BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C11

Length=581
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002283440.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     187   1e-52   Vitis vinifera
ref|XP_010277273.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    179   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_006345989.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    178   3e-49   Solanum tuberosum [potatoes]
ref|XP_004239653.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     176   2e-48   Solanum lycopersicum
ref|XP_011075752.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     175   4e-48   Sesamum indicum [beniseed]
ref|XP_009598884.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    174   1e-47   Nicotiana tomentosiformis
gb|EYU29160.1|  hypothetical protein MIMGU_mgv1a004174mg                174   1e-47   Erythranthe guttata [common monkey flower]
ref|XP_006838452.1|  hypothetical protein AMTR_s00002p00135040          164   5e-47   
ref|XP_009791268.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    172   9e-47   Nicotiana sylvestris
ref|XP_004136326.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    165   2e-44   Cucumis sativus [cucumbers]
ref|XP_004162485.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    165   2e-44   
ref|XP_007222302.1|  hypothetical protein PRUPE_ppa003911mg             165   2e-44   Prunus persica
ref|XP_008466345.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     165   3e-44   Cucumis melo [Oriental melon]
ref|XP_006850989.1|  hypothetical protein AMTR_s00025p00212870          164   4e-44   Amborella trichopoda
ref|XP_002308157.2|  aspartyl-tRNA synthetase family protein            161   6e-43   Populus trichocarpa [western balsam poplar]
ref|XP_006381194.1|  hypothetical protein POPTR_0006s08550g             161   8e-43   
ref|XP_008393995.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    159   1e-42   
ref|XP_008393994.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    159   1e-42   
gb|EPS57914.1|  hypothetical protein M569_16902                         160   2e-42   Genlisea aurea
ref|XP_011019869.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     159   3e-42   Populus euphratica
ref|XP_008352039.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    159   4e-42   
ref|XP_008378275.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    158   9e-42   
ref|XP_008347712.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    158   1e-41   
ref|XP_009377365.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    157   1e-41   Pyrus x bretschneideri [bai li]
gb|ABX46068.1|  aspartyl transcarbamylase                               150   2e-41   Atalantia ceylanica
ref|XP_002523450.1|  aspartyl-tRNA synthetase, putative                 157   2e-41   Ricinus communis
gb|ABX46071.1|  aspartyl transcarbamylase                               150   2e-41   Citrus medica [Buddha's hand]
gb|ABX46076.1|  aspartyl transcarbamylase                               150   3e-41   Citrus webberi
ref|XP_010095486.1|  Aspartate--tRNA ligase                             155   9e-41   Morus notabilis
gb|ABX46087.1|  aspartyl transcarbamylase                               148   1e-40   Citrus amblycarpa [djerook leemo]
gb|ABK25168.1|  unknown                                                 155   1e-40   Picea sitchensis
gb|ABX46070.1|  aspartyl transcarbamylase                               147   2e-40   Citrus medica [Buddha's hand]
gb|ABX46085.1|  aspartyl transcarbamylase                               147   2e-40   Citrus limon [lemon]
ref|XP_010672510.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    154   2e-40   Beta vulgaris subsp. vulgaris [field beet]
gb|ABX46081.1|  aspartyl transcarbamylase                               147   2e-40   Citrus limettioides [sweet lime]
gb|ABX46119.1|  aspartyl transcarbamylase                               147   5e-40   Citrus australasica [Australian finger-lime]
gb|ABX46077.1|  aspartyl transcarbamylase                               146   5e-40   Citrus longispina [canniisan]
gb|ABX46084.1|  aspartyl transcarbamylase                               146   6e-40   Citrus unshiu [satsuma mandarin]
gb|ABX46113.1|  aspartyl transcarbamylase                               146   6e-40   Citrus trifoliata [hardy orange]
gb|ABX46114.1|  aspartyl transcarbamylase                               146   8e-40   Citrus trifoliata [hardy orange]
ref|XP_004303438.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     152   9e-40   Fragaria vesca subsp. vesca
gb|ABX46093.1|  aspartyl transcarbamylase                               146   9e-40   Citrus nippokoreana [mandarinier]
gb|ABX46088.1|  aspartyl transcarbamylase                               146   1e-39   Citrus amblycarpa [djerook leemo]
gb|ABX46069.1|  aspartyl transcarbamylase                               145   1e-39   Swinglea glutinosa [tabog]
ref|XP_008219827.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     152   1e-39   Prunus mume [ume]
gb|ABX46072.1|  aspartyl transcarbamylase                               145   2e-39   Citrus medica [Buddha's hand]
gb|ABX46082.1|  aspartyl transcarbamylase                               145   3e-39   Citrus limettioides [sweet lime]
gb|ABX46117.1|  aspartyl transcarbamylase                               145   3e-39   Citrus japonica var. margarita [nagami kumquat]
gb|ABX46104.1|  aspartyl transcarbamylase                               144   3e-39   Citrus nobilis [King of Siam]
gb|ABX46083.1|  aspartyl transcarbamylase                               144   5e-39   Citrus unshiu [satsuma mandarin]
gb|ABX46086.1|  aspartyl transcarbamylase                               144   5e-39   Citrus limon [lemon]
gb|ABX46118.1|  aspartyl transcarbamylase                               143   1e-38   Citrus japonica var. margarita [nagami kumquat]
gb|ABX46098.1|  aspartyl transcarbamylase                               142   2e-38   Citrus aurantium [bitter orange]
gb|ABX46107.1|  aspartyl transcarbamylase                               142   2e-38   Citrus maxima [buntan]
gb|ABX46103.1|  aspartyl transcarbamylase                               142   2e-38   Citrus nobilis [King of Siam]
gb|KDO36985.1|  hypothetical protein CISIN_1g013856mg                   147   3e-38   Citrus sinensis [apfelsine]
ref|XP_008801441.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    148   4e-38   Phoenix dactylifera
gb|ABX46099.1|  aspartyl transcarbamylase                               141   6e-38   Citrus aurantium [bitter orange]
gb|KCW48297.1|  hypothetical protein EUGRSUZ_K02027                     145   6e-38   Eucalyptus grandis [rose gum]
ref|XP_008809075.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    147   8e-38   
gb|ABX46100.1|  aspartyl transcarbamylase                               139   3e-37   Citrus aurantium [bitter orange]
gb|KDO46759.1|  hypothetical protein CISIN_1g008808mg                   144   5e-37   Citrus sinensis [apfelsine]
ref|XP_010036668.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    144   5e-37   Eucalyptus grandis [rose gum]
ref|XP_009390472.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    144   6e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|KDP45577.1|  hypothetical protein JCGZ_17184                         144   9e-37   Jatropha curcas
ref|XP_010929419.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     144   1e-36   Elaeis guineensis
ref|XP_006422161.1|  hypothetical protein CICLE_v10004669mg             143   2e-36   Citrus clementina [clementine]
ref|XP_003550250.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    142   3e-36   Glycine max [soybeans]
ref|XP_003588866.1|  Aspartyl-tRNA synthetase                           142   4e-36   Medicago truncatula
gb|KCW82584.1|  hypothetical protein EUGRSUZ_C03981                     140   6e-36   Eucalyptus grandis [rose gum]
ref|XP_010927161.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    141   7e-36   Elaeis guineensis
ref|XP_004512467.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    140   1e-35   Cicer arietinum [garbanzo]
ref|XP_004498802.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    140   2e-35   Cicer arietinum [garbanzo]
ref|XP_010049784.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...    139   3e-35   
ref|XP_003544559.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    139   6e-35   Glycine max [soybeans]
gb|ABX46079.1|  aspartyl transcarbamylase                               133   1e-34   Citrus aurantiifolia [lime]
ref|XP_007160941.1|  hypothetical protein PHAVU_001G030000g             137   2e-34   Phaseolus vulgaris [French bean]
dbj|BAJ99106.1|  predicted protein                                      137   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABX46080.1|  aspartyl transcarbamylase                               131   4e-34   Citrus aurantiifolia [lime]
gb|ABX46106.1|  aspartyl transcarbamylase                               130   1e-33   Citrus maxima [buntan]
ref|XP_004967463.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    135   1e-33   Setaria italica
gb|ACG48784.1|  hypothetical protein                                    130   2e-33   Zea mays [maize]
gb|ACN28001.1|  unknown                                                 133   6e-33   Zea mays [maize]
ref|NP_001149817.1|  LOC100283444                                       133   6e-33   
gb|EMT03438.1|  Aspartyl-tRNA synthetase, cytoplasmic                   133   8e-33   
gb|ABX46105.1|  aspartyl transcarbamylase                               128   8e-33   Citrus maxima [buntan]
gb|EYU29913.1|  hypothetical protein MIMGU_mgv1a018492mg                132   8e-33   Erythranthe guttata [common monkey flower]
ref|XP_010238758.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    133   9e-33   Brachypodium distachyon [annual false brome]
ref|XP_007011471.1|  Class II aminoacyl-tRNA and biotin synthetas...    132   9e-33   
ref|XP_007011472.1|  Class II aminoacyl-tRNA and biotin synthetas...    132   9e-33   
ref|XP_006657639.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    132   1e-32   Oryza brachyantha
ref|XP_007011470.1|  Class II aminoacyl-tRNA and biotin synthetas...    132   1e-32   
gb|EYU28247.1|  hypothetical protein MIMGU_mgv1a004064mg                131   2e-32   Erythranthe guttata [common monkey flower]
ref|XP_003578963.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    131   3e-32   Brachypodium distachyon [annual false brome]
ref|NP_001145746.1|  hypothetical protein                               129   1e-31   Zea mays [maize]
ref|NP_001047770.1|  Os02g0686400                                       127   7e-31   
gb|EEC73805.1|  hypothetical protein OsI_08509                          127   1e-30   Oryza sativa Indica Group [Indian rice]
gb|KHG15734.1|  Aspartate--tRNA ligase, cytoplasmic                     125   2e-30   Gossypium arboreum [tree cotton]
gb|KJB06560.1|  hypothetical protein B456_001G001300                    123   1e-29   Gossypium raimondii
gb|KJB06559.1|  hypothetical protein B456_001G001300                    122   3e-29   Gossypium raimondii
gb|KJB06558.1|  hypothetical protein B456_001G001300                    122   4e-29   Gossypium raimondii
ref|XP_006660416.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    122   7e-29   Oryza brachyantha
gb|EYU31296.1|  hypothetical protein MIMGU_mgv1a019826mg                122   1e-28   Erythranthe guttata [common monkey flower]
gb|KDO36984.1|  hypothetical protein CISIN_1g013856mg                   115   8e-27   Citrus sinensis [apfelsine]
ref|XP_003575513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    115   2e-26   
gb|KCW78843.1|  hypothetical protein EUGRSUZ_C00281                     113   5e-26   Eucalyptus grandis [rose gum]
ref|XP_002983062.1|  hypothetical protein SELMODRAFT_117697             110   1e-24   
ref|XP_002965575.1|  hypothetical protein SELMODRAFT_84215              109   1e-24   
ref|XP_010526284.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic     109   3e-24   Tarenaya hassleriana [spider flower]
gb|KFK29697.1|  hypothetical protein AALP_AA7G167100                    101   2e-21   Arabis alpina [alpine rockcress]
ref|XP_001420524.1|  predicted protein                                99.8    6e-21   Ostreococcus lucimarinus CCE9901
ref|XP_010438070.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...    100   6e-21   Camelina sativa [gold-of-pleasure]
ref|XP_007041300.1|  Class II aminoacyl-tRNA and biotin synthetas...  99.0    7e-21   
ref|XP_010432896.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  99.8    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_010447608.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  99.8    9e-21   Camelina sativa [gold-of-pleasure]
ref|NP_849558.1|  Asx tRNA synthetase (AspRS/AsnRS) class II core...  99.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001695300.1|  aspartyl-tRNA synthetase                         99.0    1e-20   Chlamydomonas reinhardtii
ref|XP_009127185.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   98.6    2e-20   Brassica rapa
emb|CDY28248.1|  BnaA01g06010D                                        98.6    2e-20   Brassica napus [oilseed rape]
emb|CDX68726.1|  BnaC01g07270D                                        98.2    3e-20   
ref|XP_006412619.1|  hypothetical protein EUTSA_v100249450mg          94.7    5e-20   
ref|XP_002945972.1|  hypothetical protein VOLCADRAFT_72624            96.7    1e-19   Volvox carteri f. nagariensis
ref|XP_006848204.1|  hypothetical protein AMTR_s00029p00241780        96.3    2e-19   
ref|XP_002876233.1|  predicted protein                                95.5    2e-19   
ref|XP_002869341.1|  hypothetical protein ARALYDRAFT_491623           93.2    1e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006290941.1|  hypothetical protein CARUB_v10017054mg           92.8    2e-18   Capsella rubella
ref|XP_005648554.1|  aspartyl-tRNA synthetase                         92.4    2e-18   Coccomyxa subellipsoidea C-169
ref|XP_001778245.1|  predicted protein                                92.4    3e-18   
ref|XP_010431338.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  90.9    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_007318189.1|  hypothetical protein SERLADRAFT_448942           91.3    8e-18   Serpula lacrymans var. lacrymans S7.9
ref|XP_006283471.1|  hypothetical protein CARUB_v10004519mg           91.3    8e-18   Capsella rubella
ref|XP_009137996.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  90.5    1e-17   Brassica rapa
ref|XP_010436322.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  90.5    2e-17   Camelina sativa [gold-of-pleasure]
emb|CDX72297.1|  BnaC07g43190D                                        89.7    3e-17   
emb|CAN80409.1|  hypothetical protein VITISV_018932                   84.7    3e-17   Vitis vinifera
gb|KDD74520.1|  hypothetical protein H632_c1258p0                     87.0    4e-17   Helicosporidium sp. ATCC 50920
ref|XP_006830131.1|  hypothetical protein AMTR_s04335p00004830        83.6    4e-17   
ref|XP_006409458.1|  hypothetical protein EUTSA_v10023019mg           88.6    5e-17   
gb|KIJ21698.1|  hypothetical protein PAXINDRAFT_5844                  88.6    5e-17   Paxillus involutus ATCC 200175
emb|CAB36533.1|  putative aspartate-tRNA ligase                       88.6    5e-17   Arabidopsis thaliana [mouse-ear cress]
emb|CCO30608.1|  aspartyl-tRNA synthetase                             86.7    6e-17   Rhizoctonia solani AG-1 IB
ref|NP_194417.2|  Asx tRNA synthetase (AspRS/AsnRS) class II core...  88.6    6e-17   Arabidopsis thaliana [mouse-ear cress]
gb|KIK94908.1|  hypothetical protein PAXRUDRAFT_827519                88.2    7e-17   Paxillus rubicundulus Ve08.2h10
ref|XP_003612738.1|  Aspartyl-tRNA synthetase                         88.2    1e-16   
gb|KIJ68384.1|  hypothetical protein HYDPIDRAFT_165245                87.8    1e-16   Hydnomerulius pinastri MD-312
gb|KDN48094.1|  hypothetical protein RSAG8_03110                      86.7    1e-16   Rhizoctonia solani AG-8 WAC10335
gb|EUC67461.1|  aspartate-tRNA ligase                                 87.4    1e-16   Rhizoctonia solani AG-3 Rhs1AP
gb|KEP55699.1|  aspartate-tRNA ligase                                 87.4    2e-16   Rhizoctonia solani 123E
gb|KIM67275.1|  hypothetical protein SCLCIDRAFT_1210786               87.0    2e-16   Scleroderma citrinum Foug A
gb|KDE09023.1|  hypothetical protein MVLG_00744                       87.4    2e-16   Microbotryum lychnidis-dioicae p1A1 Lamole
ref|XP_003082076.1|  OJ1717_A09.34 gene product (ISS)                 86.7    3e-16   Ostreococcus tauri
emb|CEL59367.1|  aspartyl-tRNA synthetase                             86.3    3e-16   Rhizoctonia solani AG-1 IB
gb|KDP23766.1|  hypothetical protein JCGZ_23599                       79.7    6e-16   Jatropha curcas
ref|XP_002868911.1|  hypothetical protein ARALYDRAFT_490730           85.5    6e-16   
ref|XP_006401257.1|  hypothetical protein EUTSA_v10015942mg           85.9    7e-16   Eutrema salsugineum [saltwater cress]
ref|XP_009541188.1|  hypothetical protein HETIRDRAFT_437829           85.1    9e-16   Heterobasidion irregulare TC 32-1
gb|KHN37081.1|  Aspartate--tRNA ligase, cytoplasmic                   84.0    1e-15   Glycine soja [wild soybean]
ref|XP_004951929.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  83.6    3e-15   Setaria italica
gb|KDQ63697.1|  hypothetical protein JAAARDRAFT_29717                 83.6    4e-15   Jaapia argillacea MUCL 33604
ref|XP_007763373.1|  aspartyl-tRNA synthetase                         83.6    4e-15   Coniophora puteana RWD-64-598 SS2
ref|XP_001634294.1|  predicted protein                                82.4    6e-15   Nematostella vectensis
gb|KIO08227.1|  hypothetical protein M404DRAFT_342755                 82.4    8e-15   Pisolithus tinctorius Marx 270
ref|XP_002477243.1|  predicted protein                                79.0    8e-15   
gb|KFK40259.1|  hypothetical protein AALP_AA3G351000                  82.4    8e-15   Arabis alpina [alpine rockcress]
gb|KIP12007.1|  hypothetical protein PHLGIDRAFT_27619                 82.0    1e-14   Phlebiopsis gigantea 11061_1 CR5-6
gb|EPZ32107.1|  Aminoacyl-tRNA synthetase, class II (D/K/N)-like ...  82.0    1e-14   Rozella allomycis CSF55
gb|KDQ30746.1|  hypothetical protein PLEOSDRAFT_1092280               82.0    1e-14   Pleurotus ostreatus PC15
ref|XP_009055134.1|  hypothetical protein LOTGIDRAFT_118845           81.6    1e-14   Lottia gigantea
gb|KIK43564.1|  hypothetical protein CY34DRAFT_81604                  81.6    1e-14   Suillus luteus UH-Slu-Lm8-n1
ref|XP_008033065.1|  aspartate-tRNA ligase                            81.6    2e-14   Trametes versicolor FP-101664 SS1
emb|CDO75263.1|  hypothetical protein BN946_scf184967.g16             81.3    2e-14   Trametes cinnabarina
emb|CCM01942.1|  predicted protein                                    80.5    4e-14   Fibroporia radiculosa
ref|XP_006283432.1|  hypothetical protein CARUB_v10004480mg           80.5    4e-14   
gb|EEC72451.1|  hypothetical protein OsI_05793                        79.7    5e-14   Oryza sativa Indica Group [Indian rice]
dbj|BAD10253.1|  putative Aspartyl-tRNA synthetase                    79.7    5e-14   Oryza sativa Japonica Group [Japonica rice]
gb|KHN15295.1|  Aspartate--tRNA ligase, cytoplasmic                   79.3    5e-14   Glycine soja [wild soybean]
ref|XP_005286826.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  79.0    1e-13   Chrysemys picta bellii
gb|KIL70777.1|  hypothetical protein M378DRAFT_175161                 79.0    1e-13   Amanita muscaria Koide BX008
ref|XP_007060951.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   78.6    1e-13   
gb|KFM63678.1|  Aspartate--tRNA ligase, cytoplasmic                   78.2    2e-13   Stegodyphus mimosarum
gb|KJA29186.1|  hypothetical protein HYPSUDRAFT_32562                 78.2    2e-13   Hypholoma sublateritium FD-334 SS-4
ref|XP_007417129.1|  hypothetical protein MELLADRAFT_40205            78.2    2e-13   Melampsora larici-populina 98AG31
gb|KHN87168.1|  Aspartate--tRNA ligase, cytoplasmic                   78.2    2e-13   Toxocara canis
ref|XP_003384922.2|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  77.8    2e-13   Amphimedon queenslandica
ref|XP_011122417.1|  hypothetical protein AOL_s00079g240              77.8    3e-13   Arthrobotrys oligospora ATCC 24927
ref|XP_002388830.1|  hypothetical protein MPER_12111                  75.1    3e-13   
gb|EPT04273.1|  hypothetical protein FOMPIDRAFT_1014148               77.8    3e-13   Fomitopsis pinicola FP-58527 SS1
ref|XP_002155876.2|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  78.2    3e-13   
ref|XP_002286873.1|  aspartate-trna ligase                            77.4    3e-13   Thalassiosira pseudonana CCMP1335
emb|CDY06845.1|  BnaC01g09440D                                        77.4    3e-13   
emb|CDO77176.1|  hypothetical protein BN946_scf184675.g8              78.2    3e-13   Trametes cinnabarina
ref|XP_007378606.1|  aspartate-tRNA ligase                            77.4    3e-13   Punctularia strigosozonata HHB-11173 SS5
gb|KDQ55235.1|  hypothetical protein JAAARDRAFT_37783                 77.4    4e-13   Jaapia argillacea MUCL 33604
gb|KIK28495.1|  hypothetical protein PISMIDRAFT_90979                 77.4    4e-13   Pisolithus microcarpus 441
ref|XP_006956313.1|  aspartyl-tRNA synthetase                         77.0    5e-13   Wallemia mellicola CBS 633.66
emb|CDW89692.1|  aspartyl-trna synthetase                             77.0    6e-13   Stylonychia lemnae
ref|XP_006117110.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   76.6    6e-13   Pelodiscus sinensis [Chinese softshell turtle]
ref|NP_984057.1|  ADL039Cp                                            76.6    6e-13   Eremothecium gossypii ATCC 10895
gb|EMD32133.1|  hypothetical protein CERSUDRAFT_144292                77.4    7e-13   Gelatoporia subvermispora B
ref|NP_588352.1|  cytoplasmic aspartate-tRNA ligase Drs1 (predicted)  76.6    7e-13   Schizosaccharomyces pombe
gb|KFP01245.1|  Aspartate--tRNA ligase, cytoplasmic                   76.3    7e-13   Calypte anna
ref|XP_003400609.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...  76.3    8e-13   
ref|XP_003400610.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...  76.3    8e-13   
ref|XP_002423869.1|  aspartyl-tRNA synthetase, putative               76.3    9e-13   Pediculus humanus corporis [human body lice]
ref|XP_002185644.1|  predicted protein                                76.3    1e-12   Phaeodactylum tricornutum CCAP 1055/1
ref|XP_007359937.1|  aspartate-tRNA ligase                            76.3    1e-12   Dichomitus squalens LYAD-421 SS1
ref|XP_011109344.1|  hypothetical protein H072_3369                   76.3    1e-12   
gb|EMD41820.1|  hypothetical protein CERSUDRAFT_110384                76.3    1e-12   Gelatoporia subvermispora B
ref|XP_001011634.1|  tRNA synthetases class II                        75.9    1e-12   Tetrahymena thermophila SB210
gb|KIJ27385.1|  hypothetical protein M422DRAFT_271448                 75.9    1e-12   Sphaerobolus stellatus SS14
ref|XP_007852806.1|  aspartate-trna ligase                            75.9    1e-12   
ref|XP_007878981.1|  hypothetical protein PFL1_03273                  75.9    1e-12   Anthracocystis flocculosa PF-1
gb|KDN49617.1|  aspartyl-tRNA synthetase                              75.9    1e-12   Tilletiaria anomala UBC 951
ref|XP_004537437.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  75.9    1e-12   Ceratitis capitata [medfly]
ref|XP_003702833.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  75.9    1e-12   Megachile rotundata
ref|XP_007265163.1|  aspartyl-tRNA synthetase                         75.9    1e-12   Fomitiporia mediterranea MF3/22
emb|CDY35247.1|  BnaA01g07840D                                        75.5    2e-12   Brassica napus [oilseed rape]
ref|XP_004339518.1|  aspartate-tRNA ligase                            75.9    2e-12   Acanthamoeba castellanii str. Neff
ref|XP_003493969.1|  PREDICTED: aspartyl-tRNA synthetase, cytopla...  75.1    2e-12   Bombus impatiens
gb|KIM48152.1|  hypothetical protein M413DRAFT_223063                 75.1    2e-12   Hebeloma cylindrosporum h7
gb|KDR85046.1|  hypothetical protein GALMADRAFT_218132                75.1    2e-12   Galerina marginata CBS 339.88
ref|XP_968957.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic      75.1    2e-12   Tribolium castaneum [rust-red flour beetle]
ref|XP_008492572.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   74.7    3e-12   Calypte anna
