_010G092100g [Phaseolus vulgaris]
 gb|ESW06978.1| hypothetical protein PHAVU_010G092100g [Phaseolus vulgaris]
Length=560

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL+ AQ+LVP AL +AREVK FPGRWKMI+SKLEQIPS LSDLSSHPCFSKNALCK
Sbjct  15   SREDWLLHAQELVPVALAKAREVKVFPGRWKMIISKLEQIPSCLSDLSSHPCFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA E+
Sbjct  75   EQLQAVSKTLEEATEL  90



>ref|XP_007134983.1| hypothetical protein PHAVU_010G092100g [Phaseolus vulgaris]
 gb|ESW06977.1| hypothetical protein PHAVU_010G092100g [Phaseolus vulgaris]
Length=596

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/76 (79%), Positives = 67/76 (88%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL+ AQ+LVP AL +AREVK FPGRWKMI+SKLEQIPS LSDLSSHPCFSKNALCK
Sbjct  51   SREDWLLHAQELVPVALAKAREVKVFPGRWKMIISKLEQIPSCLSDLSSHPCFSKNALCK  110

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA E+
Sbjct  111  EQLQAVSKTLEEATEL  126



>ref|XP_010278535.1| PREDICTED: armadillo repeat-containing protein 4-like [Nelumbo 
nucifera]
 ref|XP_010278536.1| PREDICTED: armadillo repeat-containing protein 4-like [Nelumbo 
nucifera]
 ref|XP_010278537.1| PREDICTED: armadillo repeat-containing protein 4-like [Nelumbo 
nucifera]
 ref|XP_010278539.1| PREDICTED: armadillo repeat-containing protein 4-like [Nelumbo 
nucifera]
Length=559

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 74/90 (82%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGG-ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G++   + LS EEWL +AQ+LVP AL +A+ +K FPGRWKMI+SKLEQ+PS+L+D
Sbjct  1    MVEDGGEDVSVDTLSTEEWLSRAQELVPTALDKAKAIKRFPGRWKMIISKLEQVPSRLAD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHP FSKNALCKEQLQAV +TL E +E+
Sbjct  61   LSSHPFFSKNALCKEQLQAVTKTLAETIEL  90



>ref|XP_004510864.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like isoform 
X1 [Cicer arietinum]
 ref|XP_004510865.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like isoform 
X2 [Cicer arietinum]
Length=559

 Score =   124 bits (312),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 69/76 (91%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL+ +QQLVP AL ++++V+GF GRWKMI++KLEQ+PSKLSDLSSHPCFSKNALCK
Sbjct  16   STEEWLLHSQQLVPIALTKSKQVQGFQGRWKMIITKLEQVPSKLSDLSSHPCFSKNALCK  75

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  76   EQLQAVSRTLREAIEL  91



>emb|CBI38775.3| unnamed protein product [Vitis vinifera]
Length=522

 Score =   124 bits (311),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNG-GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     +N SA++ L +AQ+LVP AL  +REVKGF GRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGDEFLADNQSADKLLARAQELVPVALDNSREVKGFLGRWKMIISKLEQIPSCLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN LCKEQLQAVL+TL E +E+
Sbjct  61   LSSHPCFSKNTLCKEQLQAVLRTLKETIEL  90



>ref|XP_002269981.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661570.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661571.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661572.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661573.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661574.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661575.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661576.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
 ref|XP_010661577.1| PREDICTED: vacuolar protein 8 [Vitis vinifera]
Length=560

 Score =   124 bits (311),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 72/90 (80%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNG-GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     +N SA++ L +AQ+LVP AL  +REVKGF GRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGDEFLADNQSADKLLARAQELVPVALDNSREVKGFLGRWKMIISKLEQIPSCLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN LCKEQLQAVL+TL E +E+
Sbjct  61   LSSHPCFSKNTLCKEQLQAVLRTLKETIEL  90



>emb|CAN66207.1| hypothetical protein VITISV_031028 [Vitis vinifera]
Length=560

 Score =   123 bits (309),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 62/90 (69%), Positives = 71/90 (79%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNG-GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            M ED G     +N SA++ L +AQ+LVP AL   REVKGF GRWKMI+SKLEQIPS LSD
Sbjct  1    MVEDGGDEFLADNQSADKLLARAQELVPVALDNXREVKGFLGRWKMIISKLEQIPSCLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHPCFSKN LCKEQLQAVL+TL E +E+
Sbjct  61   LSSHPCFSKNTLCKEQLQAVLRTLKETIEL  90



>ref|XP_008347119.1| PREDICTED: vacuolar protein 8-like [Malus domestica]
 ref|XP_008347120.1| PREDICTED: vacuolar protein 8-like [Malus domestica]
 ref|XP_008347121.1| PREDICTED: vacuolar protein 8-like [Malus domestica]
Length=560

 Score =   123 bits (308),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/76 (74%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL  A+ LVP AL +AREVKGFPGRWK I+SKLEQIPS+LSDLS HPCFSKNALCK
Sbjct  15   SVEEWLSHARVLVPLALNKAREVKGFPGRWKTIISKLEQIPSRLSDLSGHPCFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +T+ E +E+
Sbjct  75   EQLQSVSKTVKEVIEL  90



>ref|XP_010055232.1| PREDICTED: uncharacterized protein LOC104443491 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010055233.1| PREDICTED: uncharacterized protein LOC104443491 isoform X3 [Eucalyptus 
grandis]
 ref|XP_010055234.1| PREDICTED: uncharacterized protein LOC104443491 isoform X3 [Eucalyptus 
grandis]
 gb|KCW71698.1| hypothetical protein EUGRSUZ_E00215 [Eucalyptus grandis]
Length=560

 Score =   119 bits (297),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL  A++LVP AL RAREVKGFP RW+ I+SKLEQIPS LSDLSSHPCFSKNAL K
Sbjct  15   SIEDWLSHARELVPVALDRAREVKGFPARWRKIISKLEQIPSCLSDLSSHPCFSKNALSK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  75   EQLQAVSRTLAEAIEL  90



>ref|XP_010055230.1| PREDICTED: uncharacterized protein LOC104443491 isoform X2 [Eucalyptus 
grandis]
 ref|XP_010055231.1| PREDICTED: uncharacterized protein LOC104443491 isoform X2 [Eucalyptus 
grandis]
Length=570

 Score =   119 bits (297),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL  A++LVP AL RAREVKGFP RW+ I+SKLEQIPS LSDLSSHPCFSKNAL K
Sbjct  25   SIEDWLSHARELVPVALDRAREVKGFPARWRKIISKLEQIPSCLSDLSSHPCFSKNALSK  84

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  85   EQLQAVSRTLAEAIEL  100



>ref|XP_010055229.1| PREDICTED: uncharacterized protein LOC104443491 isoform X1 [Eucalyptus 
grandis]
Length=584

 Score =   119 bits (297),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 57/76 (75%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL  A++LVP AL RAREVKGFP RW+ I+SKLEQIPS LSDLSSHPCFSKNAL K
Sbjct  39   SIEDWLSHARELVPVALDRAREVKGFPARWRKIISKLEQIPSCLSDLSSHPCFSKNALSK  98

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL EA+E+
Sbjct  99   EQLQAVSRTLAEAIEL  114



>ref|XP_008438099.1| PREDICTED: vacuolar protein 8-like [Cucumis melo]
 ref|XP_008438100.1| PREDICTED: vacuolar protein 8-like [Cucumis melo]
 ref|XP_008438101.1| PREDICTED: vacuolar protein 8-like [Cucumis melo]
 ref|XP_008438102.1| PREDICTED: vacuolar protein 8-like [Cucumis melo]
 ref|XP_008438103.1| PREDICTED: vacuolar protein 8-like [Cucumis melo]
Length=559