ref|XP_007861098.1|  aspartyl-tRNA synthetase                         74.7    3e-12   Gloeophyllum trabeum ATCC 11539
ref|XP_011208424.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   74.7    3e-12   Bactrocera dorsalis [papaya fruit fly]
ref|XP_002490206.1|  Cytoplasmic aspartyl-tRNA synthetase, homodi...  74.7    3e-12   Komagataella phaffii GS115
gb|ETE73729.1|  Aspartyl-tRNA synthetase, cytoplasmic                 74.3    3e-12   Ophiophagus hannah
ref|XP_002112894.1|  hypothetical protein TRIADDRAFT_56497            74.3    4e-12   Trichoplax adhaerens
gb|KIK06941.1|  hypothetical protein K443DRAFT_673834                 74.3    4e-12   Laccaria amethystina LaAM-08-1
ref|XP_393437.2|  PREDICTED: aspartate--tRNA ligase, cytoplasmic      73.9    5e-12   
ref|XP_001986463.1|  GH21379                                          73.9    5e-12   Drosophila grimshawi
ref|XP_011301459.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   73.9    6e-12   Fopius arisanus
gb|KIK71060.1|  hypothetical protein GYMLUDRAFT_90054                 73.9    6e-12   Gymnopus luxurians FD-317 M1
gb|KJE94928.1|  aspartyl-tRNA synthetase, variant 2                   73.6    6e-12   Capsaspora owczarzaki ATCC 30864
gb|KJE94927.1|  aspartyl-tRNA synthetase, variant 1                   73.6    6e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_007390434.1|  hypothetical protein PHACADRAFT_247281           73.6    7e-12   Phanerochaete carnosa HHB-10118-sp
ref|XP_007299157.1|  aspartyl-tRNA synthetase                         73.6    7e-12   Stereum hirsutum FP-91666 SS1
ref|XP_009129024.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   73.6    8e-12   Brassica rapa
ref|XP_003687768.1|  hypothetical protein TPHA_0K02010                73.6    8e-12   Tetrapisispora phaffii CBS 4417
gb|KIY72817.1|  aspartyl-tRNA synthetase                              73.6    8e-12   Cylindrobasidium torrendii FP15055 ss-10
ref|XP_004346141.2|  aspartyl-tRNA synthetase                         73.2    8e-12   Capsaspora owczarzaki ATCC 30864
ref|XP_005049720.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.8    1e-11   Ficedula albicollis
ref|XP_002006462.1|  GI18555                                          73.2    1e-11   Drosophila mojavensis
ref|XP_003215139.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.8    1e-11   Anolis carolinensis [Carolina anole]
gb|ELT90819.1|  hypothetical protein CAPTEDRAFT_148058                72.8    1e-11   Capitella teleta
ref|XP_005519661.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.8    1e-11   Pseudopodoces humilis [Tibetan ground-jay]
ref|XP_005153817.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  72.8    1e-11   
ref|XP_007213075.1|  hypothetical protein PRUPE_ppa021187mg           72.0    1e-11   
emb|CDK27411.1|  unnamed protein product                              72.8    1e-11   Kuraishia capsulata CBS 1993
gb|AGO11735.1|  AaceriADL039Cp                                        72.8    1e-11   Saccharomycetaceae sp. 'Ashbya aceri'
ref|XP_008034149.1|  aspartyl-tRNA synthetase cytoplasmic             73.2    1e-11   Trametes versicolor FP-101664 SS1
gb|EJT99868.1|  aspartate-tRNA ligase                                 72.4    2e-11   Dacryopinax primogenitus
ref|XP_009962605.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  69.3    2e-11   Tyto alba [Schleiereule]
ref|XP_010160988.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    2e-11   Antrostomus carolinensis
gb|EFN75459.1|  Aspartyl-tRNA synthetase, cytoplasmic                 72.4    2e-11   Harpegnathos saltator
ref|XP_011413945.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  72.4    2e-11   Crassostrea gigas
ref|XP_011152966.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.4    2e-11   Harpegnathos saltator
ref|XP_011413946.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  72.4    2e-11   Crassostrea gigas
ref|XP_011413947.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  72.4    2e-11   Crassostrea gigas
ref|XP_503144.1|  YALI0D22264p                                        72.4    2e-11   Yarrowia lipolytica CLIB122
ref|XP_005416057.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    2e-11   
ref|XP_003024677.1|  aspartate-tRNA ligase, putative                  72.8    2e-11   Trichophyton verrucosum HKI 0517
ref|XP_003012310.1|  aspartate-tRNA ligase, putative                  72.8    2e-11   Trichophyton benhamiae CBS 112371
ref|XP_005095117.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  72.0    2e-11   Aplysia californica
ref|XP_793329.3|  PREDICTED: aspartate--tRNA ligase, cytoplasmic-...  72.0    2e-11   Strongylocentrotus purpuratus [purple urchin]
ref|XP_002194194.2|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    2e-11   
ref|XP_005488013.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    2e-11   
ref|XP_006773157.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    2e-11   Myotis davidii
ref|XP_009086036.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.6    2e-11   
gb|KDB26659.1|  aspartate-tRNA(Asn) ligase                            72.4    2e-11   Trichophyton interdigitale MR816
ref|XP_001873217.1|  predicted protein                                72.0    2e-11   Laccaria bicolor S238N-H82
gb|EZF32848.1|  aspartate-tRNA(Asn) ligase                            72.4    2e-11   Trichophyton interdigitale H6
ref|XP_011182222.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   72.0    3e-11   Zeugodacus cucurbitae [melon fruit fly]
gb|KIW52065.1|  aspartate-tRNA(Asn) ligase                            72.0    3e-11   Exophiala xenobiotica
gb|EJY88629.1|  Aspartyl-tRNA synthetase                              72.0    3e-11   Oxytricha trifallax
emb|CDY14727.1|  BnaC05g19840D                                        71.6    3e-11   Brassica napus [oilseed rape]
ref|XP_006275951.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.6    3e-11   Alligator mississippiensis
ref|XP_009278011.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.2    3e-11   Aptenodytes forsteri
ref|XP_009492590.1|  aspartyl-tRNA synthetase                         71.6    3e-11   Fonticula alba
gb|KFZ46086.1|  Aspartate--tRNA ligase, cytoplasmic                   71.2    3e-11   
ref|XP_003694862.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...  71.6    3e-11   
gb|KFQ25741.1|  Aspartate--tRNA ligase, cytoplasmic                   71.2    3e-11   
ref|XP_009565947.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.2    4e-11   
gb|KFM01083.1|  Aspartate--tRNA ligase, cytoplasmic                   71.2    4e-11   
ref|XP_006018449.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.2    4e-11   
ref|XP_005153816.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  71.2    4e-11   
gb|KFO81148.1|  Aspartate--tRNA ligase, cytoplasmic                   70.9    4e-11   
gb|EMS22297.1|  asparaginyl-trna synthetase                           71.2    4e-11   
ref|XP_009508359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.9    4e-11   
ref|XP_006006252.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   71.2    5e-11   
gb|KIK52831.1|  hypothetical protein GYMLUDRAFT_88546                 70.9    5e-11   
emb|CCF50821.1|  probable DPS1-aspartyl-tRNA synthetase, cytosolic    71.2    5e-11   
ref|XP_002845901.1|  aspartyl-tRNA synthetase                         71.6    5e-11   
ref|XP_007325164.1|  hypothetical protein AGABI1DRAFT_66838           70.9    5e-11   
ref|XP_008557938.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.9    5e-11   
ref|XP_006454386.1|  hypothetical protein AGABI2DRAFT_214362          70.9    5e-11   
ref|XP_008141704.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  70.9    5e-11   
ref|XP_003794430.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  70.9    5e-11   
ref|XP_008920246.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.9    5e-11   
ref|XP_003325135.2|  aspartyl-tRNA synthetase                         70.9    6e-11   
ref|XP_003286963.1|  hypothetical protein DICPUDRAFT_31743            70.9    6e-11   
ref|NP_001125925.1|  aspartate--tRNA ligase, cytoplasmic              70.9    6e-11   
ref|XP_010301217.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.8    6e-11   
gb|EMS55708.1|  Aspartyl-tRNA synthetase, cytoplasmic                 67.0    7e-11   
gb|KDQ20318.1|  hypothetical protein BOTBODRAFT_62623                 70.5    7e-11   
gb|KFW79362.1|  Aspartate--tRNA ligase, cytoplasmic                   70.5    7e-11   
ref|XP_005862923.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.5    7e-11   
ref|XP_007310696.1|  aspartyl-tRNA synthetase                         70.9    7e-11   
ref|XP_006100496.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.1    8e-11   
emb|CAG32037.1|  hypothetical protein RCJMB04_16g4                    70.1    8e-11   
ref|XP_570076.1|  aspartate-tRNA ligase                               70.5    9e-11   
gb|KFV64522.1|  Aspartate--tRNA ligase, cytoplasmic                   70.1    9e-11   
ref|XP_009895089.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.1    1e-10   
ref|XP_010218663.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_002712168.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   70.1    1e-10   
ref|XP_004589423.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  70.1    1e-10   
ref|XP_005020359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_009487670.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_010014135.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_002017960.1|  GL17018                                          69.7    1e-10   
ref|XP_009317210.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_001361642.1|  GA17710                                          69.7    1e-10   
ref|XP_009910301.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_009945209.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
gb|ELU37747.1|  aspartate-tRNA ligase                                 69.3    1e-10   
gb|EUB65062.1|  Aspartyl-tRNA synthetase, cytoplasmic                 69.7    1e-10   
gb|KFQ88629.1|  Aspartate--tRNA ligase, cytoplasmic                   69.7    1e-10   
gb|EPB81701.1|  aspartyl-tRNA synthetase                              69.7    1e-10   
gb|KEF60012.1|  aspartyl-tRNA synthetase                              70.1    1e-10   
ref|XP_009640780.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
ref|XP_010157948.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.7    1e-10   
gb|KFB50781.1|  AGAP005576-PA-like protein                            69.7    1e-10   
ref|XP_010078250.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    1e-10   
ref|XP_007366855.1|  aspartyl-tRNA synthetase, cytoplasmic            70.1    1e-10   
ref|XP_009979954.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    1e-10   
gb|KIW65714.1|  aspartate-tRNA(Asn) ligase                            70.1    1e-10   
gb|KFP98763.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
ref|XP_010290541.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    1e-10   
ref|XP_009705402.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    1e-10   
ref|XP_001437523.1|  hypothetical protein                             69.7    1e-10   
gb|AAR09992.1|  similar to Drosophila melanogaster Aats-asp           67.0    1e-10   
gb|KFV00637.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
gb|KFQ50746.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
gb|KFP19056.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
gb|KFQ68263.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
gb|KFQ06975.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    1e-10   
ref|XP_009267514.1|  Aspartate--tRNA ligase, cytoplasmic              69.7    2e-10   
gb|KFQ54646.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
gb|AAY24055.1|  unknown                                               66.6    2e-10   
ref|XP_009029804.1|  hypothetical protein HELRODRAFT_186165           69.3    2e-10   
ref|XP_008725173.1|  aspartate-tRNA(Asn) ligase                       70.1    2e-10   
gb|KFW63602.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
gb|KIM85253.1|  hypothetical protein PILCRDRAFT_5591                  69.3    2e-10   
gb|AFR94626.1|  aspartate-tRNA(Asn) ligase                            69.7    2e-10   
ref|XP_007759673.1|  aspartyl-tRNA synthetase                         70.1    2e-10   
gb|KFV00090.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
gb|KFP47224.1|  Aspartate--tRNA ligase, cytoplasmic                   68.9    2e-10   
ref|XP_009937033.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    2e-10   
gb|KFP68443.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
ref|XP_009998676.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  69.3    2e-10   
gb|KFV96538.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
ref|XP_006636375.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  69.3    2e-10   
gb|KFU91688.1|  Aspartate--tRNA ligase, cytoplasmic                   69.3    2e-10   
ref|XP_001024675.1|  aspartyl-tRNA synthetase family protein          69.7    2e-10   
ref|XP_003175348.1|  aspartyl-tRNA synthetase                         69.7    2e-10   
emb|CDJ02923.1|  aspartyl tRNA synthetase, cytoplasmic                69.3    2e-10   
ref|XP_011263373.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   69.3    2e-10   
gb|KFW93918.1|  Aspartate--tRNA ligase, cytoplasmic                   68.9    2e-10   
ref|XP_009812359.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.9    2e-10   
emb|CEJ04778.1|  Putative Aspartyl-tRNA synthetase                    69.3    2e-10   
ref|XP_009675662.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.9    2e-10   
gb|KFR14034.1|  Aspartate--tRNA ligase, cytoplasmic                   68.9    2e-10   
ref|XP_007339748.1|  aspartate-tRNA ligase                            69.3    2e-10   
gb|ERL92973.1|  hypothetical protein D910_10276                       69.3    2e-10   
gb|KIX01760.1|  aspartate-tRNA(Asn) ligase                            69.7    2e-10   
gb|ELK23193.1|  Aspartyl-tRNA synthetase, cytoplasmic                 69.3    2e-10   
gb|EJY72918.1|  Aspartyl-tRNA synthetase                              69.3    2e-10   
gb|KFV43662.1|  Aspartate--tRNA ligase, cytoplasmic                   68.9    2e-10   
ref|XP_010405462.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.9    2e-10   
ref|XP_011129737.1|  aspartyl-tRNA synthetase                         68.9    2e-10   
ref|XP_001447353.1|  hypothetical protein                             68.9    2e-10   
gb|KFV82611.1|  Aspartate--tRNA ligase, cytoplasmic                   68.6    2e-10   
ref|XP_004994591.1|  aspartyl-tRNA synthetase                         68.9    2e-10   
gb|KGL81270.1|  Aspartate--tRNA ligase, cytoplasmic                   68.6    3e-10   
gb|EGE01752.1|  aspartyl-tRNA synthetase                              69.3    3e-10   
gb|EGD97285.1|  aspartyl-tRNA synthetase, cytoplasmic                 69.3    3e-10   
ref|XP_010712327.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.6    3e-10   
emb|CDR98052.1|  aspartyl-tRNA synthetase, putative                   68.9    3e-10   
ref|XP_008636434.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.6    3e-10   
emb|CDI54951.1|  probable DPS1-aspartyl-tRNA synthetase, cytosolic    68.9    3e-10   
gb|KIH69251.1|  aspartate--tRNA ligase                                68.6    3e-10   
ref|XP_004885153.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.6    3e-10   
ref|XP_003232967.1|  lysyl-tRNA synthetase                            69.3    3e-10   
gb|EZF76454.1|  aspartate-tRNA(Asn) ligase                            69.3    3e-10   
ref|XP_003922053.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.6    3e-10   
gb|KIO33847.1|  hypothetical protein M407DRAFT_240953                 68.6    3e-10   
ref|XP_005509007.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.2    3e-10   
ref|NP_001071079.1|  aspartate--tRNA ligase, cytoplasmic              68.6    3e-10   
gb|KFO62612.1|  Aspartate--tRNA ligase, cytoplasmic                   68.2    3e-10   
emb|CEG68415.1|  Putative Aspartyl-tRNA synthetase                    68.6    4e-10   
ref|NP_001153873.1|  aspartyl-tRNA synthetase                         68.6    4e-10   
ref|XP_004423919.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.2    4e-10   
ref|XP_007509366.1|  aspartyl-tRNA synthetase                         68.2    4e-10   
gb|EWM24309.1|  aspartyl-trna synthetase                              68.6    4e-10   
dbj|GAC99825.1|  hypothetical protein PHSY_007428                     68.6    4e-10   
ref|XP_005242442.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.2    4e-10   
ref|XP_003133314.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.2    4e-10   
gb|EAS04430.2|  aspartyl-tRNA synthetase protein                      68.2    4e-10   
ref|XP_006727730.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    4e-10   
ref|XP_002784004.1|  aspartate--tRNA ligase, putative                 67.8    4e-10   
ref|XP_004375152.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.2    4e-10   
ref|XP_009575956.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.2    4e-10   
gb|KFV92225.1|  Aspartate--tRNA ligase, cytoplasmic                   68.2    4e-10   
ref|XP_445690.1|  hypothetical protein                                68.2    4e-10   
ref|XP_010604451.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.2    4e-10   
gb|EMC84113.1|  Aspartyl-tRNA synthetase, cytoplasmic                 67.8    4e-10   
ref|XP_011283512.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  68.2    4e-10   
ref|XP_005390823.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   68.2    4e-10   
ref|XP_008471668.1|  PREDICTED: calcium-binding mitochondrial car...  67.4    5e-10   
gb|AAI07750.1|  Aspartyl-tRNA synthetase                              67.8    5e-10   
ref|NP_001006528.1|  aspartyl-tRNA synthetase, cytoplasmic            67.8    5e-10   
ref|XP_001828763.1|  aspartate-tRNA ligase                            68.2    5e-10   
gb|ENN75550.1|  hypothetical protein YQE_07893                        67.8    5e-10   
ref|XP_004774308.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.8    5e-10   
emb|CEI91695.1|  Putative Aspartyl-tRNA synthetase                    67.8    5e-10   
ref|XP_006748244.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.8    5e-10   
ref|XP_011271590.1|  aspartyl-tRNA synthetase                         67.8    5e-10   
emb|CBQ68871.1|  probable DPS1-aspartyl-tRNA synthetase, cytosolic    67.8    5e-10   
gb|KIR86188.1|  aspartate-tRNA(Asn) ligase                            67.8    6e-10   
ref|XP_011352781.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.8    6e-10   
ref|XP_002749521.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.8    6e-10   
ref|XP_005315894.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.8    6e-10   
ref|XP_003267655.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.8    6e-10   
gb|EPQ05648.1|  Aspartyl-tRNA synthetase, cytoplasmic                 67.8    6e-10   
ref|XP_007452082.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.8    6e-10   
ref|XP_001490073.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.8    6e-10   
ref|XP_004704018.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    6e-10   
ref|XP_007098910.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.8    6e-10   
ref|XP_009072672.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    6e-10   
gb|KFP80008.1|  Aspartate--tRNA ligase, cytoplasmic                   67.4    6e-10   
gb|KIV88426.1|  aspartate-tRNA(Asn) ligase                            67.8    6e-10   
gb|KIV85816.1|  aspartate-tRNA(Asn) ligase                            68.2    6e-10   
ref|XP_011283514.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    6e-10   
ref|XP_010982259.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    6e-10   
ref|XP_009884978.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    6e-10   
dbj|GAA96158.1|  hypothetical protein E5Q_02819                       67.8    7e-10   
ref|XP_008515152.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_004032648.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_010971513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_006921100.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    7e-10   
ref|XP_007192114.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_004036839.1|  hypothetical protein IMG5_068760                 67.8    7e-10   
ref|XP_004265496.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
gb|KIR47067.1|  aspartate-tRNA(Asn) ligase                            67.4    7e-10   
ref|XP_009460053.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_008935669.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_008694082.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    7e-10   
ref|XP_011283513.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    8e-10   
ref|XP_001155169.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    8e-10   
ref|XP_003405905.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...  67.4    8e-10   
gb|ELK04585.1|  Aspartyl-tRNA synthetase, cytoplasmic                 67.4    8e-10   
ref|XP_004626472.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    8e-10   
ref|XP_004403600.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    8e-10   
ref|XP_645306.1|  aspartyl-tRNA synthetase                            67.4    8e-10   
ref|XP_005007764.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    8e-10   
gb|AAA35567.1|  aspartyl-tRNA synthetase                              67.4    8e-10   
gb|KGL86649.1|  Aspartate--tRNA ligase, cytoplasmic                   67.0    8e-10   
ref|XP_006175778.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.4    8e-10   
gb|KIR60289.1|  aspartate-tRNA(Asn) ligase                            67.4    8e-10   
gb|KFQ94447.1|  Aspartate--tRNA ligase, cytoplasmic                   67.0    8e-10   
ref|XP_003478767.2|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    8e-10   
ref|XP_007525078.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.4    8e-10   
gb|KFO22727.1|  Aspartyl-tRNA synthetase, cytoplasmic                 67.0    8e-10   
ref|XP_848666.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic ...  67.0    8e-10   
ref|XP_007950689.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.0    8e-10   
ref|NP_446251.1|  aspartate--tRNA ligase, cytoplasmic                 67.0    9e-10   
gb|AAX07827.1|  cell proliferation-inducing protein 40                67.0    9e-10   
ref|NP_001085490.1|  aspartyl-tRNA synthetase                         67.0    9e-10   
ref|NP_001340.2|  aspartate--tRNA ligase, cytoplasmic isoform 1       67.0    9e-10   
dbj|BAD96196.1|  aspartyl-tRNA synthetase variant                     67.0    9e-10   
ref|XP_003909218.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.0    9e-10   
ref|NP_001080336.1|  aspartyl-tRNA synthetase                         67.0    9e-10   
ref|XP_007394695.1|  hypothetical protein PHACADRAFT_118899           67.4    9e-10   
gb|AAP36306.1|  Homo sapiens aspartyl-tRNA synthetase                 67.0    9e-10   
emb|CBJ31343.1|  Aspartyl-tRNA Synthetase                             67.4    9e-10   
pdb|4J15|A  Chain A, Crystal Structure Of Human Cytosolic Asparty...  67.0    9e-10   
gb|KFQ17990.1|  Aspartate--tRNA ligase, cytoplasmic                   67.0    9e-10   
ref|XP_008582943.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.0    9e-10   
ref|XP_004674746.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.0    1e-09   
gb|EIE79914.1|  hypothetical protein RO3G_04619                       67.0    1e-09   
ref|XP_006894506.1|  PREDICTED: LOW QUALITY PROTEIN: aspartate--t...  67.0    1e-09   
ref|XP_001975841.1|  GG20342                                          67.0    1e-09   
gb|KIW92051.1|  aspartate-tRNA(Asn) ligase                            67.4    1e-09   
ref|XP_003037371.1|  hypothetical protein SCHCODRAFT_64631            67.0    1e-09   
ref|XP_004480213.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.0    1e-09   
gb|EAX11618.1|  aspartyl-tRNA synthetase, isoform CRA_b               67.0    1e-09   
ref|XP_006169785.1|  PREDICTED: aspartate--tRNA ligase, cytoplasm...  67.0    1e-09   
ref|XP_002033628.1|  GM21429                                          67.0    1e-09   
gb|KIV90252.1|  aspartate-tRNA(Asn) ligase                            67.4    1e-09   
ref|XP_005187396.1|  PREDICTED: aspartate--tRNA ligase, cytoplasmic   67.0    1e-09   