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 56/80 (70%), Positives = 65/80 (81%), Gaps = 0/80 (0%)
 Frame = +1

Query  280  GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKN  459
            G+  S E+WL  AQ+LVP AL +AREVK FPGRWK I+ K+EQIPS+LSDLSSHP FSKN
Sbjct  11   GDRQSTEDWLSYAQELVPLALLKAREVKVFPGRWKTIIIKMEQIPSRLSDLSSHPFFSKN  70

Query  460  ALCKEQLQAVLQTLNEAMEM  519
            ALCKEQLQAV +TL E  E+
Sbjct  71   ALCKEQLQAVSKTLEEVTEL  90



>ref|XP_004133883.1| PREDICTED: vacuolar protein 8-like [Cucumis sativus]
 gb|KGN56555.1| hypothetical protein Csa_3G124750 [Cucumis sativus]
Length=559

 Score =   116 bits (290),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 54/76 (71%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL   Q+LVP  L +AREVK FPGRWKMI++K+EQIPS+LSDLSSHP FSKNALCK
Sbjct  15   STEDWLSYTQELVPLVLLKAREVKVFPGRWKMIITKMEQIPSRLSDLSSHPFFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL E +E+
Sbjct  75   EQLQAVSKTLEEVIEL  90



>gb|KJB49392.1| hypothetical protein B456_008G116900 [Gossypium raimondii]
Length=552

 Score =   114 bits (285),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 61/90 (68%), Positives = 69/90 (77%), Gaps = 1/90 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENL-SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSD  429
            MGE  G     ++ SAEE L  A++LVP AL +AREVKGF  RWKMIVSKLEQIPS LSD
Sbjct  1    MGEGIGNGVSIDVRSAEESLSYARELVPMALVKAREVKGFLSRWKMIVSKLEQIPSCLSD  60

Query  430  LSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            LSSHP FSKN LCKEQLQAV  T+ EA+E+
Sbjct  61   LSSHPFFSKNGLCKEQLQAVSMTVKEAIEL  90



>ref|XP_006307121.1| hypothetical protein CARUB_v10008707mg [Capsella rubella]
 gb|EOA40019.1| hypothetical protein CARUB_v10008707mg [Capsella rubella]
Length=572

 Score =   114 bits (285),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +   L+P  L +AR VK F GRWKMI+SK++QIP  LSDLSSHPCFSKN LC 
Sbjct  31   SAEEWLSRVHSLIPSVLSKARTVKNFAGRWKMIISKIDQIPGCLSDLSSHPCFSKNKLCN  90

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNE +E+
Sbjct  91   EQLQSVAKTLNEVIEL  106



>ref|XP_002880193.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH56452.1| armadillo/beta-catenin repeat family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=553

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 69/85 (81%), Gaps = 3/85 (4%)
 Frame = +1

Query  274  NGGENL---SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHP  444
             G E L   + E+ L++AQ+LVP AL +AR VKGF  RW++I+S+LE+IP+ LSDLSSHP
Sbjct  6    TGNETLVDPTVEDLLLQAQELVPMALSKARTVKGFSSRWRVIISRLEKIPTCLSDLSSHP  65

Query  445  CFSKNALCKEQLQAVLQTLNEAMEM  519
            CFSK+ LCKEQLQAVL+TL EA+E+
Sbjct  66   CFSKHTLCKEQLQAVLETLKEAIEL  90



>ref|XP_010255531.1| PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN 1 [Nelumbo nucifera]
 ref|XP_010255532.1| PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN 1 [Nelumbo nucifera]
 ref|XP_010255534.1| PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN 1 [Nelumbo nucifera]
Length=560

 Score =   114 bits (284),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAE+ L +AQ+LVP AL++A+E   FPGRWKMI+SK+E +PS+LSDLSSHP FSKNALCK
Sbjct  15   SAEDLLSRAQELVPTALEKAKEANWFPGRWKMIISKIEHVPSRLSDLSSHPFFSKNALCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV +TL E +E+
Sbjct  75   EQLQAVTKTLGETIEL  90



>ref|XP_004492685.1| PREDICTED: vacuolar protein 8-like [Cicer arietinum]
Length=560

 Score =   113 bits (283),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/76 (68%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL+ A++LVP AL +A+EVKGF  RWKMI+S+LE IPS LS+LSSHPCFSKNALCK
Sbjct  9    STEDWLLHAKKLVPIALDKAKEVKGFLCRWKMIISRLEHIPSMLSNLSSHPCFSKNALCK  68

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV  +L EA+++
Sbjct  69   EQLQAVSNSLGEAVKL  84



>ref|XP_010934441.1| PREDICTED: uncharacterized protein LOC105054594 [Elaeis guineensis]
Length=557

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAE WL +AQ LVP AL++AR   GF GRWK I+SKLE+IP  LSDL+SHPCF+KNALC+
Sbjct  13   SAEHWLARAQLLVPTALQKARTATGFAGRWKAIISKLERIPPCLSDLASHPCFAKNALCR  72

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V  TL EA+E+
Sbjct  73   EQLQSVADTLAEAIEL  88



>ref|XP_003623840.1| U-box domain-containing protein [Medicago truncatula]
 gb|ABN08829.1| Armadillo [Medicago truncatula]
 gb|AES80058.1| armadillo/beta-catenin-like repeat protein [Medicago truncatula]
Length=560

 Score =   113 bits (282),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  289  LSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALC  468
            LS E+WL+ A++LVP AL +A+EVKGF  RWKMI+S+LEQ+PS LS+LSSHPCFSKNALC
Sbjct  11   LSTEDWLLHAKELVPIALDKAKEVKGFSTRWKMIISRLEQVPSMLSNLSSHPCFSKNALC  70

Query  469  KEQLQAVLQTLNEAME  516
            KEQLQA+ ++L   +E
Sbjct  71   KEQLQALSKSLEGTIE  86



>ref|XP_006397753.1| hypothetical protein EUTSA_v10001387mg [Eutrema salsugineum]
 gb|ESQ39206.1| hypothetical protein EUTSA_v10001387mg [Eutrema salsugineum]
Length=553

 Score =   111 bits (278),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 67/86 (78%), Gaps = 3/86 (3%)
 Frame = +1

Query  271  KNGGENL---SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSH  441
            K G E L     E+ L++AQ+LVP AL +AR V GF  RW++I+S+LE+IP+ LSDLSSH
Sbjct  5    KTGNETLVDPKVEDLLLQAQELVPIALDKARTVTGFSSRWRVIISRLEKIPTCLSDLSSH  64

Query  442  PCFSKNALCKEQLQAVLQTLNEAMEM  519
            PCFSK+ LCKEQLQAVL TL EA+E+
Sbjct  65   PCFSKHTLCKEQLQAVLGTLKEAIEL  90



>ref|XP_010479699.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
 ref|XP_010479707.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
Length=577

 Score =   111 bits (277),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +   L+P  L +A+ VK F GRWK I+SK++QIP  LSDLSSHPCFSKN LC 
Sbjct  34   SAEEWLSRVHSLIPSVLSKAKTVKNFAGRWKTIISKIDQIPGCLSDLSSHPCFSKNKLCN  93

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V++TLNE +E+
Sbjct  94   EQLQSVVKTLNEVIEL  109



>ref|NP_182096.1| armadillo/beta-catenin repeat-containing protein [Arabidopsis 
thaliana]
 ref|NP_001031543.1| armadillo/beta-catenin repeat-containing protein [Arabidopsis 
thaliana]
 gb|AAC28553.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14897.1| unknown protein [Arabidopsis thaliana]
 gb|AAU05479.1| At2g45720 [Arabidopsis thaliana]
 gb|AAU95424.1| At2g45720 [Arabidopsis thaliana]
 gb|AEC10591.1| armadillo/beta-catenin repeat-containing protein [Arabidopsis 
thaliana]
 gb|AEC10592.1| armadillo/beta-catenin repeat-containing protein [Arabidopsis 
thaliana]
Length=553