>ref|XP_002283440.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Vitis vinifera]
Length=544

 Score =   187 bits (476),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/118 (76%), Positives = 105/118 (89%), Gaps = 0/118 (0%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            I D+PDPLA+NYGD+PL DL+SK V+G KW+DIGALT +LKD++VLIRGRAQTIRAVGK 
Sbjct  54   IGDTPDPLASNYGDVPLLDLQSKEVTGLKWTDIGALTEDLKDQKVLIRGRAQTIRAVGKN  113

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            IAF+VVR+ GFTVQCVLTVAPDLVS  MVKYAT LS+ES VD+EG++SVP V IKGAT
Sbjct  114  IAFLVVRQMGFTVQCVLTVAPDLVSRHMVKYATGLSRESHVDIEGIISVPGVPIKGAT  171



>ref|XP_010277273.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nelumbo 
nucifera]
Length=550

 Score =   179 bits (454),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/113 (73%), Positives = 102/113 (90%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA NYGD+PL++L+SK V+GRKW+++G L  ELKDKEVLIRGR QTIRAVGKKIAF+V
Sbjct  64   DPLAGNYGDVPLEELQSKDVTGRKWTEVGLLNEELKDKEVLIRGRVQTIRAVGKKIAFLV  123

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++G TVQCV TVAP+LVSGQMVK+ATSLS+ES VD++GVVSVPNV +KG +
Sbjct  124  LREKGCTVQCVATVAPELVSGQMVKFATSLSRESHVDIQGVVSVPNVPVKGTS  176



>ref|XP_006345989.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Solanum 
tuberosum]
Length=539

 Score =   178 bits (452),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 102/116 (88%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  DPL+ NYGD+ L+DL+SKAV+GRKW+++G++T E+KD+ VLIRGR QTIR VGKKIA
Sbjct  49   EESDPLSGNYGDVELNDLQSKAVTGRKWTEVGSVTPEMKDQVVLIRGRVQTIRPVGKKIA  108

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR+RGFTVQCVLTV P+LVS QMVKYATSLSKESIVDVEGVV++P   I GAT
Sbjct  109  FVVVRERGFTVQCVLTVKPELVSSQMVKYATSLSKESIVDVEGVVTIPEKPITGAT  164



>ref|XP_004239653.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Solanum lycopersicum]
Length=544

 Score =   176 bits (446),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/116 (70%), Positives = 101/116 (87%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  DPL+ NYGD+ L+DL+SKAV+GRKW+++G++  E+KD+ VL+RGR QTIR VGKKIA
Sbjct  54   EESDPLSGNYGDVELNDLQSKAVTGRKWTEVGSIAPEMKDRVVLVRGRVQTIRPVGKKIA  113

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR+RGFTVQCVLTV P+LVS QMVKYATSLSKESI+DVEGVV++P   I GAT
Sbjct  114  FVVVRERGFTVQCVLTVKPELVSSQMVKYATSLSKESIIDVEGVVTIPEKPITGAT  169



>ref|XP_011075752.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Sesamum indicum]
Length=542

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 103/116 (89%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            ++ DPLAANYG+IPL+DL+SK +SG+KW+++  LT ELKD+ VLIRGRAQ IRAVGKK+A
Sbjct  53   EAEDPLAANYGEIPLNDLQSKEISGKKWTEVKDLTNELKDQVVLIRGRAQAIRAVGKKMA  112

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR+RGFTVQCVLTVA D+VS QMVK+ATSLS+ESIVD+EGV+SVP   I GA+
Sbjct  113  FLVVRERGFTVQCVLTVAQDVVSPQMVKFATSLSRESIVDIEGVISVPTQPITGAS  168



>ref|XP_009598884.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nicotiana 
tomentosiformis]
Length=552

 Score =   174 bits (441),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/118 (70%), Positives = 99/118 (84%), Gaps = 0/118 (0%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +D+ PDPLA NYGD+ L+DL+SK VSGR+W+ +  L  E++D+ VLIRGR QTIR VGKK
Sbjct  57   VDEGPDPLAGNYGDVLLNDLQSKVVSGRQWTKVELLAPEMRDQVVLIRGRVQTIRPVGKK  116

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            IAF+VVR+RGFTVQCVLTV P+LVS  MVK+ATSLSKESIVDVEGVV+VP   I GAT
Sbjct  117  IAFVVVRERGFTVQCVLTVKPELVSAHMVKFATSLSKESIVDVEGVVTVPEKPITGAT  174



>gb|EYU29160.1| hypothetical protein MIMGU_mgv1a004174mg [Erythranthe guttata]
Length=541

 Score =   174 bits (440),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 100/116 (86%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPLAANYG+IPL+DL+SK +SG+KW+D+  L   LKD+ VL+RGRAQ IRAVGKK+A
Sbjct  52   DGEDPLAANYGEIPLNDLQSKEISGKKWTDVKDLNDGLKDQAVLVRGRAQAIRAVGKKMA  111

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVRKRGFTVQCVLTVA D+VS QMVK+ATSLS+ESIVD+EG+VSVP   I GA+
Sbjct  112  FVVVRKRGFTVQCVLTVAQDVVSSQMVKFATSLSRESIVDIEGIVSVPAQPITGAS  167



>ref|XP_006838452.1| hypothetical protein AMTR_s00002p00135040 [Amborella trichopoda]
 gb|ERN01021.1| hypothetical protein AMTR_s00002p00135040 [Amborella trichopoda]
Length=191

 Score =   164 bits (415),  Expect = 5e-47, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPLA++YGDIPL +L+SK +SG+ W+++ +L+ E KDKE+LIRG+AQTIRAV K +A
Sbjct  70   DEADPLASHYGDIPLKELQSKEISGQAWTEVKSLSDEFKDKEILIRGQAQTIRAVSKNMA  129

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            FIVVR+RGFTVQCV TVAP  VS QMVK+ T LS+ES +DV GVVSVP ++IKG +
Sbjct  130  FIVVRERGFTVQCVFTVAPGFVSKQMVKFVTGLSRESYIDVYGVVSVPGMEIKGTS  185



>ref|XP_009791268.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Nicotiana 
sylvestris]
Length=541

 Score =   172 bits (435),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 82/118 (69%), Positives = 100/118 (85%), Gaps = 0/118 (0%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +D+ PDPLA+NYGD+ L+DL+SK +SGR+W+ +  L   ++D+ VLIRGR QTIR VGKK
Sbjct  46   VDEGPDPLASNYGDVLLNDLQSKVLSGRQWTKVELLAPVMRDQVVLIRGRVQTIRPVGKK  105

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            IAF+VVR+RGFTVQCVLTV P+LVS QMVK+ATSLSKESIVDVEGVV+VP   I GAT
Sbjct  106  IAFVVVRERGFTVQCVLTVKPELVSAQMVKFATSLSKESIVDVEGVVTVPEKPITGAT  163



>ref|XP_004136326.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis 
sativus]
 gb|KGN60145.1| hypothetical protein Csa_3G881580 [Cucumis sativus]
Length=545

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAV-SGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPL+ANYGD+PL DL+SK V S   W+ +G+LT ELKDK V++RGR QTIRAVGKK+AF+
Sbjct  58   DPLSANYGDVPLSDLQSKEVKSIENWTQVGSLTPELKDKYVILRGRVQTIRAVGKKMAFL  117

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCVL+  P+LVS QMVKY   LS+ESIVDVEGVVSVPNV IKGA+
Sbjct  118  VVREKGFTVQCVLSEQPELVSRQMVKYVDGLSRESIVDVEGVVSVPNVAIKGAS  171



>ref|XP_004162485.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cucumis 
sativus]
Length=545

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAV-SGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPL+ANYGD+PL DL+SK V S   W+ +G+LT ELKDK V++RGR QTIRAVGKK+AF+
Sbjct  58   DPLSANYGDVPLSDLQSKEVKSIENWTQVGSLTPELKDKYVILRGRVQTIRAVGKKMAFL  117

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCVL+  P+LVS QMVKY   LS+ESIVDVEGVVSVPNV IKGA+
Sbjct  118  VVREKGFTVQCVLSEQPELVSRQMVKYVDGLSRESIVDVEGVVSVPNVAIKGAS  171



>ref|XP_007222302.1| hypothetical protein PRUPE_ppa003911mg [Prunus persica]
 gb|EMJ23501.1| hypothetical protein PRUPE_ppa003911mg [Prunus persica]
Length=540

 Score =   165 bits (417),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 99/119 (83%), Gaps = 1/119 (1%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGK  402
            +DD  DPL+ANYGD+PL++++SK V    +W+++GALT   +++ VLIRGRAQTIRAVGK
Sbjct  49   VDDEQDPLSANYGDVPLNEIQSKTVEDVSRWTEVGALTNTSENRSVLIRGRAQTIRAVGK  108

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             +AF+VVR+RGFTVQCV TV PD VS QMVKY   LS+ESI+D+EGVVSVP+V+IKG T
Sbjct  109  NMAFVVVRERGFTVQCVATVQPDTVSRQMVKYVAGLSRESIIDIEGVVSVPSVEIKGTT  167



>ref|XP_008466345.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Cucumis melo]
Length=545

 Score =   165 bits (417),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 97/114 (85%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAV-SGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPL+ANYGD+PL DL+SK V S   W+ +G+LT ELKDK V++RGR QTIRAVGKK+AF+
Sbjct  58   DPLSANYGDVPLSDLQSKEVKSIENWTQVGSLTPELKDKYVILRGRIQTIRAVGKKMAFL  117

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCVL+  P+LVS QMVKY   LS+ESIVDVEGVVSVPNV IKGA+
Sbjct  118  VVREKGFTVQCVLSEQPELVSRQMVKYVDGLSRESIVDVEGVVSVPNVAIKGAS  171



>ref|XP_006850989.1| hypothetical protein AMTR_s00025p00212870 [Amborella trichopoda]
 gb|ERN12570.1| hypothetical protein AMTR_s00025p00212870 [Amborella trichopoda]
Length=559

 Score =   164 bits (416),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 77/116 (66%), Positives = 96/116 (83%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPLA+NYGDIPL +L+SK +SGR W+++ +L+ ELKD EVLIRG+AQTIRAV K +A
Sbjct  70   DELDPLASNYGDIPLKELQSKDISGRVWTEVKSLSEELKDTEVLIRGQAQTIRAVSKNMA  129

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            FIV+R+RGFTVQCV T+AP  VS QMVK+ T LS+ES +DV GVVSVP V IKG++
Sbjct  130  FIVLRERGFTVQCVFTIAPGFVSKQMVKFVTGLSRESYIDVYGVVSVPGVAIKGSS  185



>ref|XP_002308157.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa]
 gb|EEE91680.2| aspartyl-tRNA synthetase family protein [Populus trichocarpa]
Length=545

 Score =   161 bits (407),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPLAANYG+IPL DL+SK  +  K W+ +G LT ELK+KEVLIRGRAQT RAVGK +AF+
Sbjct  58   DPLAANYGNIPLQDLQSKVEADLKAWTQVGDLTHELKEKEVLIRGRAQTTRAVGKNMAFV  117

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCV+T  PD+VS QMVK+A  LS+ESIVD+ GVVSVP++ IKG T
Sbjct  118  VVREKGFTVQCVVTARPDVVSKQMVKFAAGLSRESIVDIHGVVSVPSIAIKGTT  171



>ref|XP_006381194.1| hypothetical protein POPTR_0006s08550g [Populus trichocarpa]
 gb|ERP58991.1| hypothetical protein POPTR_0006s08550g [Populus trichocarpa]
Length=564

 Score =   161 bits (407),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 78/114 (68%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPLAANYG+IPL DL+SK  +  K W+ +G LT ELK+KEVLIRGRAQT RAVGK +AF+
Sbjct  58   DPLAANYGNIPLQDLQSKVEADLKAWTQVGDLTHELKEKEVLIRGRAQTTRAVGKNMAFV  117

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCV+T  PD+VS QMVK+A  LS+ESIVD+ GVVSVP++ IKG T
Sbjct  118  VVREKGFTVQCVVTARPDVVSKQMVKFAAGLSRESIVDIHGVVSVPSIAIKGTT  171



>ref|XP_008393995.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X2 
[Malus domestica]
Length=472

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA NYGD+PL +L+SK       W+++G+LT  L+++ VLIRGRAQTIRAVGK +
Sbjct  56   DXQDPLAXNYGDVPLIELQSKTAEDVSHWTEVGSLTNALENRSVLIRGRAQTIRAVGKNM  115