 Score =   110 bits (276),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            + E+ L++AQ+LVP AL +AR VKGF  RW++I+S+LE+IP+ LSDLSSHPCFSK+ LCK
Sbjct  15   TVEDLLLQAQELVPIALSKARTVKGFSSRWRVIISRLEKIPTCLSDLSSHPCFSKHTLCK  74

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAVL+TL E +E+
Sbjct  75   EQLQAVLETLKETIEL  90



>ref|XP_006418463.1| hypothetical protein EUTSA_v10007207mg [Eutrema salsugineum]
 gb|ESQ36816.1| hypothetical protein EUTSA_v10007207mg [Eutrema salsugineum]
Length=573

 Score =   110 bits (275),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL + Q L+P  L +A+ VK F GRWK I+SK++QIP  LSDLSSHPCFSKN LC 
Sbjct  31   SAEEWLSRVQSLIPSVLSKAKTVKNFTGRWKTIISKIDQIPGCLSDLSSHPCFSKNKLCN  90

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNE  E+
Sbjct  91   EQLQSVAKTLNEVKEL  106



>ref|XP_010523721.1| PREDICTED: vacuolar protein 8 [Tarenaya hassleriana]
 ref|XP_010523722.1| PREDICTED: vacuolar protein 8 [Tarenaya hassleriana]
Length=555

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 50/76 (66%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAE+ L++AQ+LVP AL  AR+ KGFP RW++I+S+LEQ PS LSDLSS+PCFS+N+LC+
Sbjct  17   SAEDLLLQAQELVPVALATARKAKGFPSRWRVIISRLEQTPSCLSDLSSYPCFSRNSLCR  76

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV  TL EA+E+
Sbjct  77   EQLQAVWSTLKEAIEL  92



>ref|XP_006293423.1| hypothetical protein CARUB_v10025291mg [Capsella rubella]
 gb|EOA26321.1| hypothetical protein CARUB_v10025291mg [Capsella rubella]
Length=553

 Score =   110 bits (274),  Expect = 8e-25, Method: Compositional matrix adjust.
 Identities = 51/86 (59%), Positives = 69/86 (80%), Gaps = 3/86 (3%)
 Frame = +1

Query  271  KNGGENL---SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSH  441
            + G E L   + E+ L++AQ+ VP AL +AR VK F  RW++I+S+LE+IP+ LSDLSSH
Sbjct  5    RTGNETLVDPTVEDLLLQAQEFVPVALSKARTVKVFSSRWRVIISRLEKIPTCLSDLSSH  64

Query  442  PCFSKNALCKEQLQAVLQTLNEAMEM  519
            PCFSK+ALCKEQLQAVL+TL +A+E+
Sbjct  65   PCFSKHALCKEQLQAVLETLKDAIEL  90



>emb|CDY15147.1| BnaC05g00260D [Brassica napus]
Length=569

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL     L+P  L++A+ V  F GRWK I+SK++QIP  LSDLSSHPCFSKN LC 
Sbjct  28   SAEEWLSHVHSLIPSVLQKAKTVPNFTGRWKTIISKIQQIPGCLSDLSSHPCFSKNKLCN  87

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNEAME+
Sbjct  88   EQLQSVAKTLNEAMEL  103



>ref|XP_010540260.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540262.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540263.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540264.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540265.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540266.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540268.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540269.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
 ref|XP_010540270.1| PREDICTED: armadillo repeat-containing protein 3 [Tarenaya hassleriana]
Length=568

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 51/76 (67%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL  AQ L+P AL +A+ VK F GRWK I SK++QIP+ LSDLSSHPCFSKN LC 
Sbjct  27   SAEEWLSLAQSLIPVALAKAKSVKNFQGRWKTISSKIDQIPTCLSDLSSHPCFSKNRLCS  86

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNE +E+
Sbjct  87   EQLQSVAKTLNEVIEL  102



>ref|XP_008800804.1| PREDICTED: protein ARABIDILLO 1-like [Phoenix dactylifera]
 ref|XP_008800805.1| PREDICTED: protein ARABIDILLO 1-like [Phoenix dactylifera]
Length=557

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 62/76 (82%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAE+WL +AQ LVP A ++AR   GF GRWK IVSKLE+IP  LSDL+SHPCF+KNALC+
Sbjct  10   SAEDWLARAQLLVPTAQEKARAATGFSGRWKAIVSKLERIPPCLSDLASHPCFAKNALCR  69

Query  472  EQLQAVLQTLNEAMEM  519
            +QLQ+V  TL EA+++
Sbjct  70   DQLQSVADTLAEAIDL  85



>emb|CDX90063.1| BnaA10g00190D [Brassica napus]
Length=569

 Score =   109 bits (272),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL     L+P  L +A+ V  F GRWK I+SK++QIP  LSDLSSHPCFSKN LC 
Sbjct  28   SAEEWLSHVHSLIPSVLHKAKTVPNFTGRWKTIISKIQQIPGCLSDLSSHPCFSKNKLCN  87

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNEAME+
Sbjct  88   EQLQSVAKTLNEAMEL  103



>ref|XP_002889350.1| hypothetical protein ARALYDRAFT_470092 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65609.1| hypothetical protein ARALYDRAFT_470092 [Arabidopsis lyrata subsp. 
lyrata]
Length=569

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +   L+P  L +A+ VK F GRWK I+SK+EQIP+ LSDLSSHPCFSKN LC 
Sbjct  28   SAEEWLSRVHSLIPSVLSKAKTVKNFAGRWKTIISKIEQIPACLSDLSSHPCFSKNKLCN  87

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TL+E +E+
Sbjct  88   EQLQSVAKTLSEVIEL  103



>ref|XP_010506527.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
 ref|XP_010506528.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
 ref|XP_010506529.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
Length=554

 Score =   108 bits (270),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 65/76 (86%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            + E+ L++AQ+LVP AL +AR VK F  RW++I+S+LE+IP+ LSDLSSHPCFSK+ LCK
Sbjct  16   TVEDLLLQAQELVPVALSKARTVKVFSSRWRVIISRLEKIPTCLSDLSSHPCFSKHTLCK  75

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAVL+TL EA+E+
Sbjct  76   EQLQAVLETLKEAIEL  91



>ref|XP_010474811.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
 ref|XP_010474812.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
 ref|XP_010474813.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
Length=575

 Score =   108 bits (271),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +   L+P  L +A+ V  F GRWK I+SK++QIP+ LSDLSSHPCFSKN LC 
Sbjct  31   SAEEWLSRVHSLIPSVLSKAKTVNNFAGRWKTIISKIDQIPACLSDLSSHPCFSKNKLCN  90

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNE +E+
Sbjct  91   EQLQSVAKTLNEVIEL  106



>emb|CDY18907.1| BnaC04g04430D [Brassica napus]
Length=538

 Score =   108 bits (269),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/77 (65%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            EN +AE+ L +A +LVP AL +A+  KGF  RW++I+S+LE+IP+ LSDLSSHPCFSKN 
Sbjct  4    ENQTAEDLLQQALELVPIALSKAKTAKGFTTRWRVIISRLEKIPTCLSDLSSHPCFSKNT  63

Query  463  LCKEQLQAVLQTLNEAM  513
            LCKEQLQAVLQTL E +
Sbjct  64   LCKEQLQAVLQTLQETI  80



>ref|XP_009119737.1| PREDICTED: uncharacterized protein LOC103844682 [Brassica rapa]
 ref|XP_009119738.1| PREDICTED: uncharacterized protein LOC103844682 [Brassica rapa]
 ref|XP_009119739.1| PREDICTED: uncharacterized protein LOC103844682 [Brassica rapa]
Length=569