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+VVR+RGFTVQCV TV PD VS QMVKY   LS+ESI+D+EGVVSVP+V+IKG T
Sbjct  116  AFVVVRERGFTVQCVATVQPDTVSRQMVKYIAGLSRESIIDIEGVVSVPSVEIKGTT  172



>ref|XP_008393994.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X1 
[Malus domestica]
Length=485

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA NYGD+PL +L+SK       W+++G+LT  L+++ VLIRGRAQTIRAVGK +
Sbjct  56   DXQDPLAXNYGDVPLIELQSKTAEDVSHWTEVGSLTNALENRSVLIRGRAQTIRAVGKNM  115

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+VVR+RGFTVQCV TV PD VS QMVKY   LS+ESI+D+EGVVSVP+V+IKG T
Sbjct  116  AFVVVRERGFTVQCVATVQPDTVSRQMVKYIAGLSRESIIDIEGVVSVPSVEIKGTT  172



>gb|EPS57914.1| hypothetical protein M569_16902, partial [Genlisea aurea]
Length=534

 Score =   160 bits (404),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 79/116 (68%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  DPL+ NYGD+ L+DL+SK +SG+KW+DI  L   LKD+ VLIRGRAQTIRA GKKIA
Sbjct  45   EDEDPLSENYGDVLLNDLQSKEISGKKWTDIKNLNDRLKDQPVLIRGRAQTIRAKGKKIA  104

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR+RGFTVQCVL  A D VS QMVK+A ++S+ESIVDVEGVVSVP   IKG T
Sbjct  105  FVVVRERGFTVQCVLNAADDGVSPQMVKFAAAISRESIVDVEGVVSVPENPIKGTT  160



>ref|XP_011019869.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Populus euphratica]
Length=546

 Score =   159 bits (403),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 77/114 (68%), Positives = 94/114 (82%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPLA NYG+IPL DL+SK  +  K W+ +G LT ELK+KEVLIRGRAQT RAVGK +AF+
Sbjct  59   DPLAENYGNIPLQDLQSKVEADLKAWTQVGDLTHELKEKEVLIRGRAQTTRAVGKNMAFV  118

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCV+T  PD+VS QMVK+A  LS+ESIVD+ GVVSVP++ IKG T
Sbjct  119  VVREKGFTVQCVVTARPDVVSKQMVKFAAGLSRESIVDIHGVVSVPSIAIKGTT  172



>ref|XP_008352039.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=545

 Score =   159 bits (402),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 76/117 (65%), Positives = 94/117 (80%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA NYGD+PL +L+SK       W+++G+LT  L+++ VLIRGRAQTIRAVGK +
Sbjct  56   DXQDPLAXNYGDVPLIELQSKTAEDVSHWTEVGSLTNALENRSVLIRGRAQTIRAVGKNM  115

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+VVR+RGFTVQCV TV PD VS QMVKY   LS+ESI+D+EGVVSVP+V+IKG T
Sbjct  116  AFVVVRERGFTVQCVATVQPDTVSRQMVKYIAGLSRESIIDIEGVVSVPSVEIKGTT  172



>ref|XP_008378275.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=542

 Score =   158 bits (399),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA+NYG++PL +L+SK       W+++G LT  L+++ VLIRGRAQTIRAVG K+
Sbjct  53   DEQDPLASNYGEVPLVELQSKTAEDVSHWTEVGHLTNALENQSVLIRGRAQTIRAVGNKM  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +F+VVR+RGFTVQCV+TV PD VS QMVKY   LS+ESI+DVEGVVSVP+V+IKG T
Sbjct  113  SFVVVRERGFTVQCVVTVQPDTVSRQMVKYVAGLSRESIIDVEGVVSVPSVEIKGTT  169



>ref|XP_008347712.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Malus domestica]
Length=542

 Score =   158 bits (399),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA+NYG++PL +L+SK       W+++G LT  L+++ VLIRGRAQTIRAVG K+
Sbjct  53   DEQDPLASNYGEVPLVELQSKTAEDVSHWTEVGHLTNALENQSVLIRGRAQTIRAVGNKM  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +F+VVR+RGFTVQCV+TV PD VS QMVKY   LS+ESI+DVEGVVSVP+V+IKG T
Sbjct  113  SFVVVRERGFTVQCVVTVQPDTVSRQMVKYVAGLSRESIIDVEGVVSVPSVEIKGTT  169



>ref|XP_009377365.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Pyrus x 
bretschneideri]
Length=542

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 95/117 (81%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLA+NYG++PL +L+SK       W+++G LT  L+++ VLIRGRAQTIRAVG K+
Sbjct  53   DEQDPLASNYGEVPLVELQSKTAEDVSHWTEVGNLTNALENQSVLIRGRAQTIRAVGNKM  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +F+VVR+RGFTVQCV+TV PD VS QMVKY   LS+ESI+DVEGVVSVP+V+IKG T
Sbjct  113  SFVVVRERGFTVQCVVTVQPDTVSRQMVKYVAGLSRESIIDVEGVVSVPSVEIKGTT  169



>gb|ABX46068.1| aspartyl transcarbamylase, partial [Atalantia ceylanica]
Length=218

 Score =   150 bits (380),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  59   PLANNYGDVPLQELQSVNDPQTGNWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  118

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVPNV+IKG
Sbjct  119  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPNVEIKG  178

Query  574  AT  579
            AT
Sbjct  179  AT  180



>ref|XP_002523450.1| aspartyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF38909.1| aspartyl-tRNA synthetase, putative [Ricinus communis]
Length=540

 Score =   157 bits (396),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 93/119 (78%), Gaps = 1/119 (1%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGK  402
            ++D  DPL+ NYG+ PL DL+SK  S   +W+ +G L  ELKDKE+LIRGRAQT RAVGK
Sbjct  48   MEDQEDPLSGNYGNTPLSDLQSKEESDLSEWTRVGQLNEELKDKELLIRGRAQTTRAVGK  107

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             +AF+VVR++GFTVQCV+TV  DLVS QMVK+   LS+ESIVDV GVVSVPN  IKG T
Sbjct  108  NMAFVVVRQKGFTVQCVVTVQADLVSRQMVKFVAGLSRESIVDVRGVVSVPNSPIKGTT  166



>gb|ABX46071.1| aspartyl transcarbamylase, partial [Citrus medica]
Length=217

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 93/122 (76%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL A LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNASLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++A SLS ESIVDV GV+SVP V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFARSLSNESIVDVIGVISVPXVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46076.1| aspartyl transcarbamylase, partial [Citrus webberi]
Length=217

 Score =   150 bits (378),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 75/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVPNV+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPNVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_010095486.1| Aspartate--tRNA ligase [Morus notabilis]
 gb|EXB60460.1| Aspartate--tRNA ligase [Morus notabilis]
Length=541

 Score =   155 bits (391),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 75/114 (66%), Positives = 95/114 (83%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKA-VSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPLAANYGD+PL +L+SKA V    W+++GAL+  LKD+ VL+RGR+QTIR+V K +AF+
Sbjct  54   DPLAANYGDVPLPELQSKAPVDTGNWTEVGALSEALKDQRVLVRGRSQTIRSVSKNMAFL  113

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VVR++GFTVQCV+T  PD+VS QMVKY + LS+ESIVDVEG+VSVP   IKGAT
Sbjct  114  VVREKGFTVQCVVTAIPDVVSRQMVKYVSGLSRESIVDVEGIVSVPKDAIKGAT  167



>gb|ABX46087.1| aspartyl transcarbamylase, partial [Citrus amblycarpa]
Length=217

 Score =   148 bits (374),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PL  NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLVNNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVPNV+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPNVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABK25168.1| unknown [Picea sitchensis]
Length=566

 Score =   155 bits (391),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 93/116 (80%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  DPLA NYGD+PL+ ++SK +SGRKW+ +G+L  ELKD+++L+RGRA  IR V  K+A
Sbjct  77   EESDPLAGNYGDLPLEAVQSKEISGRKWTRVGSLMDELKDQQILVRGRAHAIRGVSSKMA  136

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR+ G+TVQCVL V P +VS  MVK+ T LSKESIVDVEG+V+VPN+ I GA+
Sbjct  137  FLVVREAGYTVQCVLNVNPGVVSKGMVKFVTGLSKESIVDVEGIVTVPNIAITGAS  192



>gb|ABX46070.1| aspartyl transcarbamylase, partial [Citrus medica]
 gb|ABX46073.1| aspartyl transcarbamylase, partial [Citrus medica]
 gb|ABX46074.1| aspartyl transcarbamylase, partial [Citrus halimii]
 gb|ABX46075.1| aspartyl transcarbamylase, partial [Citrus halimii]
 gb|ABX46090.1| aspartyl transcarbamylase, partial [Citrus reticulata]
 gb|ABX46091.1| aspartyl transcarbamylase, partial [Citrus reticulata]
 gb|ABX46096.1| aspartyl transcarbamylase, partial [Citrus reshni]
 gb|ABX46108.1| aspartyl transcarbamylase, partial [Citrus maxima]
 gb|ABX46109.1| aspartyl transcarbamylase, partial [Citrus ichangensis]
 gb|ABX46111.1| aspartyl transcarbamylase, partial [Citrus hanaju]
 gb|ABX46112.1| aspartyl transcarbamylase, partial [Citrus hanaju]
Length=217

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46085.1| aspartyl transcarbamylase, partial [Citrus limon]
Length=217

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_010672510.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
Length=544

 Score =   154 bits (389),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 92/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA NYGDIPL +L+SKAV+GRKW ++ +L  +LKD+EVLIRGR Q IRAV KK+AF+V
Sbjct  58   DPLAHNYGDIPLIELQSKAVTGRKWIEVKSLVTDLKDQEVLIRGRVQAIRAVSKKMAFVV  117

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR+ G+TVQCVL VA + VS QMVK+A  LS+ES+VD++G VSVP   IKG +
Sbjct  118  VREGGYTVQCVLMVAKEKVSEQMVKFANGLSRESVVDIQGFVSVPGESIKGTS  170



>gb|ABX46081.1| aspartyl transcarbamylase, partial [Citrus limettioides]
Length=217

 Score =   147 bits (372),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46119.1| aspartyl transcarbamylase, partial [Citrus australasica]
 gb|ABX46120.1| aspartyl transcarbamylase, partial [Citrus australasica]
Length=217

 Score =   147 bits (370),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46077.1| aspartyl transcarbamylase, partial [Citrus longispina]
 gb|ABX46078.1| aspartyl transcarbamylase, partial [Citrus longispina]
Length=217

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKXAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46084.1| aspartyl transcarbamylase, partial [Citrus unshiu]
 gb|ABX46102.1| aspartyl transcarbamylase, partial [Citrus sinensis]
 gb|ABX46110.1| aspartyl transcarbamylase, partial [Citrus ichangensis]
Length=217

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46113.1| aspartyl transcarbamylase, partial [Citrus trifoliata]
 gb|ABX46115.1| aspartyl transcarbamylase, partial [Citrus trifoliata]
Length=217

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46114.1| aspartyl transcarbamylase, partial [Citrus trifoliata]
 gb|ABX46116.1| aspartyl transcarbamylase, partial [Citrus trifoliata]
Length=217

 Score =   146 bits (368),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_004303438.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Fragaria vesca 
subsp. vesca]
Length=551

 Score =   152 bits (384),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 75/117 (64%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            DS DPLA NYGD+PL  L+S  ++  K W+++GALT  LKDK+V IRGRAQTIRAVGK +
Sbjct  62   DSEDPLAENYGDLPLIQLQSMRIADVKDWTEVGALTEALKDKQVQIRGRAQTIRAVGKNM  121

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AFIVVR++GFTVQCV TV P++VS QMVKY   LS+ESI+D+EG+VSVP   I  A+
Sbjct  122  AFIVVREKGFTVQCVATVQPEIVSRQMVKYVAGLSRESIIDIEGIVSVPGTPIISAS  178



>gb|ABX46093.1| aspartyl transcarbamylase, partial [Citrus nippokoreana]
 gb|ABX46094.1| aspartyl transcarbamylase, partial [Citrus nippokoreana]
Length=217

 Score =   146 bits (368),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVXGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46088.1| aspartyl transcarbamylase, partial [Citrus amblycarpa]
 gb|ABX46092.1| aspartyl transcarbamylase, partial [Citrus reticulata]
 gb|ABX46095.1| aspartyl transcarbamylase, partial [Citrus reshni]
Length=217

 Score =   146 bits (368),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PL  NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLVNNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46069.1| aspartyl transcarbamylase, partial [Swinglea glutinosa]
Length=217

 Score =   145 bits (367),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLADNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV+   SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRSVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_008219827.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Prunus mume]
Length=533

 Score =   152 bits (383),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/119 (64%), Positives = 95/119 (80%), Gaps = 8/119 (7%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGK  402
            +DD  DPLAANYGD+PL++++SK V    +W+     T+E  ++ VLIRGRAQTIRAVGK
Sbjct  49   VDDEQDPLAANYGDVPLNEIQSKTVEDVSRWN-----TSE--NRSVLIRGRAQTIRAVGK  101

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             +AF+VVR+RGFTVQCV TV PD VS QMVKY   LS+ESI+D+EGVVSVP+V+IKG T
Sbjct  102  NMAFVVVRERGFTVQCVATVQPDTVSRQMVKYVAGLSRESIIDIEGVVSVPSVEIKGTT  160



>gb|ABX46072.1| aspartyl transcarbamylase, partial [Citrus medica]
Length=217

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +A+SGR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEALSGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++A SLS ESIVDV GVVSVP V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFARSLSNESIVDVIGVVSVPXVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46082.1| aspartyl transcarbamylase, partial [Citrus limettioides]
Length=217

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYG++PL +L S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGNVPLQELPSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46117.1| aspartyl transcarbamylase, partial [Citrus japonica var. margarita]
Length=217

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/121 (60%), Positives = 91/121 (75%), Gaps = 10/121 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  A  576
            A
Sbjct  178  A  178



>gb|ABX46104.1| aspartyl transcarbamylase, partial [Citrus nobilis]
Length=217

 Score =   144 bits (364),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PL  NYGD+PL +L+S          +AV+GR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLVNNYGDVPLQELQSVNDPQTGKWSEAVNGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46083.1| aspartyl transcarbamylase, partial [Citrus unshiu]
 gb|ABX46089.1| aspartyl transcarbamylase, partial [Citrus reticulata]
 gb|ABX46097.1| aspartyl transcarbamylase, partial [Citrus aurantium]
 gb|ABX46101.1| aspartyl transcarbamylase, partial [Citrus sinensis]
Length=217

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46086.1| aspartyl transcarbamylase, partial [Citrus limon]
Length=217

 Score =   144 bits (363),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46118.1| aspartyl transcarbamylase, partial [Citrus japonica var. margarita]
Length=217

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/121 (59%), Positives = 91/121 (75%), Gaps = 10/121 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+G +W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGTEWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R +TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVWTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  A  576
            A
Sbjct  178  A  178



>gb|ABX46098.1| aspartyl transcarbamylase, partial [Citrus aurantium]
Length=217

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA +YGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANHYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46107.1| aspartyl transcarbamylase, partial [Citrus maxima]
Length=217

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA +YGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANHYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS  SIVDV GVVSVPNV+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVXPDSVSKEMVRFVRSLSNXSIVDVIGVVSVPNVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46103.1| aspartyl transcarbamylase, partial [Citrus nobilis]
Length=217

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PL  NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLVNNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|KDO36985.1| hypothetical protein CISIN_1g013856mg [Citrus sinensis]
Length=435

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  59   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  118

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  119  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  178

Query  574  AT  579
            AT
Sbjct  179  AT  180



>ref|XP_008801441.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
Length=543

 Score =   148 bits (373),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP + NYGDIP +D++SKAVSGR+W++IG+L AEL ++ VLIRG AQ IR V KK+AF+V
Sbjct  57   DPFSGNYGDIPTEDIQSKAVSGRQWAEIGSLDAELAERMVLIRGAAQAIRPVSKKMAFLV  116

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL V  + VS QMVK+AT+LSKESIVDVEGVVS+P   IKG T
Sbjct  117  LRQYVSTVQCVLVVNKEWVSPQMVKFATALSKESIVDVEGVVSIPKDPIKGTT  169



>gb|ABX46099.1| aspartyl transcarbamylase, partial [Citrus aurantium]
Length=217

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 72/122 (59%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+   TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVREXVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|KCW48297.1| hypothetical protein EUGRSUZ_K02027 [Eucalyptus grandis]
Length=376

 Score =   145 bits (366),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPLA NYG++PL +L+SK      ++ IGAL  E+KD+ V++RGRAQTIRAVGKK+A
Sbjct  46   DEEDPLAGNYGEVPLPELQSKEEVREPYTAIGALAEEMKDETVVVRGRAQTIRAVGKKMA  105

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR++GFTVQCV+T    LVS QMVK+  SL++ESIVDV G ++VP+  IKGAT
Sbjct  106  FVVVREKGFTVQCVVTEKEGLVSRQMVKFVASLNRESIVDVHGSLTVPSSPIKGAT  161



>ref|XP_008809075.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
 ref|XP_008809076.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Phoenix 
dactylifera]
Length=546

 Score =   147 bits (370),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 88/113 (78%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP + NYGD+P ++++SKA+SGR+W++IG+L AEL D+ VLIRG AQ IR V KK+ F+V
Sbjct  60   DPFSGNYGDVPTEEIQSKAISGRRWTEIGSLDAELADRTVLIRGAAQAIRPVSKKMVFLV  119

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR    TVQCVL V  + VS QMVK+AT LSKESIVDVEGVVS+P   IKG T
Sbjct  120  VRHSVSTVQCVLVVNKECVSPQMVKFATGLSKESIVDVEGVVSIPKEPIKGTT  172



>gb|ABX46100.1| aspartyl transcarbamylase, partial [Citrus aurantium]
Length=217

 Score =   139 bits (351),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA +YGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANHYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+   TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVREXVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|KDO46759.1| hypothetical protein CISIN_1g008808mg [Citrus sinensis]
Length=435

 Score =   144 bits (362),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  59   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  118

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  119  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  178

Query  574  AT  579
            AT
Sbjct  179  AT  180



>ref|XP_010036668.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Eucalyptus 
grandis]
 gb|KCW48296.1| hypothetical protein EUGRSUZ_K02027 [Eucalyptus grandis]
Length=535

 Score =   144 bits (364),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/116 (60%), Positives = 91/116 (78%), Gaps = 0/116 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPLA NYG++PL +L+SK      ++ IGAL  E+KD+ V++RGRAQTIRAVGKK+A
Sbjct  46   DEEDPLAGNYGEVPLPELQSKEEVREPYTAIGALAEEMKDETVVVRGRAQTIRAVGKKMA  105

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+VVR++GFTVQCV+T    LVS QMVK+  SL++ESIVDV G ++VP+  IKGAT
Sbjct  106  FVVVREKGFTVQCVVTEKEGLVSRQMVKFVASLNRESIVDVHGSLTVPSSPIKGAT  161



>ref|XP_009390472.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   144 bits (364),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 91/113 (81%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLAANYGD+ ++D++SKA+SGR+W++IGAL  +L  + VLIRG AQTIR V KK+AF+V
Sbjct  74   DPLAANYGDVLVEDIQSKAISGREWTEIGALGVDLACRAVLIRGVAQTIRPVSKKMAFVV  133

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVLTV  + VS  MVK+AT LSKESIVDVEG++S+P   IKG T
Sbjct  134  LRQFMSTVQCVLTVDKEFVSPHMVKFATGLSKESIVDVEGMISIPKDPIKGTT  186



>gb|KDP45577.1| hypothetical protein JCGZ_17184 [Jatropha curcas]
Length=594

 Score =   144 bits (363),  Expect = 9e-37, Method: Composition-based stats.
 Identities = 70/117 (60%), Positives = 93/117 (79%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            +  DPLAANYG++PL DL+S   +   +W+ +G L   LKDK VLI GRAQT RAVGK +
Sbjct  45   EEEDPLAANYGNVPLVDLQSNEEADLSEWTRVGDLNEGLKDKTVLISGRAQTTRAVGKNM  104

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+VVR++GFTVQCV+TV P++VS QMVK+  +LS+ESI++V+GV+SVP+V IKG T
Sbjct  105  AFVVVRQKGFTVQCVVTVQPEVVSRQMVKFVAALSRESIIEVQGVISVPSVPIKGTT  161



>ref|XP_010929419.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Elaeis guineensis]
Length=547

 Score =   144 bits (362),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP + NYGD+P ++++SKAVSGR+W++IG+L AE  ++ VLIRG AQ IR V KK+AF+V
Sbjct  61   DPFSGNYGDVPTEEIQSKAVSGRQWTEIGSLDAERAERMVLIRGAAQAIRPVSKKMAFLV  120

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR+   TVQCVL V  + VS QMVK+AT LSKESIVDVEGVVS+P   IKG T
Sbjct  121  VRQYVSTVQCVLVVNKEWVSPQMVKFATGLSKESIVDVEGVVSIPKDPIKGTT  173



>ref|XP_006422161.1| hypothetical protein CICLE_v10004669mg [Citrus clementina]
 ref|XP_006490529.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Citrus sinensis]
 gb|ESR35401.1| hypothetical protein CICLE_v10004669mg [Citrus clementina]
 gb|KDO46758.1| hypothetical protein CISIN_1g008808mg [Citrus sinensis]
Length=553

 Score =   143 bits (360),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 91/122 (75%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  59   PLANNYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  118

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VVR+R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  119  VGNKLAFVVVRERVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  178

Query  574  AT  579
            AT
Sbjct  179  AT  180



>ref|XP_003550250.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Glycine 
max]
Length=544

 Score =   142 bits (359),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/117 (61%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPL  NYGD+PL +L+SK  S   +W+ + AL   L++  VLIRGRAQ IR VGKK+
Sbjct  54   DEEDPLGGNYGDVPLVELQSKTPSDVGEWTRVEALGGALENNSVLIRGRAQAIRPVGKKM  113

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+V+R+ GFTVQC++   PD VS QMVK+A +LS+ESIVDVEGVVSVP   IKGAT
Sbjct  114  AFLVIRENGFTVQCLVQAQPDTVSAQMVKFAAALSRESIVDVEGVVSVPTAPIKGAT  170



>ref|XP_003588866.1| Aspartyl-tRNA synthetase [Medicago truncatula]
 gb|AES59117.1| aspartate-tRNA ligase [Medicago truncatula]
Length=541

 Score =   142 bits (357),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 70/114 (61%), Positives = 89/114 (78%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DPLA NYG +PL +L+SK  +    W+ + AL   L++K+VLIRGRAQ IR VGKK+AF+
Sbjct  54   DPLAVNYGIVPLIELQSKTPANVNDWTRVEALNDSLENKQVLIRGRAQAIRPVGKKMAFL  113

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            V+R+ GFTVQC++   PDLVS QMVK+A +LS+ESIVDVEGVVS+P   IKGAT
Sbjct  114  VIRENGFTVQCLVQAQPDLVSPQMVKFAAALSRESIVDVEGVVSIPAAPIKGAT  167



>gb|KCW82584.1| hypothetical protein EUGRSUZ_C03981 [Eucalyptus grandis]
 gb|KCW82585.1| hypothetical protein EUGRSUZ_C03981 [Eucalyptus grandis]
Length=415

 Score =   140 bits (353),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLAANYG++PL DL+SK   G  ++++GAL   ++ + VL+RGRAQ IRAVGKK+AF+V
Sbjct  53   DPLAANYGEVPLPDLQSKEEVGEPYTEVGALGEGMQGRSVLVRGRAQAIRAVGKKMAFVV  112

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR+RGFTVQCV+T     VS QMVK+  SL++ESIVDV G ++VP+  IKGA+
Sbjct  113  VRERGFTVQCVVTEQEGSVSRQMVKFVASLNRESIVDVRGTLTVPSSPIKGAS  165



>ref|XP_010927161.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Elaeis guineensis]
 ref|XP_010927162.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Elaeis guineensis]
Length=543

 Score =   141 bits (356),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP + NYGD+P ++++SKA+SGR+W++IG+L AEL    VLIRG AQ IR V KK+ F+V
Sbjct  57   DPFSGNYGDVPTEEIQSKAISGRRWTEIGSLDAELAGSTVLIRGAAQAIRPVSKKMVFLV  116

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR    TVQCVL V  + VS QMVK+AT LSKES+VD+EGVVS+P   IKG T
Sbjct  117  VRHYVSTVQCVLVVNKECVSPQMVKFATGLSKESVVDIEGVVSIPKDPIKGTT  169



>ref|XP_004512467.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cicer arietinum]
Length=538

 Score =   140 bits (354),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 88/114 (77%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKA-VSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            DP AANYGD+PL +L+SK  V   +W+ + AL   L ++ VLIRGR QTIR VGKK+AF+
Sbjct  51   DPFAANYGDVPLVELQSKTPVDVNEWTRVEALDDSLANRPVLIRGRTQTIRPVGKKMAFL  110

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            V+R+ GFTVQC++   PD VS QMVK+A +LS+ES+VDVEGVVS+P   IKGAT
Sbjct  111  VIRENGFTVQCLVQAQPDSVSPQMVKFAAALSRESVVDVEGVVSIPAAPIKGAT  164



>ref|XP_004498802.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Cicer arietinum]
Length=539

 Score =   140 bits (353),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 90/119 (76%), Gaps = 3/119 (3%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKA-VSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGK  402
            +DD  DPLA NYGD+PL +L+SK  V    W+ + AL   L ++ V IRGRAQTIR VGK
Sbjct  49   VDD--DPLAVNYGDVPLIELQSKTPVDVNDWTKVEALDDSLANRPVQIRGRAQTIRPVGK  106

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            K+AF+VVR+ GFTVQC++   PD VS QMVK+A +LS+ES+VDVEG+VS+P   IKGAT
Sbjct  107  KMAFLVVRENGFTVQCLVQAQPDSVSSQMVKFAAALSRESVVDVEGIVSIPAAPIKGAT  165



>ref|XP_010049784.1| PREDICTED: LOW QUALITY PROTEIN: aspartate--tRNA ligase, cytoplasmic 
[Eucalyptus grandis]
Length=546

 Score =   139 bits (351),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 89/113 (79%), Gaps = 0/113 (0%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLAANYG++PL DL+SK   G  ++++GAL   ++ + VL+RGRAQ IRAVGKK+AF+V
Sbjct  53   DPLAANYGEVPLPDLQSKEEVGEPYTEVGALGEGMQGRSVLVRGRAQAIRAVGKKMAFVV  112

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR+RGFTVQCV+T     VS QMVK+  SL++ESIVDV G ++VP+  IKGA+
Sbjct  113  VRERGFTVQCVVTEQEGSVSRQMVKFVASLNRESIVDVRGTLTVPSSPIKGAS  165



>ref|XP_003544559.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Glycine 
max]
Length=543

 Score =   139 bits (349),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/117 (58%), Positives = 89/117 (76%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPL  NYGD+PL +L+SK  +   +W+ + AL   L+++ VLIRGRAQ IR VGKK+
Sbjct  53   DEEDPLGGNYGDVPLVELQSKTSADVGEWTRVEALGGALENRSVLIRGRAQAIRPVGKKM  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+V+R+ GFTVQC++    D VS QMVK+A +LS+ESIVDVEGVVS+P+  IKGAT
Sbjct  113  AFLVIRENGFTVQCLVQAQADTVSPQMVKFAAALSRESIVDVEGVVSIPSAPIKGAT  169



>gb|ABX46079.1| aspartyl transcarbamylase, partial [Citrus aurantiifolia]
Length=217

 Score =   133 bits (334),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 90/122 (74%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +A SGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAXSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VV +   TVQC+ TV PD VS +MV++A SLS ESIVDV GV+SVP+V+IKG
Sbjct  118  VGNKLAFVVVXEXVSTVQCLATVKPDSVSKEMVRFARSLSNESIVDVIGVISVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_007160941.1| hypothetical protein PHAVU_001G030000g [Phaseolus vulgaris]
 gb|ESW32935.1| hypothetical protein PHAVU_001G030000g [Phaseolus vulgaris]
Length=541

 Score =   137 bits (346),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D  DPLAANYGD+PL +L+SK  +    W+ + AL   L++K VLIRG AQTIR VGKK+
Sbjct  51   DEDDPLAANYGDVPLVELQSKTPANVDDWTPVEALGVALENKTVLIRGTAQTIRPVGKKM  110

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+V+R   FTVQC++   PD VS QMVK+A SL++ESIVDVEGVV++P   IKGAT
Sbjct  111  AFLVIRDDYFTVQCLVQAQPDTVSPQMVKFAASLNRESIVDVEGVVTIPTAPIKGAT  167



>dbj|BAJ99106.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=544

 Score =   137 bits (345),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 88/117 (75%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  DP AANYGD+P+++++SK +SGR W+DIG L      + VLIRG AQT+R V KK+A
Sbjct  54   EEADPFAANYGDVPVEEIQSKVISGRTWTDIGDLDEAAAGRSVLIRGSAQTLRPVSKKMA  113

Query  412  FIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+   TVQCVL  +PD  VS QMV++ATSLSKESIVDVEG+V++P   +K  T
Sbjct  114  FVVLRQSMSTVQCVLVASPDAGVSTQMVRFATSLSKESIVDVEGIVTLPKEPLKATT  170



>gb|ABX46080.1| aspartyl transcarbamylase, partial [Citrus aurantiifolia]
Length=217

 Score =   131 bits (330),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +A SGR+W+++GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANNYGDVPLQELQSVNDPQTGKWSEAXSGREWTEVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VV +   TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVXEXVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|ABX46106.1| aspartyl transcarbamylase, partial [Citrus maxima]
Length=217

 Score =   130 bits (327),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 71/122 (58%), Positives = 89/122 (73%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA +YGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANHYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VV +   TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVPNV+IKG
Sbjct  118  VGNKLAFVVVXEXVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPNVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>ref|XP_004967463.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Setaria 
italica]
Length=547

 Score =   135 bits (339),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D+ DP AANYGD+P+++++SKA+SGR W+ IG L A    + VLIRG  Q IR V KK+A
Sbjct  57   DAEDPFAANYGDVPVEEIQSKAISGRSWTKIGDLDAAAAGRSVLIRGATQAIRPVSKKMA  116

Query  412  FIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+   TVQCVL  + D  VS QMV++AT+LSKESIVDVEGVVS+P   +K  T
Sbjct  117  FVVLRQSMSTVQCVLVASADAGVSTQMVRFATALSKESIVDVEGVVSLPKEPLKATT  173



>gb|ACG48784.1| hypothetical protein [Zea mays]
 gb|AFW80450.1| hypothetical protein ZEAMMB73_076937 [Zea mays]
Length=228

 Score =   130 bits (326),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP AANYGD+P+++++SKA+SGR WS IG L      + VLIRG  Q IR V KK+AF+V
Sbjct  58   DPFAANYGDVPVEEIQSKAISGRLWSQIGDLDDSSAGRSVLIRGSLQAIRPVSKKMAFVV  117

Query  421  VRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL  + D  VS QMV++AT+LSKESIVDVEGVVS+P   +K  T
Sbjct  118  LRQSMSTVQCVLVASADAGVSTQMVRFATALSKESIVDVEGVVSLPKEPLKATT  171



>gb|ACN28001.1| unknown [Zea mays]
 gb|AFW70024.1| aspartyl-tRNA synthetase [Zea mays]
Length=546

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D+ DP AANYG++P+++++SKA+SGR WS +G L      + VLIRG AQ IR V KK+A
Sbjct  56   DAEDPFAANYGEVPVEEIQSKAISGRSWSHVGDLDDSAAGRSVLIRGAAQAIRPVSKKMA  115

Query  412  FIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+   TVQCVL  + D  VS QMV++AT+LSKESIVDVEGVVS+P   +K  T
Sbjct  116  FVVLRQSMSTVQCVLVASADAGVSTQMVRFATALSKESIVDVEGVVSLPKEPLKATT  172



>ref|NP_001149817.1| LOC100283444 [Zea mays]
 gb|ACG36897.1| aspartyl-tRNA synthetase [Zea mays]
Length=546

 Score =   133 bits (334),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D+ DP AANYG++P+++++SKA+SGR WS +G L      + VLIRG AQ IR V KK+A
Sbjct  56   DAEDPFAANYGEVPVEEIQSKAISGRSWSHVGDLDDSAAGRSVLIRGAAQAIRPVSKKMA  115

Query  412  FIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+   TVQCVL  + D  VS QMV++AT+LSKESIVDVEGVVS+P   +K  T
Sbjct  116  FVVLRQSMSTVQCVLVASADAGVSTQMVRFATALSKESIVDVEGVVSLPKEPLKATT  172



>gb|EMT03438.1| Aspartyl-tRNA synthetase, cytoplasmic [Aegilops tauschii]
Length=563

 Score =   133 bits (334),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 66/117 (56%), Positives = 87/117 (74%), Gaps = 1/117 (1%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  D  AANYGD+P+++++SKA+SGR W+DIG L      + VLIRG AQT+R V KK+A
Sbjct  54   EEADLFAANYGDVPVEEIQSKAISGRSWTDIGDLDEAAAGRSVLIRGSAQTLRPVSKKMA  113

Query  412  FIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+   TVQCVL  + D  VS QMV++ATSLSKESIVDVEGVV++P   +K  T
Sbjct  114  FVVLRQSMSTVQCVLVASADAGVSTQMVRFATSLSKESIVDVEGVVTLPKEPLKATT  170



>gb|ABX46105.1| aspartyl transcarbamylase, partial [Citrus maxima]
Length=217

 Score =   128 bits (321),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 70/122 (57%), Positives = 89/122 (73%), Gaps = 10/122 (8%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA +YGD+PL +L+S          +AV+GR+W+ +GAL   LKD+EVLIRGR  T R 
Sbjct  58   PLANHYGDVPLQELQSVNDPQTGKWSEAVNGREWTVVGALNGSLKDQEVLIRGRVHTTRP  117

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VG K+AF+VV +   TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  118  VGNKLAFVVVXEXVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  177

Query  574  AT  579
            AT
Sbjct  178  AT  179



>gb|EYU29913.1| hypothetical protein MIMGU_mgv1a018492mg, partial [Erythranthe 
guttata]
Length=454

 Score =   132 bits (332),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 88/115 (77%), Gaps = 2/115 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDL-KSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAF  414
            DPL  NYGDI L +   SK +SG+K  + +  L   LK   V++RGRAQ IRAVGKK+AF
Sbjct  57   DPLRTNYGDITLKEFASSKPISGKKKRTLVQDLNDGLKGNMVVVRGRAQAIRAVGKKMAF  116

Query  415  IVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VVR+RG TVQCVLTV+ DLVS QMVK+ATSLS+ESI+++EG+VSVP   I GAT
Sbjct  117  LVVRRRGCTVQCVLTVSQDLVSSQMVKFATSLSRESIIEIEGLVSVPAQPITGAT  171



>ref|XP_010238758.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X1 
[Brachypodium distachyon]
Length=588

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP AANYGD+P+++++SKA+SGR W+DIG L      + VLIRG AQ +R V KK+AF+V
Sbjct  71   DPFAANYGDVPVEEIQSKAISGRVWTDIGDLGEADAGRSVLIRGAAQAMRPVSKKMAFLV  130

Query  421  VRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL    +  VS QMV++ATSLSKESIVDVEGVVSVP   +K  T
Sbjct  131  MRQSMSTVQCVLVATAEAGVSTQMVRFATSLSKESIVDVEGVVSVPKEPLKATT  184



>ref|XP_007011471.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
 gb|EOY29090.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 2 [Theobroma cacao]
Length=526

 Score =   132 bits (333),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            D  DP ++NYGD+PL +LKS          +AV+    + +GALT ELK+KEVLIRGRA 
Sbjct  44   DEEDPHSSNYGDVPLPELKSCSQADAGNWSRAVASMVRTQVGALTQELKEKEVLIRGRAH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            TIR VGK +AF+VVRK+GFTVQC+       VS QMVK+   L++ESIVDV GVVSVP  
Sbjct  104  TIRPVGKNMAFLVVRKKGFTVQCLAATQSMGVSRQMVKFVAGLNRESIVDVIGVVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>ref|XP_007011472.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 3 [Theobroma cacao]
 gb|EOY29091.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 3 [Theobroma cacao]
Length=506

 Score =   132 bits (332),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            D  DP ++NYGD+PL +LKS          +AV+    + +GALT ELK+KEVLIRGRA 
Sbjct  44   DEEDPHSSNYGDVPLPELKSCSQADAGNWSRAVASMVRTQVGALTQELKEKEVLIRGRAH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            TIR VGK +AF+VVRK+GFTVQC+       VS QMVK+   L++ESIVDV GVVSVP  
Sbjct  104  TIRPVGKNMAFLVVRKKGFTVQCLAATQSMGVSRQMVKFVAGLNRESIVDVIGVVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>ref|XP_006657639.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Oryza brachyantha]
Length=545

 Score =   132 bits (333),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 86/118 (73%), Gaps = 1/118 (1%)
 Frame = +1

Query  229  DDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D   DP AANYGD+P+++++SKA+SGR W+ +G L      + VLIRG AQ IR V KK+
Sbjct  54   DAEEDPYAANYGDVPVEEIQSKAISGRSWTGVGDLDEAAAGRSVLIRGAAQAIRPVSKKM  113

Query  409  AFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            AF+V+R+   TVQCVL  + D  VS QMV++ATSLSKESIVDVEGVVS+P   +K  T
Sbjct  114  AFVVLRESMSTVQCVLVASADAGVSTQMVRFATSLSKESIVDVEGVVSLPKEPLKATT  171



>ref|XP_007011470.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
 gb|EOY29089.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
isoform 1 [Theobroma cacao]
Length=543

 Score =   132 bits (332),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 87/126 (69%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            D  DP ++NYGD+PL +LKS          +AV+    + +GALT ELK+KEVLIRGRA 
Sbjct  44   DEEDPHSSNYGDVPLPELKSCSQADAGNWSRAVASMVRTQVGALTQELKEKEVLIRGRAH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            TIR VGK +AF+VVRK+GFTVQC+       VS QMVK+   L++ESIVDV GVVSVP  
Sbjct  104  TIRPVGKNMAFLVVRKKGFTVQCLAATQSMGVSRQMVKFVAGLNRESIVDVIGVVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>gb|EYU28247.1| hypothetical protein MIMGU_mgv1a004064mg [Erythranthe guttata]
Length=546

 Score =   131 bits (330),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 91/120 (76%), Gaps = 2/120 (2%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDL-KSKAVSGRK-WSDIGALTAELKDKEVLIRGRAQTIRAVG  399
            ++   DPL  NYGDI L +L  SK +SG+K  + +  L   LK   V++RGRAQ IRAVG
Sbjct  51   LEGDEDPLRTNYGDITLKELASSKPISGKKKRTLVQDLNDGLKGNMVVVRGRAQAIRAVG  110

Query  400  KKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            KK+AF+VVR+RG TVQC+LTV+ DLVS QMVK+ATSL++ESI+++EG+VS+P   I GAT
Sbjct  111  KKMAFLVVRRRGCTVQCILTVSQDLVSSQMVKFATSLTRESIIEIEGLVSLPAQPITGAT  170



>ref|XP_003578963.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like isoform X2 
[Brachypodium distachyon]
Length=558

 Score =   131 bits (329),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP AANYGD+P+++++SKA+SGR W+DIG L      + VLIRG AQ +R V KK+AF+V
Sbjct  71   DPFAANYGDVPVEEIQSKAISGRVWTDIGDLGEADAGRSVLIRGAAQAMRPVSKKMAFLV  130