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 49/76 (64%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL     L+P  L +A+ V  F GRWK I+SK++QIP  LSDLSSHPCFSKN LCK
Sbjct  28   SAEEWLSHVHSLIPSVLHKAKTVPNFTGRWKTIISKIQQIPGCLSDLSSHPCFSKNKLCK  87

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNEA E+
Sbjct  88   EQLQSVAKTLNEAKEL  103



>ref|XP_010457072.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
 ref|XP_010457073.1| PREDICTED: armadillo repeat-containing protein 3-like [Camelina 
sativa]
Length=574

 Score =   107 bits (268),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAEEWL +   L+P  L  A+ V  F GRWK I+SK++QIP+ LSDLSSHPCFSKN LC 
Sbjct  31   SAEEWLSRVHSLIPSVLSEAKTVNNFAGRWKTIISKIDQIPACLSDLSSHPCFSKNKLCN  90

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TLNE +E+
Sbjct  91   EQLQSVAKTLNEVIEL  106



>ref|XP_010933887.1| PREDICTED: uncharacterized protein LOC105054144 isoform X1 [Elaeis 
guineensis]
Length=646

 Score =   107 bits (268),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/91 (57%), Positives = 65/91 (71%), Gaps = 1/91 (1%)
 Frame = +1

Query  247  EKMGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLS  426
            + MGED  +   +  SA  WL +AQQLVP AL ++R   GFPGRWK IVSKLE++P  LS
Sbjct  88   QSMGED-SEPITDTDSANHWLSRAQQLVPTALDKSRAATGFPGRWKAIVSKLERVPPCLS  146

Query  427  DLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            DLSSH CF+KNALC E LQ+V   L +A+E+
Sbjct  147  DLSSHHCFAKNALCTELLQSVTNALTDALEL  177



>gb|EPS70823.1| hypothetical protein M569_03935 [Genlisea aurea]
Length=560

 Score =   107 bits (267),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/86 (60%), Positives = 65/86 (76%), Gaps = 3/86 (3%)
 Frame = +1

Query  256  GEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLS  435
            GE    NG    S EE+L  A++L+P+AL++A+E+  F  RWKMIVSKLE+IPS LSD S
Sbjct  7    GESPAFNGR---SVEEYLSYARELIPKALEKAKEMSDFALRWKMIVSKLEKIPSSLSDFS  63

Query  436  SHPCFSKNALCKEQLQAVLQTLNEAM  513
            +HPCFSKNALCKEQLQ +  TLNE +
Sbjct  64   THPCFSKNALCKEQLQTICNTLNEVI  89



>ref|XP_010508117.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
 ref|XP_010508118.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
 ref|XP_010508119.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
 ref|XP_010508121.1| PREDICTED: U-box domain-containing protein 15-like [Camelina 
sativa]
Length=554

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 64/76 (84%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            + E+ L++AQ+ VP AL +AR VK F  RW++I+S+LE+IP+ LSDLSSHPCFSK+ LCK
Sbjct  16   TVEDLLLQAQEFVPVALTKARTVKVFSSRWRVIISRLEKIPTCLSDLSSHPCFSKHTLCK  75

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAVL+TL EA+E+
Sbjct  76   EQLQAVLETLKEAIEL  91



>ref|XP_010933888.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like isoform 
X2 [Elaeis guineensis]
Length=557

 Score =   107 bits (266),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/89 (58%), Positives = 64/89 (72%), Gaps = 1/89 (1%)
 Frame = +1

Query  253  MGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDL  432
            MGED  +   +  SA  WL +AQQLVP AL ++R   GFPGRWK IVSKLE++P  LSDL
Sbjct  1    MGED-SEPITDTDSANHWLSRAQQLVPTALDKSRAATGFPGRWKAIVSKLERVPPCLSDL  59

Query  433  SSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SSH CF+KNALC E LQ+V   L +A+E+
Sbjct  60   SSHHCFAKNALCTELLQSVTNALTDALEL  88



>emb|CDX74759.1| BnaA05g05050D [Brassica napus]
Length=541

 Score =   106 bits (265),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            EN + EE L +A +L+P AL +A+  KGF  RW++I+S+LE+IP+ LSDLSSHPCFSKN 
Sbjct  4    ENQTVEELLQQALELIPIALSKAKTAKGFTTRWRVIISRLEKIPTCLSDLSSHPCFSKNT  63

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LC+EQLQAVLQTL E++ +
Sbjct  64   LCREQLQAVLQTLQESIAL  82



>ref|XP_009143163.1| PREDICTED: uncharacterized protein LOC103866916 isoform X2 [Brassica 
rapa]
Length=541

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            EN + E+ L +A +LVP AL +A+  KGF  RW++I+S+LE+IP+ LSDLSSHPCFSKN 
Sbjct  4    ENQTVEDLLQQALELVPIALSKAKTAKGFTTRWRVIISRLEKIPTCLSDLSSHPCFSKNT  63

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LC+EQLQAVLQTL E++ +
Sbjct  64   LCREQLQAVLQTLQESIAL  82



>ref|XP_009143162.1| PREDICTED: uncharacterized protein LOC103866916 isoform X1 [Brassica 
rapa]
Length=557

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/79 (61%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            EN + E+ L +A +LVP AL +A+  KGF  RW++I+S+LE+IP+ LSDLSSHPCFSKN 
Sbjct  20   ENQTVEDLLQQALELVPIALSKAKTAKGFTTRWRVIISRLEKIPTCLSDLSSHPCFSKNT  79

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LC+EQLQAVLQTL E++ +
Sbjct  80   LCREQLQAVLQTLQESIAL  98



>gb|AAF78412.1|AC009273_18 Contains similarity to an unknown protein F17K2.25 gi|7485635 
from Arabidopsis thaliana BAC F17K2 gb|AC004665. It contains 
a flagellar FliJ protein PF|02050 domain. ESTs gb|H76945 and 
gb|AA712775 come from this gene [Arabidopsis thaliana]
Length=571

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL +   L+P  L +A+ VK F GRWK I+SK+EQIP+ LSDLSSHPCFSKN LC 
Sbjct  28   SVEEWLSRVNSLIPSVLSKAKTVKKFTGRWKTIISKIEQIPACLSDLSSHPCFSKNKLCN  87

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TL+E +E+
Sbjct  88   EQLQSVAKTLSEVIEL  103



>ref|NP_563637.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 ref|NP_001077443.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 ref|NP_001077444.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 gb|AAL24151.1| unknown protein [Arabidopsis thaliana]
 gb|AAM14212.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27340.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 gb|AEE27341.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
 gb|AEE27342.1| armadillo/beta-catenin-like repeat-containing protein [Arabidopsis 
thaliana]
Length=574

 Score =   106 bits (264),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S EEWL +   L+P  L +A+ VK F GRWK I+SK+EQIP+ LSDLSSHPCFSKN LC 
Sbjct  31   SVEEWLSRVNSLIPSVLSKAKTVKKFTGRWKTIISKIEQIPACLSDLSSHPCFSKNKLCN  90

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQ+V +TL+E +E+
Sbjct  91   EQLQSVAKTLSEVIEL  106



>ref|XP_008803267.1| PREDICTED: uncharacterized protein LOC103716867 [Phoenix dactylifera]
Length=665

 Score =   105 bits (263),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA  WL +A+QLVP +L +AR   GFPGRWK IVSKLE++P  LSDLSSHPCF+KNALC 
Sbjct  121  SAHHWLSRARQLVPTSLDKARAATGFPGRWKAIVSKLERVPPCLSDLSSHPCFAKNALCI  180

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V   L +A+E+
Sbjct  181  ELLQSVADVLADAVEL  196



>ref|XP_009400038.1| PREDICTED: ARMADILLO BTB ARABIDOPSIS PROTEIN 1-like [Musa acuminata 
subsp. malaccensis]
Length=568

 Score =   105 bits (261),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 61/76 (80%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SAE WL +A+ LVP AL +AR  KGFPGRWK I SKLE++P  LSDLSSHPCF+++ LC+
Sbjct  20   SAEHWLSRARLLVPVALDKARSTKGFPGRWKSIASKLERVPPCLSDLSSHPCFARHPLCR  79

Query  472  EQLQAVLQTLNEAMEM  519
            E +Q+V  TL+EA+E+
Sbjct  80   ELVQSVAATLSEAVEL  95



>ref|XP_009133747.1| PREDICTED: U-box domain-containing protein 9-like [Brassica rapa]
Length=585

 Score =   104 bits (259),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 49/86 (57%), Positives = 64/86 (74%), Gaps = 3/86 (3%)
 Frame = +1

Query  271  KNGGENL---SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSH  441
            K G E L   + E+ L+ A +LVP AL +AR +  F  RW++I+S+LE++P+ LSD SSH
Sbjct  47   KPGNETLVDPTVEDMLLHALELVPIALDKARTITCFSSRWRVIISRLEKVPTCLSDFSSH  106

Query  442  PCFSKNALCKEQLQAVLQTLNEAMEM  519
            PCFSKN LCKEQ+QAVLQTL EA E+
Sbjct  107  PCFSKNTLCKEQIQAVLQTLKEANEL  132



>ref|XP_008795377.1| PREDICTED: ARM REPEAT PROTEIN INTERACTING WITH ABF2-like [Phoenix 
dactylifera]
Length=557

 Score =   103 bits (258),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA  WL +A+QLVP AL ++R   GFPGRWK IVSKLE++P  LSDLSSH CF+KNALC 
Sbjct  13   SANHWLSRARQLVPTALDKSRAATGFPGRWKAIVSKLERVPPCLSDLSSHHCFAKNALCT  72

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V   L +A+E+
Sbjct  73   ELLQSVTNALADALEL  88



>ref|XP_010919224.1| PREDICTED: uncharacterized protein LOC105043395 [Elaeis guineensis]
Length=626

 Score =   103 bits (256),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA  WL +A+QLVP AL +AR   GFP RWK I+SKLE++P  LSDLSSHPCF+KNALC 
Sbjct  82   SAHHWLSRARQLVPTALDKARAATGFPRRWKAIISKLERVPPCLSDLSSHPCFAKNALCI  141

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V   L +A+E+
Sbjct  142  ELLQSVANALADAIEL  157



>ref|XP_009407953.1| PREDICTED: vacuolar protein 8-like [Musa acuminata subsp. malaccensis]
Length=640

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/77 (55%), Positives = 63/77 (82%), Gaps = 0/77 (0%)
 Frame = +1

Query  289  LSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALC  468
            +  E+WL +A+ LVP AL++AR  +GF GRWK I SK+E++P+ LSDLS+HPCF+++ALC
Sbjct  94   MPVEDWLSRARLLVPTALEKARSARGFAGRWKSIASKIERVPTCLSDLSTHPCFARHALC  153

Query  469  KEQLQAVLQTLNEAMEM  519
            +E L++V  TL+EA+E+
Sbjct  154  RELLESVAATLSEAVEL  170



>ref|XP_009391949.1| PREDICTED: U-box domain-containing protein 15 [Musa acuminata 
subsp. malaccensis]
Length=566

 Score =   101 bits (251),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 46/86 (53%), Positives = 64/86 (74%), Gaps = 1/86 (1%)
 Frame = +1

Query  262  DCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSH  441
            D G +G +  SAE WL +   LVP A+++AR  KGF GRWK I  KL+ +P  LSDLSSH
Sbjct  10   DSGDSGTDG-SAEHWLSRTLLLVPIAIEKARSAKGFAGRWKSIADKLQSLPPCLSDLSSH  68

Query  442  PCFSKNALCKEQLQAVLQTLNEAMEM  519
            PCF+++ALC+E LQ+++ TL+EA+E+
Sbjct  69   PCFARHALCRELLQSIVTTLSEAVEL  94



>ref|XP_006857903.1| hypothetical protein AMTR_s00069p00131410 [Amborella trichopoda]
 gb|ERN19370.1| hypothetical protein AMTR_s00069p00131410 [Amborella trichopoda]
Length=565

 Score =   100 bits (250),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/76 (63%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            S E+WL  A++LVP A+K+A  VK F G+WK+I SKLEQ+P  LS LSSHPCF KN+LCK
Sbjct  19   STEDWLRYAEELVPIAIKKATMVKVFLGKWKLISSKLEQVPQCLSSLSSHPCFCKNSLCK  78

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAV  TL EA+++
Sbjct  79   EQLQAVSATLQEAIDL  94



>ref|XP_009400720.1| PREDICTED: vacuolar protein 8-like [Musa acuminata subsp. malaccensis]
Length=558

 Score = 99.8 bits (247),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA + L +A+QLVP AL +AR   GFPGRWK I+SKLE++   LSDLSSHPCF+KN LCK
Sbjct  13   SAGQLLCQARQLVPAALDKARAATGFPGRWKSIISKLERVSPCLSDLSSHPCFAKNELCK  72

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V +T+ EA+ +
Sbjct  73   ELLQSVTKTVAEAIGL  88



>emb|CDY53892.1| BnaA03g56940D [Brassica napus]
Length=527

 Score = 98.6 bits (244),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            + E  L+ A +LVP AL +AR +  F  RW++I+ +LE+IP+ LSD S+HPCFSKN LCK
Sbjct  16   TVEYMLLHALELVPIALDKARTITCFSSRWRVIIPRLEKIPTCLSDFSTHPCFSKNTLCK  75

Query  472  EQLQAVLQTLNEAMEM  519
            EQLQAVLQTL EA E+
Sbjct  76   EQLQAVLQTLKEANEL  91



>ref|XP_009393926.1| PREDICTED: vacuolar protein 8-like [Musa acuminata subsp. malaccensis]
Length=558

 Score = 97.8 bits (242),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA   L +A+QLVP AL +AR   GFP RWK I+SKLE++   LSD SSHPCF+KNALCK
Sbjct  13   SASHLLSQARQLVPTALDKARAAAGFPARWKYIISKLERVSPCLSDFSSHPCFAKNALCK  72

Query  472  EQLQAVLQTLNEAMEM  519
            E L +V  TL EA+E+
Sbjct  73   ELLLSVTNTLVEAIEL  88



>ref|XP_009392351.1| PREDICTED: uncharacterized protein LOC103978317 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009392352.1| PREDICTED: uncharacterized protein LOC103978317 [Musa acuminata 
subsp. malaccensis]
Length=558

 Score = 96.7 bits (239),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 60/76 (79%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA+ WL +A+ L P AL++AR  KGF  RW  IVSKLE++P  LSDLSSHPCF+++ALC+
Sbjct  12   SADHWLSRARLLAPLALEKARSAKGFARRWMSIVSKLERVPPCLSDLSSHPCFARDALCR  71

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V  T++EA+E+
Sbjct  72   ELLQSVAATVSEAVEL  87



>ref|XP_004985979.1| PREDICTED: protein ARABIDILLO 1-like [Setaria italica]
Length=612

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L + Q +VP AL+ AR   GFPGRWK I +KLE +P+ LSDLSSHPCF+KNALC+
Sbjct  68   TAEELLERVQGMVPAALEAARAAGGFPGRWKAIAAKLETLPACLSDLSSHPCFAKNALCR  127

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V  TL EA ++
Sbjct  128  ELLQSVAATLAEAADL  143