Query  421  VRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL    +  VS QMV++ATSLSKESIVDVEGVVSVP   +K  T
Sbjct  131  MRQSMSTVQCVLVATAEAGVSTQMVRFATSLSKESIVDVEGVVSVPKEPLKATT  184



>ref|NP_001145746.1| hypothetical protein [Zea mays]
 gb|ACL52520.1| unknown [Zea mays]
 gb|AFW80451.1| hypothetical protein ZEAMMB73_076937 [Zea mays]
Length=545

 Score =   129 bits (325),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 66/114 (58%), Positives = 84/114 (74%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP AANYGD+P+++++SKA+SGR WS IG L      + VLIRG  Q IR V KK+AF+V
Sbjct  58   DPFAANYGDVPVEEIQSKAISGRLWSQIGDLDDSSAGRSVLIRGSLQAIRPVSKKMAFVV  117

Query  421  VRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL  + D  VS QMV++AT+LSKESIVDVEGVVS+P   +K  T
Sbjct  118  LRQSMSTVQCVLVASADAGVSTQMVRFATALSKESIVDVEGVVSLPKEPLKATT  171



>ref|NP_001047770.1| Os02g0686400 [Oryza sativa Japonica Group]
 dbj|BAD07576.1| putative aspartate-tRNA ligase [Oryza sativa Japonica Group]
 dbj|BAF09684.1| Os02g0686400 [Oryza sativa Japonica Group]
 dbj|BAG93847.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE57599.1| hypothetical protein OsJ_07966 [Oryza sativa Japonica Group]
Length=549

 Score =   127 bits (319),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = +1

Query  247  LAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
             AANYGD+P+++++SK +SGR W++IG L      + VLIRG AQ IR V KK+AF+V+R
Sbjct  64   FAANYGDVPVEEIQSKTISGRVWTEIGGLDEAAAGRSVLIRGAAQAIRPVSKKMAFVVLR  123

Query  427  KRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +   TVQCVL  + D  VS QMV++ATSLSKESIVDVEGVVS+P   +K  T
Sbjct  124  ESMSTVQCVLVASADAGVSTQMVRFATSLSKESIVDVEGVVSLPKEPLKATT  175



>gb|EEC73805.1| hypothetical protein OsI_08509 [Oryza sativa Indica Group]
Length=549

 Score =   127 bits (318),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 83/112 (74%), Gaps = 1/112 (1%)
 Frame = +1

Query  247  LAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
             AANYGD+P+++++SK +SGR W+++G L      + VLIRG AQ IR V KK+AF+V+R
Sbjct  64   FAANYGDVPVEEIQSKTISGRVWTEVGGLDEAAAGRSVLIRGAAQAIRPVSKKMAFVVLR  123

Query  427  KRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +   TVQCVL  + D  VS QMV++ATSLSKESIVDVEGVVS+P   +K  T
Sbjct  124  ESMSTVQCVLVASADAGVSTQMVRFATSLSKESIVDVEGVVSLPKEPLKATT  175



>gb|KHG15734.1| Aspartate--tRNA ligase, cytoplasmic [Gossypium arboreum]
Length=543

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 84/126 (67%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +  DP ++NYGD+ L +LKS           A+S   W+ +GALT ELK+KEVLIRGR  
Sbjct  44   EEEDPYSSNYGDVTLPELKSCSKPDAGNWSMAISSMDWTRVGALTQELKEKEVLIRGRVH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            T R V K +AF+VVR+RGFTVQC++      VS QMVK+  +L++ESI+D  G+VSVP  
Sbjct  104  TTRPVSKNMAFVVVRERGFTVQCLVATHEAGVSRQMVKFVAALNRESIIDAIGMVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>gb|KJB06560.1| hypothetical protein B456_001G001300 [Gossypium raimondii]
Length=394

 Score =   123 bits (308),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSK----------AVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +  D  ++NYGD+ L +LKS           A+S   W+ +GALT ELK+KEVLIRGR  
Sbjct  44   EEEDSYSSNYGDVTLPELKSCSKPDAGNWSIAISSMDWTRVGALTEELKEKEVLIRGRVH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            T R V K +AF+VVR+RGFTVQC++      VS QMVK+  +L++ESI+D  G+VSVP  
Sbjct  104  TTRPVSKNMAFVVVRERGFTVQCLVATHEAGVSRQMVKFVAALNRESIIDAIGMVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>gb|KJB06559.1| hypothetical protein B456_001G001300 [Gossypium raimondii]
Length=485

 Score =   122 bits (306),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSK----------AVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +  D  ++NYGD+ L +LKS           A+S   W+ +GALT ELK+KEVLIRGR  
Sbjct  44   EEEDSYSSNYGDVTLPELKSCSKPDAGNWSIAISSMDWTRVGALTEELKEKEVLIRGRVH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            T R V K +AF+VVR+RGFTVQC++      VS QMVK+  +L++ESI+D  G+VSVP  
Sbjct  104  TTRPVSKNMAFVVVRERGFTVQCLVATHEAGVSRQMVKFVAALNRESIIDAIGMVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>gb|KJB06558.1| hypothetical protein B456_001G001300 [Gossypium raimondii]
Length=543

 Score =   122 bits (306),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/126 (50%), Positives = 83/126 (66%), Gaps = 10/126 (8%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSK----------AVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +  D  ++NYGD+ L +LKS           A+S   W+ +GALT ELK+KEVLIRGR  
Sbjct  44   EEEDSYSSNYGDVTLPELKSCSKPDAGNWSIAISSMDWTRVGALTEELKEKEVLIRGRVH  103

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNV  561
            T R V K +AF+VVR+RGFTVQC++      VS QMVK+  +L++ESI+D  G+VSVP  
Sbjct  104  TTRPVSKNMAFVVVRERGFTVQCLVATHEAGVSRQMVKFVAALNRESIIDAIGMVSVPGN  163

Query  562  QIKGAT  579
             IKG T
Sbjct  164  PIKGTT  169



>ref|XP_006660416.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Oryza brachyantha]
Length=543

 Score =   122 bits (305),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/112 (54%), Positives = 82/112 (73%), Gaps = 1/112 (1%)
 Frame = +1

Query  247  LAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
             AANYGD+P+++++SK +SGR W++I  L      + V+IRG AQ IR V KK+AF+V+R
Sbjct  58   FAANYGDVPVEEIQSKTISGRVWTEIADLDDAAAGRSVIIRGAAQAIRPVSKKMAFVVLR  117

Query  427  KRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +   TVQCVL  + D  VS QMV++ATSLSKESIVD+EGVVS+P   +K  T
Sbjct  118  QSMCTVQCVLVASVDAGVSTQMVRFATSLSKESIVDIEGVVSLPKEPLKATT  169



>gb|EYU31296.1| hypothetical protein MIMGU_mgv1a019826mg, partial [Erythranthe 
guttata]
Length=634

 Score =   122 bits (306),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 2/110 (2%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDL-KSKAVSGRKWSD-IGALTAELKDKEVLIRGRAQTIRAVG  399
            ++   DPL  NYGDI L +L  SK +SG+K    +  L   LK   V++RGR Q IRAVG
Sbjct  56   LEGDEDPLRTNYGDITLKELASSKPISGKKKRTLVQDLNDGLKGNMVVVRGRVQAIRAVG  115

Query  400  KKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVS  549
            KK+ F+VVR+RG TVQCVLTV+ DLVS QMVK+ATSLS+ESI+++EG+VS
Sbjct  116  KKMVFLVVRRRGCTVQCVLTVSQDLVSSQMVKFATSLSRESIIEIEGLVS  165



>gb|KDO36984.1| hypothetical protein CISIN_1g013856mg [Citrus sinensis]
Length=417

 Score =   115 bits (287),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 64/122 (52%), Positives = 79/122 (65%), Gaps = 28/122 (23%)
 Frame = +1

Query  244  PLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            PLA NYGD+PL +L+S          +AVSGR+W+++GAL   LKD+EVLIRGR      
Sbjct  59   PLANNYGDVPLQELQSVNDPQTGKWSEAVSGREWTEVGALNGSLKDQEVLIRGR------  112

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
                        R  TVQC+ TV PD VS +MV++  SLS ESIVDV GVVSVP+V+IKG
Sbjct  113  ------------RVSTVQCLATVKPDSVSKEMVRFVRSLSNESIVDVIGVVSVPDVEIKG  160

Query  574  AT  579
            AT
Sbjct  161  AT  162



>ref|XP_003575513.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Brachypodium 
distachyon]
Length=539

 Score =   115 bits (288),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 59/114 (52%), Positives = 78/114 (68%), Gaps = 1/114 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP A NYGD+   ++  KA+SG  W+ +G L      + VLIR RA TIR VG+K+AF+V
Sbjct  52   DPFAENYGDVLPGEILPKAISGEPWTKVGHLDEAAVGRSVLIRARAHTIRPVGRKMAFVV  111

Query  421  VRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCVL V+ D  +S QMV++A SL KES+V VEGVVS+P   +K AT
Sbjct  112  LRQGMSTVQCVLVVSADAGISAQMVRFAASLPKESVVAVEGVVSLPKEDLKSAT  165



>gb|KCW78843.1| hypothetical protein EUGRSUZ_C00281 [Eucalyptus grandis]
Length=503

 Score =   113 bits (283),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 80/113 (71%), Gaps = 9/113 (8%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA NYG+  +         G  ++++GAL   ++ + VL+RGRAQ IRAVGKK+AF+ 
Sbjct  368  DPLAVNYGEEEV---------GEPYTEVGALGEGMQGRSVLVRGRAQAIRAVGKKMAFVA  418

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR+RGFTVQCV+T     VS QMVK+  SL++ESIVDV G +++P+  +KGA+
Sbjct  419  VRERGFTVQCVVTEQEGSVSRQMVKFVASLNRESIVDVRGTLTLPSSPMKGAS  471



>ref|XP_002983062.1| hypothetical protein SELMODRAFT_117697 [Selaginella moellendorffii]
 gb|EFJ15871.1| hypothetical protein SELMODRAFT_117697 [Selaginella moellendorffii]
Length=521

 Score =   110 bits (274),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA  YGD  L+DL+SKAV+GRKW++I  L  +L+   VL+RGR  + RA G K+AF+V
Sbjct  34   DPLADKYGDTKLEDLQSKAVTGRKWTEISELGTDLEGSTVLVRGRVHSKRAKG-KMAFLV  92

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCV+++  ++ S Q VKYA+ LSKES+VDV G VS P   + G T
Sbjct  93   LRETIHTVQCVVSME-NVGSKQFVKYASLLSKESVVDVTGNVSNPRNPVSGTT  144



>ref|XP_002965575.1| hypothetical protein SELMODRAFT_84215 [Selaginella moellendorffii]
 gb|EFJ32995.1| hypothetical protein SELMODRAFT_84215 [Selaginella moellendorffii]
Length=521

 Score =   109 bits (273),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 59/113 (52%), Positives = 80/113 (71%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA  YGD  L+DL+SKAV+GRKW++I  L  +L+   VL+RGR  + RA G K+AF+V
Sbjct  34   DPLADKYGDTKLEDLQSKAVTGRKWTEISELGTDLEGSTVLVRGRVHSKRAKG-KMAFLV  92

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+   TVQCV+++  ++ S Q VKYA+ LSKES+VDV G VS P   + G T
Sbjct  93   LRETIHTVQCVVSME-NVGSKQFVKYASLLSKESVVDVTGNVSNPRNPVSGTT  144



>ref|XP_010526284.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Tarenaya hassleriana]
Length=566

 Score =   109 bits (272),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 80/124 (65%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSK----------AVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            DP + NYG++ L +L+S           AV GR+W+++  L   +K +EVLIRGR  + R
Sbjct  69   DPHSDNYGEVTLTELQSTPDSGAGKWIAAVEGREWTEVKNLVEGMKGEEVLIRGRVHSTR  128

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
            AVGK + F+VVRKRGFTVQCV + + +  VS  MV +A  L++ES VDV GVVS+P   +
Sbjct  129  AVGKNMVFLVVRKRGFTVQCVASKSEEKKVSSTMVDFARRLNRESFVDVIGVVSLPKEPL  188

Query  568  KGAT  579
            K  T
Sbjct  189  KSTT  192



>gb|KFK29697.1| hypothetical protein AALP_AA7G167100 [Arabis alpina]
Length=556

 Score =   101 bits (252),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D    NYGD+ L++L+S          +AV G+KW+D+  L   + D EVLIRGR  T R
Sbjct  59   DETWKNYGDVTLNELQSTADLEAGKWIQAVEGKKWTDVCDLVESMADSEVLIRGRVHTNR  118

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K+ F+++R+ GFTVQCV   + +  VS  M+K+   LS+ES VDV G+V+VP   +
Sbjct  119  PVSSKLGFVILRESGFTVQCVANQSEENKVSSNMIKFLKQLSRESFVDVIGIVTVPKEPL  178

Query  568  KGAT  579
             G +
Sbjct  179  TGTS  182



>ref|XP_001420524.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98817.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=491

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 54/115 (47%), Positives = 77/115 (67%), Gaps = 3/115 (3%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAF  414
            +PD LA  YGD  +  ++SK ++GR W+ + AL   LKD+EVL+RGR   +R  GK  AF
Sbjct  7    APDALAHRYGDAEM--VQSKEITGRAWTRVDALNETLKDREVLLRGRVHNVRGKGKS-AF  63

Query  415  IVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            IV+R++  TVQ  L V    VS  MVK+A++L++ES+VDV+G+V  P V I+  T
Sbjct  64   IVLRQQTATVQVTLFVDDVNVSKGMVKWASALARESVVDVKGLVVHPEVPIESCT  118



>ref|XP_010438070.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score =   100 bits (248),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 76/127 (60%), Gaps = 11/127 (9%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +  D  ++NYGD+ L++L+S          +A+ G+ W D+  L  E+ + EVLIRGR  
Sbjct  51   EENDEFSSNYGDVTLNELQSTEDPKAGKWREAIEGKNWIDVSDLVEEMAESEVLIRGRVH  110

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAP-DLVSGQMVKYATSLSKESIVDVEGVVSVPN  558
            T R V  K+ F+++R  G TVQCV++ A  + V   MVKY   LS+ES VDV GVV++P 
Sbjct  111  TNRPVSGKLGFVILRASGSTVQCVVSQAEQNKVGANMVKYLRQLSRESFVDVIGVVALPK  170

Query  559  VQIKGAT  579
              + G T
Sbjct  171  EPLTGTT  177



>ref|XP_007041300.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
[Theobroma cacao]
 gb|EOX97131.1| Class II aminoacyl-tRNA and biotin synthetases superfamily protein 
[Theobroma cacao]
Length=451

 Score = 99.0 bits (245),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/97 (52%), Positives = 69/97 (71%), Gaps = 0/97 (0%)
 Frame = +1

Query  289  SKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAP  468
            S++V+   W+ +GALT ELKDKEVLIR +AQT R +GK +AF+VVR+  FTVQC+     
Sbjct  12   SRSVASMDWTAVGALTPELKDKEVLIRRQAQTTRPMGKNMAFLVVREELFTVQCLAAPQS  71

Query  469  DLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
              VS +M+K+   L++ +I+DV GVVS+P   IKG T
Sbjct  72   AGVSRRMLKFVAGLNRGTIIDVIGVVSIPRNPIKGTT  108



>ref|XP_010432896.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score = 99.8 bits (247),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D  ++NYGD+ L++L+S          +A+ G+KW D+  L  E+ + EVLIRGR  T R
Sbjct  54   DEFSSNYGDVALNELQSTEDPKAGKWREAIEGKKWIDVSDLVEEMAESEVLIRGRVHTNR  113

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAP-DLVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K+ F+++R  G TVQCV++ +  + V   MVKY   LS+ES VDV GVV +P   +
Sbjct  114  PVSGKLGFVILRASGSTVQCVVSQSEQNKVGANMVKYLKQLSRESFVDVIGVVVLPKEPL  173

Query  568  KGAT  579
             G T
Sbjct  174  TGTT  177



>ref|XP_010447608.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=551

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 75/124 (60%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D  ++NYGD+ L++L+S          +A+ G+KW D+  L  E+ + EVLIRGR  T R
Sbjct  54   DEFSSNYGDVTLNELQSTEDPKAGKWREAIEGKKWIDVSDLVEEMAESEVLIRGRVHTNR  113

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAP-DLVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K+ F+++R  G TVQCV++ +  + V   MVKY   LS+ES VDV GVV +P   +
Sbjct  114  PVSGKLGFVILRASGSTVQCVVSQSEQNKVGANMVKYLKQLSRESFVDVIGVVVLPKEPL  173

Query  568  KGAT  579
             G T
Sbjct  174  TGTT  177



>ref|NP_849558.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 ref|NP_194847.3| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 emb|CAB79836.1| aspartate--tRNA ligase-like protein [Arabidopsis thaliana]
 dbj|BAH20270.1| AT4G31180 [Arabidopsis thaliana]
 gb|AEE85872.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 gb|AEE85873.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
Length=558

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 52/124 (42%), Positives = 74/124 (60%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D  + NYGD+ L +L+S          +AV G++W+D+  L  E+ + EVLIRGR  T R
Sbjct  61   DEFSNNYGDVTLTELQSSADPKAGKWIEAVEGKEWTDVSDLVEEMLESEVLIRGRVHTNR  120

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
                K+ F+V+R+ G TVQCV++ +    V   MVKY   LS+ES VDV GVV++P   +
Sbjct  121  PTSNKLGFVVLRESGSTVQCVVSQSEKTKVGANMVKYLKQLSRESFVDVIGVVTLPKEPL  180

Query  568  KGAT  579
             G T
Sbjct  181  TGTT  184



>ref|XP_001695300.1| aspartyl-tRNA synthetase [Chlamydomonas reinhardtii]
 gb|EDP01558.1| aspartyl-tRNA synthetase [Chlamydomonas reinhardtii]
Length=545

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/116 (46%), Positives = 71/116 (61%), Gaps = 3/116 (3%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPL   YGD P+  ++S+  + RKW+++  L  EL D+ VL+R R    R  GK  A
Sbjct  60   DPEDPLKDKYGDYPM--VQSQGQTTRKWTEVEQLEKELADQTVLVRARIHNTRGKGKS-A  116

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+R  TVQ ++      VS  MVKYAT + KESIVDVEG+V VP   I G +
Sbjct  117  FLVLRQRTATVQAIMFADETTVSKGMVKYATQIPKESIVDVEGIVKVPEKSIDGCS  172



>ref|XP_009127185.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Brassica rapa]
Length=549

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 11/119 (9%)
 Frame = +1

Query  256  NYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            NYGD+ L +L+S          +AV G+KW+++  L  E+   EVLIRGR  T R V  K
Sbjct  63   NYGDVTLTELQSTADPKAGKWREAVEGKKWTNVSELVEEIAGSEVLIRGRVHTNRPVSNK  122

Query  406  IAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+ GFTVQCV+T + +  VS  MVK+   LS ES VDV GVV +P   + G T
Sbjct  123  LGFVILRQSGFTVQCVVTESKERNVSVNMVKFLKQLSGESFVDVIGVVVLPKEPLTGTT  181



>emb|CDY28248.1| BnaA01g06010D [Brassica napus]
Length=549

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 11/119 (9%)
 Frame = +1

Query  256  NYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            NYGD+ L +L+S          +AV G+KW+++  L  E+   EVLIRGR  T R V  K
Sbjct  63   NYGDVTLTELQSTADPKAGKWREAVEGKKWTNVSELVEEIAGSEVLIRGRVHTNRPVSNK  122