>ref|XP_010234927.1| PREDICTED: U-box domain-containing protein 15 isoform X2 [Brachypodium 
distachyon]
 ref|XP_003574221.2| PREDICTED: U-box domain-containing protein 15 isoform X2 [Brachypodium 
distachyon]
Length=552

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  11   TAEELLERARGLVPAALDAARTAAGFGGRWKAIATRLERVPPCLSDLSSHPCFSKNSLCR  70

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V  TL EA E+
Sbjct  71   ELLQSVAATLTEATEL  86



>ref|XP_010234926.1| PREDICTED: vacuolar protein 8 isoform X1 [Brachypodium distachyon]
Length=610

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 46/76 (61%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  69   TAEELLERARGLVPAALDAARTAAGFGGRWKAIATRLERVPPCLSDLSSHPCFSKNSLCR  128

Query  472  EQLQAVLQTLNEAMEM  519
            E LQ+V  TL EA E+
Sbjct  129  ELLQSVAATLTEATEL  144



>tpg|DAA42941.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=625

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 62/94 (66%), Gaps = 0/94 (0%)
 Frame = +1

Query  238  QKSEKMGEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPS  417
            Q+    G D    G E  +AEE L + + +VP A   AR   GFPGRWK I +KL+ +P+
Sbjct  68   QEMSSRGPDPAPPGEEQETAEELLERVRGMVPAAAAAARAAGGFPGRWKAIAAKLDALPA  127

Query  418  KLSDLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
             LSDLSSHPCF++N+LC+E LQ+V  TL +A E+
Sbjct  128  CLSDLSSHPCFARNSLCRELLQSVAATLADAAEL  161



>ref|XP_008650123.1| PREDICTED: protein ARABIDILLO 2-like [Zea mays]
Length=556

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 60/88 (68%), Gaps = 0/88 (0%)
 Frame = +1

Query  256  GEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLS  435
            G D    G E  +AEE L + + +VP A   AR   GFPGRWK I +KL+ +P+ LSDLS
Sbjct  5    GPDPAPPGEEQETAEELLERVRGMVPAAAAAARAAGGFPGRWKAIAAKLDALPACLSDLS  64

Query  436  SHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            SHPCF++N+LC+E LQ+V  TL +A E+
Sbjct  65   SHPCFARNSLCRELLQSVAATLADAAEL  92



>dbj|BAJ95308.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=565

 Score = 87.8 bits (216),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L + + +VP A+  A   +GFPGRWK I +KL  +P++LSDLSSHPCF++NALC+
Sbjct  16   TAEELLARVRGMVPAAVGAATAAEGFPGRWKAIAAKLGALPARLSDLSSHPCFARNALCR  75

Query  472  EQLQAVLQTLNEAMEM  519
            E L +V  TL +A  +
Sbjct  76   ELLHSVAATLADAAGL  91



>gb|ACS92633.1| conserved hypothetical protein [Triticum aestivum]
Length=565

 Score = 86.7 bits (213),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/80 (51%), Positives = 58/80 (73%), Gaps = 1/80 (1%)
 Frame = +1

Query  280  GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKN  459
            GE+ +AEE L + + +V  A+  A   +GFPGRWK I +KL  +P++LSDLSSHPCF++N
Sbjct  14   GED-TAEELLARVRGMVQAAVGAATAAEGFPGRWKAIAAKLGALPARLSDLSSHPCFARN  72

Query  460  ALCKEQLQAVLQTLNEAMEM  519
            ALC+E L +V  TL +A E+
Sbjct  73   ALCRELLHSVAATLADAAEL  92



>ref|XP_002468641.1| hypothetical protein SORBIDRAFT_01g049470 [Sorghum bicolor]
 gb|EER95639.1| hypothetical protein SORBIDRAFT_01g049470 [Sorghum bicolor]
Length=565

 Score = 83.6 bits (205),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 37/69 (54%), Positives = 50/69 (72%), Gaps = 0/69 (0%)
 Frame = +1

Query  313  KAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAVL  492
            + + +VP     AR   GFPGRWK I +KL+ +P+ LSDLSSHPCF++NALC+E LQ+V 
Sbjct  22   RVRGMVPAVAAAARAAGGFPGRWKAIAAKLDTLPACLSDLSSHPCFARNALCRELLQSVA  81

Query  493  QTLNEAMEM  519
             TL +A E+
Sbjct  82   ATLADAAEL  90



>ref|XP_003562185.1| PREDICTED: uncharacterized protein LOC100846680 [Brachypodium 
distachyon]
Length=588

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 55/81 (68%), Gaps = 2/81 (2%)
 Frame = +1

Query  256  GEDCGKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLS  435
            G+ C   G E  +AE+ L +   +VP AL  AR   GFPGRWK I +KL  +P++LSDLS
Sbjct  5    GDPCASAGDE--TAEQLLARVTAMVPAALDAARGAAGFPGRWKAIAAKLGALPARLSDLS  62

Query  436  SHPCFSKNALCKEQLQAVLQT  498
            SHPCF++NALC+E + +V  T
Sbjct  63   SHPCFARNALCRELVLSVAAT  83



>gb|ABB47908.1| Armadillo/beta-catenin-like repeat family protein, expressed 
[Oryza sativa Japonica Group]
 gb|ABG66199.1| Armadillo/beta-catenin-like repeat family protein, expressed 
[Oryza sativa Japonica Group]
Length=560

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK+I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  18   TAEELLERARSLVPAALDAARAATGFGGRWKVIAARLERVPPCLSDLSSHPCFSKNSLCR  77

Query  472  EQLQAV  489
            E LQ+V
Sbjct  78   ELLQSV  83



>gb|AAM92297.1| putative arm repeat containing protein [Oryza sativa Japonica 
Group]
 gb|AAO00697.1| putative armadillo repeat containing protein [Oryza sativa Japonica 
Group]
 gb|AAP54684.1| Armadillo/beta-catenin-like repeat family protein, expressed 
[Oryza sativa Japonica Group]
Length=575

 Score = 83.2 bits (204),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK+I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  33   TAEELLERARSLVPAALDAARAATGFGGRWKVIAARLERVPPCLSDLSSHPCFSKNSLCR  92

Query  472  EQLQAV  489
            E LQ+V
Sbjct  93   ELLQSV  98



>gb|EEE51288.1| hypothetical protein OsJ_32200 [Oryza sativa Japonica Group]
Length=636

 Score = 83.2 bits (204),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 52/66 (79%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK+I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  94   TAEELLERARSLVPAALDAARAATGFGGRWKVIAARLERVPPCLSDLSSHPCFSKNSLCR  153

Query  472  EQLQAV  489
            E LQ+V
Sbjct  154  ELLQSV  159



>dbj|BAK05920.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=560

 Score = 82.4 bits (202),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AE+ L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKNALC+
Sbjct  17   TAEDLLERARGLVPAALDAARAATGFGGRWKAIAARLERVPPCLSDLSSHPCFSKNALCR  76

Query  472  EQLQAV  489
            E LQ+V
Sbjct  77   ELLQSV  82



>gb|EEC67332.1| hypothetical protein OsI_34367 [Oryza sativa Indica Group]
Length=560

 Score = 82.0 bits (201),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+LC+
Sbjct  18   TAEELLERARSLVPAALDAARAATGFGGRWKAIAARLERVPPCLSDLSSHPCFSKNSLCR  77

Query  472  EQLQAV  489
            E LQ+V
Sbjct  78   ELLQSV  83



>dbj|BAJ93526.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=576

 Score = 82.0 bits (201),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AE+ L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKNALC+
Sbjct  33   TAEDLLERARGLVPAALDAARAATGFGGRWKAIAARLERVPPCLSDLSSHPCFSKNALCR  92