Query  406  IAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+ GFTVQCV+T + +  VS  MVK+   LS ES VDV GVV +P   + G T
Sbjct  123  LGFVILRQSGFTVQCVVTESKERNVSVNMVKFLKQLSGESFVDVIGVVVLPKEPLTGTT  181



>emb|CDX68726.1| BnaC01g07270D [Brassica napus]
Length=549

 Score = 98.2 bits (243),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 53/119 (45%), Positives = 73/119 (61%), Gaps = 11/119 (9%)
 Frame = +1

Query  256  NYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            NYGD+ L +L+S          +AV G+KW+++  L  E+   EVLIRGR  T R V  K
Sbjct  63   NYGDVTLTELQSTADPKAGKWREAVEGKKWTNVSELVEEIAGSEVLIRGRVHTNRPVSSK  122

Query  406  IAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+ GFTVQCV+T + +  VS  MVK+   LS ES VDV GVV +P   + G T
Sbjct  123  LGFVILRQSGFTVQCVVTESKEKNVSVNMVKFLKQLSGESFVDVIGVVVLPKEPLTGTT  181



>ref|XP_006412619.1| hypothetical protein EUTSA_v100249450mg, partial [Eutrema salsugineum]
 gb|ESQ54072.1| hypothetical protein EUTSA_v100249450mg, partial [Eutrema salsugineum]
Length=254

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 54/131 (41%), Positives = 76/131 (58%), Gaps = 15/131 (11%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVS------------GRKWSDIGALTAELKDKEVLIR  369
            +DD  +  + NYGD+ L +LKS A S            G+KW+D+  L  E+   EVLIR
Sbjct  55   LDD--ESFSENYGDVTLTELKSTADSKAGKWIEAVEGMGKKWTDVRDLVEEMVGSEVLIR  112

Query  370  GRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVV  546
            GR +T R    K+ F+++R+ GF VQCV T + +  VS  M+K+   LS ES VDV GVV
Sbjct  113  GRLETYRHKSSKLGFLILRQSGFKVQCVATQSEETKVSVNMIKFLKQLSSESFVDVIGVV  172

Query  547  SVPNVQIKGAT  579
             +P   + G+T
Sbjct  173  VLPKDPVTGST  183



>ref|XP_002945972.1| hypothetical protein VOLCADRAFT_72624 [Volvox carteri f. nagariensis]
 gb|EFJ52967.1| hypothetical protein VOLCADRAFT_72624 [Volvox carteri f. nagariensis]
Length=545

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 3/116 (3%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPL   YGD P+  ++S+  S R W+ + +L  +L +++VL+R R  T R  GK  A
Sbjct  60   DPEDPLREQYGDYPM--VQSREQSSRVWTKVESLGKDLSEQKVLVRARVHTTRGKGKS-A  116

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R+R  TVQ VL      VS  MVKYAT + KESIVD+EGVV VP   I+G +
Sbjct  117  FLVLRQRTATVQAVLFADDVTVSKGMVKYATQIPKESIVDLEGVVKVPEKPIEGCS  172



>ref|XP_006848204.1| hypothetical protein AMTR_s00029p00241780 [Amborella trichopoda]
 gb|ERN09785.1| hypothetical protein AMTR_s00029p00241780 [Amborella trichopoda]
Length=681

 Score = 96.3 bits (238),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 52/115 (45%), Positives = 80/115 (70%), Gaps = 0/115 (0%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAF  414
            +PD  A+NYGD+ +++ +SK V   + + I +L+ ELK KEV +R R  +IR V K + F
Sbjct  194  APDLSASNYGDLSIEEFESKKVGDHERATIESLSNELKGKEVWVRARVHSIREVSKNMVF  253

Query  415  IVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            ++++++ +T+QCV+TV    VS QMVKY ++L  +S VDV GVV VP + IKGA+
Sbjct  254  LILKEKWYTLQCVVTVTQGFVSQQMVKYVSALGVDSFVDVYGVVVVPGILIKGAS  308



>ref|XP_002876233.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52492.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=550

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 54/124 (44%), Positives = 75/124 (60%), Gaps = 12/124 (10%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D  ++NYGD+ L++L+S          +AV G++W+++  L  E+   EVLIRGR  T R
Sbjct  62   DEFSSNYGDVTLNELQSTEDPKAGIWREAVEGKRWTEVSKLVEEIAGSEVLIRGRVHTYR  121

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V   I F+++RK G TVQCV   + +  VS  M+KY   LS ESIVDV GVV +P   +
Sbjct  122  -VQPSIVFVILRKSGSTVQCVAKQSEETNVSVNMIKYLEKLSCESIVDVIGVVVLPKDPV  180

Query  568  KGAT  579
            KG T
Sbjct  181  KGTT  184



>ref|XP_002869341.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45600.1| hypothetical protein ARALYDRAFT_491623 [Arabidopsis lyrata subsp. 
lyrata]
Length=557

 Score = 93.2 bits (230),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/124 (40%), Positives = 73/124 (59%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            +  ++NYGD+ L++L+S          +AV G+ W+D+  L  E+ + EVLIRGR    R
Sbjct  60   EEYSSNYGDVTLNELQSTADPKAGKWREAVEGKDWTDVSDLVEEMVESEVLIRGRVHINR  119

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
                K+ F+++R+ G TVQCV+  +    V   MVKY+  LS+ES VDV GVV +P   +
Sbjct  120  PTSSKLGFLILRESGSTVQCVVRQSEKTKVGANMVKYSEQLSRESFVDVIGVVVLPKEPL  179

Query  568  KGAT  579
             G T
Sbjct  180  TGTT  183



>ref|XP_006290941.1| hypothetical protein CARUB_v10017054mg [Capsella rubella]
 gb|EOA23839.1| hypothetical protein CARUB_v10017054mg [Capsella rubella]
Length=506

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 54/129 (42%), Positives = 77/129 (60%), Gaps = 16/129 (12%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGR  375
            +++  D L++NYGD+ L++L+S          +AV G++W+D+  L  EL   EVLIRGR
Sbjct  3    LEEDVDELSSNYGDVTLNELQSTADPKAGKWREAVEGKEWTDVSDLVEELAGSEVLIRGR  62

Query  376  AQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSV  552
              T R V     F+++R+ G TVQCV   + +  VS  M+KY   L  ES VDV G+V +
Sbjct  63   VHTYRQV-----FMILRQSGSTVQCVAKQSEETNVSVNMLKYLKQLPCESFVDVIGLVVL  117

Query  553  PNVQIKGAT  579
            P   IKGAT
Sbjct  118  PKDPIKGAT  126



>ref|XP_005648554.1| aspartyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE24010.1| aspartyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=506

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/116 (45%), Positives = 70/116 (60%), Gaps = 3/116 (3%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D  DPL   YGD PL  ++S+  SG K+  I  L+ EL  ++VL+RGR   +R  GK   
Sbjct  23   DPDDPLREQYGDTPL--VQSRTQSGEKYYQISELSPELSGQKVLLRGRVHNVRGKGKS-C  79

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R++  TVQ VL V    VS  MVKY +++ KESIVD+ G V VP   + G T
Sbjct  80   FLVLRQQTGTVQAVLFVDDKTVSRGMVKYTSAIPKESIVDISGEVHVPQEPVAGCT  135



>ref|XP_001778245.1| predicted protein [Physcomitrella patens]
 gb|EDQ56912.1| predicted protein [Physcomitrella patens]
Length=525

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/97 (48%), Positives = 66/97 (68%), Gaps = 1/97 (1%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPLA NYGD+ +++L+SK  S R W+++G L  +   + VL+RGR  T+R  G  + F+V
Sbjct  40   DPLAGNYGDVVMENLQSKEKSCRVWTNVGDLGQDHSGQTVLVRGRVHTVRGKGS-LGFLV  98

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVD  531
            VR+ G TVQCV  V  ++VS  M+KY   L+KESIVD
Sbjct  99   VREAGHTVQCVAAVKENVVSKGMIKYVGKLNKESIVD  135



>ref|XP_010431338.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=497

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/125 (39%), Positives = 76/125 (61%), Gaps = 14/125 (11%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQT  384
            S +  ++NYGD+ L++L+S          +AV G++W+D+  L  E+   EVLIRGR   
Sbjct  2    SLEEFSSNYGDVTLNELQSTADPKAGKWREAVEGKEWTDVSDLVEEMAGSEVLIRGRINR  61

Query  385  IRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQ  564
            +++   K+ F+++R+ GFTVQCV   + +  +  M+KY   LS ES VDV GVV +P   
Sbjct  62   LKS--SKVLFLILRQSGFTVQCVAKQSEE--TDVMIKYLKQLSCESFVDVIGVVVIPKDP  117

Query  565  IKGAT  579
            +KG T
Sbjct  118  VKGTT  122



>ref|XP_007318189.1| hypothetical protein SERLADRAFT_448942 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN98604.1| hypothetical protein SERLA73DRAFT_89528 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO24170.1| hypothetical protein SERLADRAFT_448942 [Serpula lacrymans var. 
lacrymans S7.9]
Length=542

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL   +S++  GR  + I AL+AE   + VLIR R QT RA G K+ F+ 
Sbjct  57   DFAAQYYGKLPLH--QSQSRPGRARTQIAALSAENDGQRVLIRARIQTSRAQGSKMVFLN  114

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  TVQ +LTV P+ VS QMVK+A SL+ ESIV VEG V      IK AT
Sbjct  115  LRQRTDTVQALLTVTPEKVSKQMVKWAASLADESIVLVEGSVKKSPEIIKSAT  167



>ref|XP_006283471.1| hypothetical protein CARUB_v10004519mg [Capsella rubella]
 gb|EOA16369.1| hypothetical protein CARUB_v10004519mg [Capsella rubella]
Length=550

 Score = 91.3 bits (225),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 71/124 (57%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            D  ++NYGD+ L +L+S          +A+ G++  D+  L  E+ + EVLIRGR  T R
Sbjct  53   DEFSSNYGDVTLSELQSTADPKAGKWREAIEGKECIDVSDLVEEMAESEVLIRGRVHTNR  112

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K+ F+ +R  G TVQCV++ +    V   MVKY   LS+ES VDV GVV +P   +
Sbjct  113  PVSSKLGFVTLRASGSTVQCVVSQSEKTKVGANMVKYLKQLSRESFVDVIGVVVLPKEPL  172

Query  568  KGAT  579
             G T
Sbjct  173  TGTT  176



>ref|XP_009137996.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Brassica 
rapa]
 emb|CDY13418.1| BnaA03g51360D [Brassica napus]
Length=552

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 72/124 (58%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            +  + NYGD+ L++LKS          +AV G++W+D+  L   +   EVLIRGR  T R
Sbjct  61   ESFSRNYGDVTLNELKSTEDPKAGKWREAVEGKEWTDVRELVEAMAGTEVLIRGRVHTYR  120

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVA-PDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K  F++VR++   VQCV+T +  + VS  MVK+   L+ ES VDV G V +P   +
Sbjct  121  HVSSKKGFLIVRQKWSRVQCVVTESKENHVSVNMVKFVKQLNSESFVDVIGYVVLPKDPV  180

Query  568  KGAT  579
             GAT
Sbjct  181  TGAT  184



>ref|XP_010436322.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Camelina 
sativa]
Length=657

 Score = 90.5 bits (223),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 51/121 (42%), Positives = 72/121 (60%), Gaps = 12/121 (10%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS-------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVG  399
            D  ++NYGD+ L  L         KAV G++W+D+  L  E+   EVLIRGR  T+R+  
Sbjct  124  DEYSSNYGDVILSGLPDPKAETWRKAVEGKEWTDVSDLVGEMVGSEVLIRGRVHTVRSG-  182

Query  400  KKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGA  576
                F+++R+ GFTVQCV   + +  VS  M+ +   LS ESIV+V GVVS+P   + GA
Sbjct  183  ---MFVILRQSGFTVQCVAKKSEETKVSANMINFLKELSDESIVEVIGVVSLPKDPVTGA  239

Query  577  T  579
            T
Sbjct  240  T  240



>emb|CDX72297.1| BnaC07g43190D [Brassica napus]
Length=554

 Score = 89.7 bits (221),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 48/124 (39%), Positives = 73/124 (59%), Gaps = 11/124 (9%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIR  390
            +  + N+GD+ L++LKS          +AV G++W+D+  L   +   EVLIRGR  T R
Sbjct  63   ESFSRNHGDVTLNELKSTEDPKAGKWREAVEGKEWTDVRELVEAMAGTEVLIRGRVHTYR  122

Query  391  AVGKKIAFIVVRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQI  567
             V  K  F++VR++G  VQCV+  + +  VS  MVK+   +++ES VDV G V +P   +
Sbjct  123  HVSSKKGFLIVRQKGSKVQCVVAESKENHVSVDMVKFVRQMNRESFVDVIGYVVLPKDPV  182

Query  568  KGAT  579
             GAT
Sbjct  183  TGAT  186



>emb|CAN80409.1| hypothetical protein VITISV_018932 [Vitis vinifera]
Length=143

 Score = 84.7 bits (208),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 38/58 (66%), Positives = 47/58 (81%), Gaps = 0/58 (0%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVG  399
            IDD PDP A+NYGD+PL D +SK ++  KW DIGALT +LKD++VL + RAQTIRAVG
Sbjct  86   IDDIPDPFASNYGDVPLLDFQSKEITDLKWIDIGALTEDLKDQKVLTQRRAQTIRAVG  143



>gb|KDD74520.1| hypothetical protein H632_c1258p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=304

 Score = 87.0 bits (214),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 51/113 (45%), Positives = 68/113 (60%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPL   YGD  +  ++S+AV+GR W+ I AL A    + VL+R R   +R  GK  AF+V
Sbjct  50   DPLRERYGDAEM--VQSRAVTGRVWTPISALGAAKAGESVLVRARVHNVRGKGKS-AFMV  106

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R +  TVQ  L V    VS  MVKYA +LS+ESIVDVEG +  P   I+  +
Sbjct  107  LRDQTSTVQVTLFVDDVTVSKGMVKYACALSRESIVDVEGTLVCPEQSIESCS  159



>ref|XP_006830131.1| hypothetical protein AMTR_s04335p00004830 [Amborella trichopoda]
 gb|ERM97547.1| hypothetical protein AMTR_s04335p00004830 [Amborella trichopoda]
Length=106

 Score = 83.6 bits (205),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 54/66 (82%), Gaps = 0/66 (0%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            +  D LA++Y DIPL +L+SK +SG+ W+++ +L+ ELK+KE+LIRG+AQTIRAV K +A
Sbjct  9    NEADTLASHYRDIPLKELQSKEISGQAWTEVKSLSDELKNKEILIRGQAQTIRAVSKNMA  68

Query  412  FIVVRK  429
            FI++ K
Sbjct  69   FIIMPK  74



>ref|XP_006409458.1| hypothetical protein EUTSA_v10023019mg [Eutrema salsugineum]
 gb|ESQ50911.1| hypothetical protein EUTSA_v10023019mg [Eutrema salsugineum]
Length=521

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 51/127 (40%), Positives = 73/127 (57%), Gaps = 9/127 (7%)
 Frame = +1

Query  226  IDDSPDPLAANYG-DIPLDDLKS-------KAVSGRKWSDIGALTAELKDKEVLIRGRAQ  381
            +DD       NYG D+ L +L S       +A  G+KW+D+G L  E+   EVLIRGR +
Sbjct  47   LDDESFSENENYGGDVTLTELNSPADHKWREATEGKKWTDVGDLVEEMVGLEVLIRGRLE  106

Query  382  TIRAVGKKIAFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPN  558
            T R    K+ F+++R+ GF VQCV T + +  VS  M+K+   LS ES V+V GVV +P 
Sbjct  107  TYRHKSSKLGFLMLRQSGFKVQCVATQSEETKVSVNMIKFLKQLSSESFVNVIGVVLLPK  166

Query  559  VQIKGAT  579
              +  +T
Sbjct  167  DPVTAST  173



>gb|KIJ21698.1| hypothetical protein PAXINDRAFT_5844 [Paxillus involutus ATCC 
200175]
Length=548

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 52/113 (46%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A+ YG +P+   +S++  GRK +DI  LTA+   ++V +R R QT R  G K+ F+ 
Sbjct  64   DYAASKYGKLPMH--QSQSRPGRKRTDISTLTAQNDGEKVFLRARVQTSRLQGNKMVFLN  121

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  TVQ +L V  +LVS QMVK+A SL+ ESIV VEG V      IK AT
Sbjct  122  LRQRTGTVQALLQVTAELVSKQMVKWAGSLADESIVLVEGTVKKSPEPIKSAT  174



>emb|CAB36533.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
 emb|CAB79542.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
Length=504

 Score = 88.6 bits (218),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +++  +  ++NYGD+  ++L+S AV G++ +D+  L  E+   EV IRGR    R VG K
Sbjct  45   LEEEDESCSSNYGDVTTNELQS-AVEGKELTDVSNLVEEIVGSEVSIRGRLHKNRLVGTK  103

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+ GFTVQCV  V    V   M+K+   LS+ES+V++ GVVS P   + G T
Sbjct  104  L-FVILRESGFTVQCV--VEETRVGANMIKFVKQLSRESVVELIGVVSHPKKPLTGTT  158



>emb|CCO30608.1| aspartyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=342

 Score = 86.7 bits (213),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            +YG +PL+  +S+   GR  + I    A    + V++R R  T RA G K+ F  +R+R 
Sbjct  48   SYGKLPLN--QSQERPGRSRAQISTFDASKDGENVILRARVHTSRAQGSKMVFFALRQRQ  105

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +LTVAP+ VS QMVK+A S+  ESIV VEGVV     +IK AT
Sbjct  106  HTVQALLTVAPETVSKQMVKWAASVPLESIVLVEGVVKRSPEEIKSAT  153



>ref|NP_194417.2| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
 gb|AAN41339.1| putative aspartate-tRNA ligase [Arabidopsis thaliana]
 gb|AEE85263.1| Asx tRNA synthetase (AspRS/AsnRS) class II core domain-contating 
protein [Arabidopsis thaliana]
Length=532

 Score = 88.6 bits (218),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 74/118 (63%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +++  +  ++NYGD+  ++L+S AV G++ +D+  L  E+   EV IRGR    R VG K
Sbjct  45   LEEEDESCSSNYGDVTTNELQS-AVEGKELTDVSNLVEEIVGSEVSIRGRLHKNRLVGTK  103

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+ GFTVQCV  V    V   M+K+   LS+ES+V++ GVVS P   + G T
Sbjct  104  L-FVILRESGFTVQCV--VEETRVGANMIKFVKQLSRESVVELIGVVSHPKKPLTGTT  158



>gb|KIK94908.1| hypothetical protein PAXRUDRAFT_827519 [Paxillus rubicundulus 
Ve08.2h10]
Length=562

 Score = 88.2 bits (217),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 72/113 (64%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A+ YG +P+   +S++  GRK +DI  L+A+   ++VL+R R QT R  G K+ F+ 
Sbjct  78   DYAASKYGKLPMH--QSQSRPGRKRTDISTLSAQNDGEKVLLRARVQTSRLQGNKMVFLN  135

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  TVQ +L VA  LVS QMVK+A SL+ ESIV VEG V      IK AT
Sbjct  136  LRQRTGTVQALLQVAGGLVSKQMVKWAGSLADESIVLVEGTVKKSPEPIKSAT  188



>ref|XP_003612738.1| Aspartyl-tRNA synthetase [Medicago truncatula]
 gb|AES95696.1| aspartate-tRNA ligase [Medicago truncatula]
Length=589

 Score = 88.2 bits (217),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 51/116 (44%), Positives = 69/116 (59%), Gaps = 16/116 (14%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKSKA-VSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            S DPLA NYGDIPL +L+SK  V     + + AL   L +                 K+A
Sbjct  111  SADPLATNYGDIPLKELQSKTPVHPVPRTQVEALDDSLVNNS---------------KLA  155