Query  472  EQLQAV  489
            E LQ+V
Sbjct  93   ELLQSV  98



>ref|NP_001146217.1| putative ARM repeat-containing protein containing family protein 
isoform 1 [Zea mays]
 ref|XP_008658486.1| PREDICTED: putative ARM repeat-containing protein containing 
family protein isoform 1 isoform X1 [Zea mays]
 gb|ACL53487.1| unknown [Zea mays]
 gb|ACN25545.1| unknown [Zea mays]
 gb|ACN26833.1| unknown [Zea mays]
 gb|AFW89916.1| putative ARM repeat-containing protein containing family protein 
isoform 1 [Zea mays]
 gb|AFW89917.1| putative ARM repeat-containing protein containing family protein 
isoform 2 [Zea mays]
 gb|AFW89918.1| putative ARM repeat-containing protein containing family protein 
isoform 3 [Zea mays]
 gb|AFW89919.1| putative ARM repeat-containing protein containing family protein 
isoform 4 [Zea mays]
Length=554

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNAL  465
            + +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+L
Sbjct  12   DATAEELLQRARGLVPPALAAARAATGFGGRWKAIAARLEKVPPCLSDLSSHPCFSKNSL  71

Query  466  CKEQLQAV  489
            C+E LQ+V
Sbjct  72   CRELLQSV  79



>ref|XP_002467629.1| hypothetical protein SORBIDRAFT_01g031170 [Sorghum bicolor]
 gb|EER94627.1| hypothetical protein SORBIDRAFT_01g031170 [Sorghum bicolor]
Length=557

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNAL  465
            + +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+L
Sbjct  12   DATAEELLERARGLVPPALAAARAATGFGGRWKAIAARLERVPPCLSDLSSHPCFSKNSL  71

Query  466  CKEQLQAV  489
            C+E LQ+V
Sbjct  72   CRELLQSV  79



>gb|AFW89915.1| putative ARM repeat-containing protein containing family protein 
[Zea mays]
Length=607

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNAL  465
            + +AEE L +A+ LVP AL  AR   GF GRWK I ++LE++P  LSDLSSHPCFSKN+L
Sbjct  65   DATAEELLQRARGLVPPALAAARAATGFGGRWKAIAARLEKVPPCLSDLSSHPCFSKNSL  124

Query  466  CKEQLQAV  489
            C+E LQ+V
Sbjct  125  CRELLQSV  132



>ref|NP_001140766.1| putative ARM repeat-containing protein containing family protein 
isoform 1 [Zea mays]
 gb|ACF84581.1| unknown [Zea mays]
 gb|ACN28200.1| unknown [Zea mays]
 gb|ACN28569.1| unknown [Zea mays]
 gb|ACR36322.1| unknown [Zea mays]
 tpg|DAA45998.1| TPA: putative ARM repeat-containing protein containing family 
protein isoform 1 [Zea mays]
 tpg|DAA45999.1| TPA: putative ARM repeat-containing protein containing family 
protein isoform 2 [Zea mays]
 tpg|DAA46000.1| TPA: putative ARM repeat-containing protein containing family 
protein isoform 3 [Zea mays]
 tpg|DAA46001.1| TPA: putative ARM repeat-containing protein containing family 
protein isoform 4 [Zea mays]
Length=557

 Score = 79.0 bits (193),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK I ++L ++P  LSDLSSHPCFSKN+LC+
Sbjct  14   TAEELLERARGLVPPALAAARAATGFGGRWKAIAARLGRLPQCLSDLSSHPCFSKNSLCR  73

Query  472  EQLQAV  489
            E LQ+V
Sbjct  74   ELLQSV  79



>gb|ACG29266.1| armadillo-repeat containing protein [Zea mays]
Length=557

 Score = 79.0 bits (193),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 50/66 (76%), Gaps = 0/66 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AEE L +A+ LVP AL  AR   GF GRWK I ++L ++P  LSDLSSHPCFSKN+LC+
Sbjct  14   TAEELLERARGLVPPALAAARAATGFGGRWKAIAARLGRLPQCLSDLSSHPCFSKNSLCR  73

Query  472  EQLQAV  489
            E LQ+V
Sbjct  74   ELLQSV  79



>ref|XP_004983876.1| PREDICTED: U-box domain-containing protein 15-like isoform X2 
[Setaria italica]
 ref|XP_004983877.1| PREDICTED: U-box domain-containing protein 15-like isoform X3 
[Setaria italica]
Length=557

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNAL  465
            + +AEE L +A+ LVP AL  AR   GF GRWK I  +LE++   LSDLSSHPCFSKNAL
Sbjct  12   DATAEELLERARGLVPPALAAARAATGFGGRWKAIAVRLERVTPCLSDLSSHPCFSKNAL  71

Query  466  CKEQLQAV  489
            C+E LQ+V
Sbjct  72   CRELLQSV  79



>ref|XP_004983875.1| PREDICTED: U-box domain-containing protein 15-like isoform X1 
[Setaria italica]
Length=621

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 50/68 (74%), Gaps = 0/68 (0%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNAL  465
            + +AEE L +A+ LVP AL  AR   GF GRWK I  +LE++   LSDLSSHPCFSKNAL
Sbjct  76   DATAEELLERARGLVPPALAAARAATGFGGRWKAIAVRLERVTPCLSDLSSHPCFSKNAL  135

Query  466  CKEQLQAV  489
            C+E LQ+V
Sbjct  136  CRELLQSV  143



>tpg|DAA40828.1| TPA: putative ARM repeat-containing protein containing family 
protein [Zea mays]
Length=326

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/71 (51%), Positives = 49/71 (69%), Gaps = 6/71 (8%)
 Frame = +1

Query  271  KNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCF  450
            ++GG   +AEE L   +  VP A   AR    F GRWK I +KL+++P+ LSDLSSHPCF
Sbjct  101  RDGG---AAEELLELVRGTVPVA---ARTAGRFSGRWKAITAKLDKLPACLSDLSSHPCF  154

Query  451  SKNALCKEQLQ  483
            ++N+LC+E LQ
Sbjct  155  ARNSLCRELLQ  165



>ref|XP_001772489.1| predicted protein [Physcomitrella patens]
 gb|EDQ62771.1| predicted protein [Physcomitrella patens]
Length=582

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +1

Query  268  GKNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPC  447
            G + G+  S E WL +AQ L   A+  A  VK F GRWK I ++L Q+P+ L+++S   C
Sbjct  19   GVHHGDWNSGEAWLRQAQHLTSLAVTDAALVKAFLGRWKAIENRLLQLPALLTEMSHLHC  78

Query  448  FSKNALCKEQLQAVLQTLNEA  510
             S NA+CKE L+ +++TL EA
Sbjct  79   LSDNAVCKEVLKTIIETLEEA  99



>ref|XP_006649275.1| PREDICTED: vacuolar protein 8-like [Oryza brachyantha]
Length=560

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/79 (54%), Positives = 56/79 (71%), Gaps = 0/79 (0%)
 Frame = +1

Query  283  ENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNA  462
            E  + +E L + + +VP AL  A   +GFPGRWK I SKLE++P+ LSDLSSHPCF+KNA
Sbjct  14   EGETVDELLARVRGMVPPALGAAGAAEGFPGRWKAIASKLEKLPTCLSDLSSHPCFAKNA  73

Query  463  LCKEQLQAVLQTLNEAMEM  519
            LC+E LQ+V   L E  E+
Sbjct  74   LCRELLQSVAAMLAEVAEL  92



>ref|XP_002966534.1| hypothetical protein SELMODRAFT_439556 [Selaginella moellendorffii]
 gb|EFJ32561.1| hypothetical protein SELMODRAFT_439556 [Selaginella moellendorffii]
Length=575

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = +1

Query  271  KNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCF  450
            + GGE L     L +AQ LV + +  +  VK F  RWKMI+S+LE++P  L++L   P F
Sbjct  14   RGGGEGL-----LEQAQSLVAQIVAASSSVKAFLVRWKMIISRLERLPDLLTELGGAPFF  68

Query  451  SKNALCKEQLQAVLQTLNEAMEM  519
            +KN LC E L++++ +L E +E+
Sbjct  69   AKNTLCLELLESLVASLGEGLEL  91



>ref|XP_001768690.1| predicted protein [Physcomitrella patens]
 gb|EDQ66422.1| predicted protein [Physcomitrella patens]
Length=582

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +1

Query  280  GENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKN  459
            G+  + E WL +AQ L   A+  A  VK F GRWK I ++L Q+P+ L+++S   C S N
Sbjct  23   GDMNTTEAWLRQAQHLTSLAVTDAASVKAFLGRWKSIENRLLQLPALLTEMSHLHCLSDN  82

Query  460  ALCKEQLQAVLQTLNEAMEM  519
            A+CKE L+A+ +TL EA  +
Sbjct  83   AVCKELLKAMSETLEEARNL  102



>ref|XP_002982376.1| hypothetical protein SELMODRAFT_421713 [Selaginella moellendorffii]
 gb|EFJ16621.1| hypothetical protein SELMODRAFT_421713 [Selaginella moellendorffii]
Length=576

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 53/83 (64%), Gaps = 5/83 (6%)
 Frame = +1

Query  271  KNGGENLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCF  450
            + GGE L     L +AQ LV + +  +  VK F  RWKMI+S+LE++P  L++L   P F
Sbjct  14   RGGGEGL-----LEQAQSLVAQIVAASSSVKAFLVRWKMIISRLERLPDLLTELGGAPFF  68

Query  451  SKNALCKEQLQAVLQTLNEAMEM  519
            +KN LC E L++++ +L E +E+
Sbjct  69   AKNTLCLELLESLVASLGEGLEL  91



>gb|ABF93658.1| Armadillo/beta-catenin-like repeat family protein [Oryza sativa 
Japonica Group]
 gb|EAZ25363.1| hypothetical protein OsJ_09179 [Oryza sativa Japonica Group]
 dbj|BAH00574.1| unnamed protein product [Oryza sativa Japonica Group]
Length=535

 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  RWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAV  489
            RWK I +KLE +P+ LSDLSSHPCF+KNALC+E LQ+V
Sbjct  18   RWKAIAAKLEGLPACLSDLSSHPCFAKNALCRELLQSV  55



>ref|NP_001048764.1| Os03g0116900 [Oryza sativa Japonica Group]
 dbj|BAF10678.1| Os03g0116900 [Oryza sativa Japonica Group]
Length=563

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  RWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAV  489
            RWK I +KLE +P+ LSDLSSHPCF+KNALC+E LQ+V
Sbjct  46   RWKAIAAKLEGLPACLSDLSSHPCFAKNALCRELLQSV  83



>gb|EAY88286.1| hypothetical protein OsI_09742 [Oryza sativa Indica Group]
Length=563

 Score = 64.3 bits (155),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 27/38 (71%), Positives = 33/38 (87%), Gaps = 0/38 (0%)
 Frame = +1

Query  376  RWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAV  489
            RWK I +KLE +P+ LSDLSSHPCF+KNALC+E LQ+V
Sbjct  46   RWKAIAAKLEGLPACLSDLSSHPCFAKNALCRELLQSV  83



>ref|XP_006844544.1| hypothetical protein AMTR_s00016p00174170 [Amborella trichopoda]
 gb|ERN06219.1| hypothetical protein AMTR_s00016p00174170 [Amborella trichopoda]
Length=554

 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 27/55 (49%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = +1

Query  355  EVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAVLQTLNEAMEM  519
            +V+ F G+W ++ +KL+Q+PS ++DLS  P FS N LC E LQ+V QTL  A+E+
Sbjct  28   QVQSFKGKWGVVKTKLDQLPSLITDLSEFPSFSSNLLCSELLQSVSQTLTLALEL  82



>ref|XP_001756212.1| predicted protein [Physcomitrella patens]
 gb|EDQ79078.1| predicted protein [Physcomitrella patens]
Length=603

 Score = 58.9 bits (141),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 31/76 (41%), Positives = 45/76 (59%), Gaps = 0/76 (0%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            SA+    +AQQL       A  VK F GRWK I ++L Q+ + L+++S   C S NA CK
Sbjct  30   SAQSMFQEAQQLASLVTANAASVKAFLGRWKAIENRLLQLRALLTEMSHLRCLSDNAACK  89

Query  472  EQLQAVLQTLNEAMEM  519
            E L+ +++TL EA  +
Sbjct  90   ELLKTMIETLGEARSL  105



>ref|XP_001758043.1| predicted protein [Physcomitrella patens]
 gb|EDQ77285.1| predicted protein [Physcomitrella patens]
Length=602

 Score = 56.6 bits (135),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/88 (36%), Positives = 47/88 (53%), Gaps = 13/88 (15%)
 Frame = +1

Query  292  SAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCK  471
            +AE W  +A +L    L  A  VK F GRWK I ++L Q+P+  +++S   C S+NA CK
Sbjct  30   TAEVWCQEALRLTSAVLTDAASVKAFLGRWKAIENRLSQLPALFTEMSHLHCLSENAACK  89

Query  472  EQLQA-------------VLQTLNEAME  516
            + L+              V+QTL E +E
Sbjct  90   KLLKTNTSARAVPDSRRNVVQTLTETLE  117



>ref|XP_002966572.1| hypothetical protein SELMODRAFT_407593 [Selaginella moellendorffii]
 gb|EFJ32599.1| hypothetical protein SELMODRAFT_407593 [Selaginella moellendorffii]
Length=437

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPC--FSKN  459
            ++SA E L  AQQ +  AL  A  VK F GRW++I  +LE++ S+L D+S  P       
Sbjct  3    SISARELLEVAQQRIAAALDEASSVKTFLGRWRIIQFRLEKLGSQLHDMSKCPLLFLESY  62

Query  460  ALCKEQLQAVLQTLNEA  510
            +LC E L++++ T+ +A
Sbjct  63   SLCTEVLESMVATIEDA  79



>ref|XP_002982410.1| hypothetical protein SELMODRAFT_421767 [Selaginella moellendorffii]
 gb|EFJ16655.1| hypothetical protein SELMODRAFT_421767 [Selaginella moellendorffii]
Length=607

 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 30/77 (39%), Positives = 47/77 (61%), Gaps = 2/77 (3%)
 Frame = +1

Query  286  NLSAEEWLVKAQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPC--FSKN  459
            ++SA E L  AQQ +  AL  A  VK F GRW++I  +LE++ S+L D+S  P       
Sbjct  176  SISARELLEVAQQRIAAALDEASSVKTFLGRWRIIQFRLEKLGSQLHDMSKCPLLFLESY  235

Query  460  ALCKEQLQAVLQTLNEA  510
            +LC E L++++ T+ +A
Sbjct  236  SLCTEVLESMVATIEDA  252



>ref|XP_010250571.1| PREDICTED: vacuolar protein 8 [Nelumbo nucifera]
Length=555

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/68 (34%), Positives = 41/68 (60%), Gaps = 0/68 (0%)
 Frame = +1

Query  316  AQQLVPEALKRAREVKGFPGRWKMIVSKLEQIPSKLSDLSSHPCFSKNALCKEQLQAVLQ  495
            + QL+   ++    ++ F G+W +I +KLE +P++L DLS  P F  N L  + +Q+V Q
Sbjct  12   STQLISSLMQEIPHIQIFRGKWSIIRNKLENLPTQLKDLSDFPNFYSNPLSLDLVQSVSQ  71

Query  496  TLNEAMEM  519
            TL + + +
Sbjct  72   TLTDTLAL  79



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 566636427000