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+++   TVQC++   PD VS QMVK+A ++S+ES+VDV GVVS+P   IKG T
Sbjct  156  FLVLKENVETVQCLVQTQPDSVSEQMVKFAKTISRESVVDVHGVVSIPAAPIKGTT  211



>gb|KIJ68384.1| hypothetical protein HYDPIDRAFT_165245 [Hydnomerulius pinastri 
MD-312]
Length=561

 Score = 87.8 bits (216),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL   +S++  GRK +D+  L+A+   ++VLIR R QT R  G K+ F+ +R+R  
Sbjct  83   YGKLPLH--QSQSRPGRKRTDLSTLSAQNDGEQVLIRARVQTSRLQGNKMVFLNLRQRTS  140

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +++V P+L+S QMVK+A +L+ ESIV  EG V      IK AT
Sbjct  141  TVQALMSVTPNLISKQMVKWAGALADESIVLAEGTVKKSPEPIKSAT  187



>gb|KDN48094.1| hypothetical protein RSAG8_03110, partial [Rhizoctonia solani 
AG-8 WAC10335]
Length=435

 Score = 86.7 bits (213),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 68/108 (63%), Gaps = 2/108 (2%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            +YG +PL+  +S+  +GR  + I         + VL+R R  T RA G K+ F+ +R+R 
Sbjct  64   SYGKLPLN--QSQERTGRVRAQISTFDGSKDGEHVLLRARVHTSRAQGSKMVFLALRQRQ  121

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +LTV+P+ VS QMVK+A S+  ESIV VEG+V     ++KGAT
Sbjct  122  HTVQALLTVSPETVSKQMVKWAASVPLESIVLVEGLVKRSPEEVKGAT  169



>gb|EUC67461.1| aspartate-tRNA ligase [Rhizoctonia solani AG-3 Rhs1AP]
Length=541

 Score = 87.4 bits (215),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG +PL+  +S    GR  + I         + VL+R R  T RA G K+ F  +R+R 
Sbjct  68   NYGKLPLN--QSHERPGRVRAQISTFDGSKNGEHVLLRARVHTSRAQGSKMVFFALRQRQ  125

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +LTVAP+ VS QMVK+A S+  ESIV VEGV+     +IK AT
Sbjct  126  HTVQALLTVAPETVSKQMVKWAASVPLESIVLVEGVIKRSPEEIKSAT  173



>gb|KEP55699.1| aspartate-tRNA ligase [Rhizoctonia solani 123E]
Length=541

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 64/108 (59%), Gaps = 2/108 (2%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG +PL+  +S    GR  + I         + VL+R R  T RA G K+ F  +R+R 
Sbjct  68   NYGKLPLN--QSHERPGRVRAQISTFDGSKNGEHVLLRARVHTSRAQGSKMVFFALRQRQ  125

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +LTVAP+ VS QMVK+A S+  ESIV VEGV+     +IK AT
Sbjct  126  HTVQALLTVAPETVSKQMVKWAASVPLESIVLVEGVIKRSPEEIKSAT  173



>gb|KIM67275.1| hypothetical protein SCLCIDRAFT_1210786 [Scleroderma citrinum 
Foug A]
Length=539

 Score = 87.0 bits (214),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 70/107 (65%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +P+   +S++   RK +DI  LTA+   ++VLIR R QT R  G K+ F+ +R+R  
Sbjct  64   YGRLPMH--QSQSRPNRKRADISTLTAQNDGEQVLIRARVQTSRLQGNKMVFLNLRQRTN  121

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +++V  D +S QMVK+A SL+ ESIV VEG+V      IKGA+
Sbjct  122  TVQSLMSVTKDTISKQMVKWAGSLADESIVLVEGIVRKSPEPIKGAS  168



>gb|KDE09023.1| hypothetical protein MVLG_00744 [Microbotryum violaceum p1A1 
Lamole]
Length=629

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 71/115 (62%), Gaps = 6/115 (5%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAF  414
            SPD     YG +PL+   S+  SG++ +D+G LTA    +EVL R R QT RA G K+ F
Sbjct  147  SPD----KYGKLPLN--TSQDRSGKERTDLGTLTAADAGREVLFRARLQTSRAQGAKMVF  200

Query  415  IVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +V R++  T+Q ++ V P+LVS  MV++  S++ ESIV V+G V  P   +K  T
Sbjct  201  LVFRQQQHTIQALIQVEPELVSKPMVRWTESINAESIVLVQGTVQKPLEPVKSCT  255



>ref|XP_003082076.1| OJ1717_A09.34 gene product (ISS) [Ostreococcus tauri]
 emb|CAL55879.1| Aminoacyl-tRNA synthetase, class II (D/K/N)-like [Ostreococcus 
tauri]
Length=542

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 67/106 (63%), Gaps = 3/106 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPL   YGD  +  ++S+  SGR+W+ +  L+  L D+EVL+RGR   +R  GK  AFIV
Sbjct  57   DPLKDKYGDAEM--VQSQTKSGRRWTRVEDLSGTLADEEVLVRGRVHNVRGKGKS-AFIV  113

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPN  558
            +R++  TVQ VL V    VS  MVK+  SL +E++VDV GV+  P 
Sbjct  114  LRQQTATVQVVLFVDDVHVSKGMVKWVCSLPRETVVDVRGVIVRPE  159



>emb|CEL59367.1| aspartyl-tRNA synthetase [Rhizoctonia solani AG-1 IB]
Length=541

 Score = 86.3 bits (212),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 66/108 (61%), Gaps = 2/108 (2%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            +YG +PL+  +S+   GR  + I    A    + V++R R  T RA G K+ F  +R+R 
Sbjct  68   SYGKLPLN--QSQERPGRSRAQISTFDASKDGENVILRARVHTSRAQGSKMVFFALRQRQ  125

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +LTVAP+ VS QMVK+A S+  ESIV VEGVV     +IK AT
Sbjct  126  HTVQALLTVAPETVSKQMVKWAASVPLESIVLVEGVVKRSPEEIKSAT  173



>gb|KDP23766.1| hypothetical protein JCGZ_23599 [Jatropha curcas]
Length=81

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 1/75 (1%)
 Frame = +1

Query  310  KWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQM  489
            +W+ +  LT  LK KEVLIRGRA+TIR V K +  +VVR+RGFTVQCV+TV   LVS QM
Sbjct  8    RWTKVKDLTGVLKGKEVLIRGRAETIR-VTKDVVLVVVRQRGFTVQCVITVQLGLVSDQM  66

Query  490  VKYATSLSKESIVDV  534
            V +  SLS ESI+DV
Sbjct  67   VVFVASLSPESIIDV  81



>ref|XP_002868911.1| hypothetical protein ARALYDRAFT_490730 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45170.1| hypothetical protein ARALYDRAFT_490730 [Arabidopsis lyrata subsp. 
lyrata]
Length=504

 Score = 85.5 bits (210),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 70/113 (62%), Gaps = 4/113 (4%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            +  ++NYGD+  ++L+  AV G++ +D+  L  E+   EV IRGR    R VG K+ F++
Sbjct  28   ESFSSNYGDVTTNELQL-AVEGKELTDVSNLVEEIVGSEVSIRGRVHKNRLVGTKL-FVI  85

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+ GFTVQCV  V    V   M+K+   LS+ES+V++ GVVS P   + G T
Sbjct  86   LRESGFTVQCV--VEETRVGANMIKFVKQLSRESVVELIGVVSHPKKPLTGTT  136



>ref|XP_006401257.1| hypothetical protein EUTSA_v10015942mg [Eutrema salsugineum]
 gb|ESQ42710.1| hypothetical protein EUTSA_v10015942mg [Eutrema salsugineum]
Length=628

 Score = 85.9 bits (211),  Expect = 7e-16, Method: Composition-based stats.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 8/118 (7%)
 Frame = +1

Query  250  AANYGDIPLDDLKS-------KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            + NYGD+   +L S       +A  G+K +++  L  E+   EVLIRGR +T R    K+
Sbjct  137  SENYGDVTFTELNSTAAGKWREATEGKKMTEVRDLVEEMVGTEVLIRGRLETYRHKSSKL  196

Query  409  AFIVVRKRGFTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             F+++R+ GF VQCV T + +  VS  M+K+   LS ES VDV GVV +P   +K +T
Sbjct  197  GFMMLRQNGFKVQCVATQSEETKVSVNMIKFLKQLSSESFVDVIGVVVLPKEPVKAST  254



>ref|XP_009541188.1| hypothetical protein HETIRDRAFT_437829 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW87265.1| hypothetical protein HETIRDRAFT_437829 [Heterobasidion irregulare 
TC 32-1]
Length=545

 Score = 85.1 bits (209),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+    R  + I +L+A L  + VLIR R  T+RA G K+ F+ +R+R  
Sbjct  71   YGKLPLNQSQSRPRIPR--TQISSLSAALDGQSVLIRARVHTLRAQGNKMVFLNLRQRID  128

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ ++TV P+ VS QMVK+  SL  ESIV VEGVV     +IK AT
Sbjct  129  SVQALVTVTPEKVSKQMVKWVASLGSESIVLVEGVVKTAPEEIKSAT  175



>gb|KHN37081.1| Aspartate--tRNA ligase, cytoplasmic [Glycine soja]
Length=432

 Score = 84.0 bits (206),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/58 (67%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +AF+V+R+ GFTVQC++   PD VS QMVK+A +LS+ESIVDVEGVVSVP   IKGAT
Sbjct  1    MAFLVIRENGFTVQCLVQAQPDTVSAQMVKFAAALSRESIVDVEGVVSVPTAPIKGAT  58



>ref|XP_004951929.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Setaria 
italica]
Length=495

 Score = 83.6 bits (205),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 43/109 (39%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALT-AELKDKEVLIRGRAQTIRAVGKKIAFIVVRKR  432
            +YGD    +   +  +G  W+D+ +L  A    + V +RG AQ +RAVG+++AF+V+R+ 
Sbjct  16   DYGDAATMEALRQLRAGYAWADVASLEPASAAGRAVRVRGAAQAVRAVGRRVAFLVLRQG  75

Query  433  GFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
              TVQCV++       G M ++A  LS+ES+VDV GVVS+P   ++G T
Sbjct  76   AATVQCVVSGG----DGGMARFAAGLSRESVVDVAGVVSLPREPVRGTT  120



>gb|KDQ63697.1| hypothetical protein JAAARDRAFT_29717 [Jaapia argillacea MUCL 
33604]
Length=547

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +++    R +  I  L   L+D+ VL+R R  T RA G K+ F+ +R+R  
Sbjct  71   YGKLPLNQSQTRTRRPRVF--IHELNPNLEDQTVLLRARVHTSRAQGNKMVFLNLRQRSD  128

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +LTV P+ VS QMVK+A SL  ESIV VEGVV      IK A+
Sbjct  129  SVQALLTVEPEKVSKQMVKWAASLQAESIVLVEGVVKKSPELIKSAS  175



>ref|XP_007763373.1| aspartyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86660.1| aspartyl-tRNA synthetase [Coniophora puteana RWD-64-598 SS2]
Length=590

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/103 (45%), Positives = 68/103 (66%), Gaps = 2/103 (2%)
 Frame = +1

Query  238  PDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFI  417
            PD    +YG++P+   +S++  GR  +D+  LTA+   + V +R R QT RA GK++ F+
Sbjct  105  PDYATNHYGELPMH--QSQSRPGRARTDLSKLTAQNDGEHVTLRARIQTSRAQGKRMVFL  162

Query  418  VVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVV  546
             +R+R  TVQ +L V  D VS QMVK+ATSL+ ESIV +EG +
Sbjct  163  NLRQRTDTVQALLQVTDDQVSTQMVKWATSLADESIVLIEGTI  205



>ref|XP_001634294.1| predicted protein [Nematostella vectensis]
 gb|EDO42231.1| predicted protein [Nematostella vectensis]
Length=506

 Score = 82.4 bits (202),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            Y  +PL  L+SK  + R+W  + ALT ++  K VL+R R  T RA GK+  F+ +R R +
Sbjct  38   YAVLPL--LQSKEKTSRQWLKVQALTEDMVGKRVLVRARIHTSRATGKQ-CFMTLRDRQY  94

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ  L  A D+VS  MVK+A  +++ESI+DVEG V     +IK  +
Sbjct  95   TVQA-LCAASDVVSKHMVKFAAGINRESIIDVEGEVKAAAQKIKSCS  140



>gb|KIO08227.1| hypothetical protein M404DRAFT_342755 [Pisolithus tinctorius 
Marx 270]
Length=529

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +P+   +S++   R+ +DI  LTA+   K+VL+R R QT R  G K+ F+ +R+   
Sbjct  54   YGKLPMH--QSQSCQNRERTDISTLTAQDDGKQVLLRARIQTSRLQGNKMVFLNLRQCTN  111

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +++V  D +S QMVK+A SL+ ESIV VEGVV      IK A+
Sbjct  112  TVQALMSVTKDTISKQMVKWAGSLADESIVLVEGVVKKSPEPIKSAS  158



>ref|XP_002477243.1| predicted protein [Postia placenta Mad-698-R]
 gb|EED77558.1| predicted protein, partial [Postia placenta Mad-698-R]
Length=182

 Score = 79.0 bits (193),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+    R  + I +LT EL  + VL+R R QT R  G K+ F V+R+R  
Sbjct  64   YGKLPLNQSQSRPRRSR--TQIASLTPELDGQPVLLRARVQTSRMQGSKMVFFVLRQRID  121

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +LTV+   VS QM K+A  L+ ESIV VEG V      IK AT
Sbjct  122  SVQALLTVSEGKVSKQMAKWAGGLAMESIVLVEGTVKKAPEIIKSAT  168



>gb|KFK40259.1| hypothetical protein AALP_AA3G351000 [Arabis alpina]
Length=549

 Score = 82.4 bits (202),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 76/131 (58%), Gaps = 13/131 (10%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKS----------KAVSGRKWSDIGALTAELKDKEVLIRGR  375
            +++  +  + NYGD+ + ++KS          +A+ G+ W D+  LT E+   EVLIRGR
Sbjct  50   LEEEDESFSRNYGDVTIPEIKSTNDSNSGKWREAIEGKSWIDMKNLTKEMIGLEVLIRGR  109

Query  376  AQTIRAVGKKIAFIVVRKRG--FTVQCVLTVAPDL-VSGQMVKYATSLSKESIVDVEGVV  546
              T R V  K+ F+ +R+ G   +VQCV   + ++ VS +M+++   LS ES VDV GVV
Sbjct  110  VNTNRPVSSKLGFMTLRQTGGEVSVQCVGIASEEMKVSVKMIRFMKQLSCESFVDVIGVV  169

Query  547  SVPNVQIKGAT  579
            ++P   + G T
Sbjct  170  ALPKDPVIGTT  180



>gb|KIP12007.1| hypothetical protein PHLGIDRAFT_27619 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=552

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 69/113 (61%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG  PL+  +S++   R+ + I +L   +  + VLIR R QT RA G K+ F+ 
Sbjct  66   DYAAEFYGKEPLN--QSQSRPRRQRTQIASLNPNMDGENVLIRARVQTSRAQGNKMVFLN  123

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  +VQ +LTV P+ VS QMVK+A SL  ESIV VEG+V      IK A+
Sbjct  124  LRQRIDSVQALLTVTPEKVSKQMVKWAASLQDESIVLVEGIVKKSPEVIKSAS  176



>gb|EPZ32107.1| Aminoacyl-tRNA synthetase, class II (D/K/N)-like domain-containing 
protein [Rozella allomycis CSF55]
Length=532

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 66/113 (58%), Gaps = 4/113 (4%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG   L+ + S A SGRKW+ I  LT E+ +K VLIRGR    R  GK+  F+V
Sbjct  56   DVSAGKYGT--LEMINSSAKSGRKWTAINNLTLEMTEKSVLIRGRLHNSRMTGKQ-TFMV  112

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R    TVQ V+      VS QM+K++  + KESIVD+EG+V V    ++  T
Sbjct  113  LRGNCETVQ-VIVAQSHQVSKQMLKFSAGIPKESIVDIEGIVKVVQTPVESCT  164



>gb|KDQ30746.1| hypothetical protein PLEOSDRAFT_1092280 [Pleurotus ostreatus 
PC15]
Length=571

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 50/113 (44%), Positives = 71/113 (63%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL+  +S+  + +    I  L+A+   ++VL+R R QT RA G K+ F+ 
Sbjct  68   DFAAELYGKLPLN--QSQTRTNQTRIQISTLSADRDGEQVLLRARVQTSRAQGSKMVFLN  125

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  +VQ +L VAP+ VS QMVK+A  LS ESIV VEGVV+     IK A+
Sbjct  126  LRQRTDSVQALLVVAPEKVSKQMVKWAAGLSDESIVLVEGVVAKAPEPIKSAS  178



>ref|XP_009055134.1| hypothetical protein LOTGIDRAFT_118845 [Lottia gigantea]
 gb|ESO94292.1| hypothetical protein LOTGIDRAFT_118845 [Lottia gigantea]
Length=515

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 76/116 (66%), Gaps = 4/116 (3%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            ++ D    NYG++PL  ++S + S R+   I  LT +L  ++V +RGR  T R+ GK+  
Sbjct  37   ETEDYAKDNYGNLPL--IQSASKSARRLQKISTLTTDLAGQKVWLRGRLHTSRSKGKQ-C  93

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F V+R++ +++Q +L+V  + VS QM+K+A S++KESI++VEG +   + +I+  +
Sbjct  94   FFVLRQQKYSIQALLSVG-EKVSKQMIKFAASINKESIIEVEGFIRTVDQKIEACS  148



>gb|KIK43564.1| hypothetical protein CY34DRAFT_81604 [Suillus luteus UH-Slu-Lm8-n1]
Length=565

 Score = 81.6 bits (200),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/105 (44%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            + PD  AA+YG +PL   +S++ S R+ ++I  L+A+   + VL+R R QT R    K+A
Sbjct  64   EGPDYAAAHYGKLPLH--QSQSRSNRERTEIATLSAKNDSEHVLLRARIQTSRLQSNKMA  121

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVV  546
            F+ +R+R  T+Q +L V    VS QMVK+A  LS ESIV V G V
Sbjct  122  FLSLRQRTDTIQAMLAVNDKQVSKQMVKWAAGLSVESIVLVHGTV  166



>ref|XP_008033065.1| aspartate-tRNA ligase [Trametes versicolor FP-101664 SS1]
 gb|EIW64722.1| aspartate-tRNA ligase [Trametes versicolor FP-101664 SS1]
Length=551

 Score = 81.6 bits (200),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 66/107 (62%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  KS++   R+   I ALT  +  + VL+R R QT RA G K+ F+ +R+R  
Sbjct  71   YGKLPLN--KSQSRPRRERVQIAALTPAMDGQTVLLRARVQTSRAQGSKMVFLNLRQRTD  128

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +L+VAP+ VS QM K+A  L  ESIV  EGVV      IK AT
Sbjct  129  SVQALLSVAPEKVSKQMAKWAAGLQIESIVLAEGVVKKSPEIIKSAT  175



>emb|CDO75263.1| hypothetical protein BN946_scf184967.g16 [Trametes cinnabarina]
Length=551

 Score = 81.3 bits (199),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+    R+   I +L   +  + VL+R R QT RA G K+ F+ +R+R  
Sbjct  71   YGKLPLN--QSQTRERRERVQIASLNPNMDGQTVLLRARVQTSRAQGSKMVFLNLRQRTD  128

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +LTVAP+ VS QM K+A SL  ESIV  EGVV      IK AT
Sbjct  129  SVQALLTVAPEKVSKQMAKWAASLQIESIVLAEGVVRKAPEFIKSAT  175



>emb|CCM01942.1| predicted protein [Fibroporia radiculosa]
Length=546

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 48/107 (45%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+    R   DI  LT ++   +VL+R R QT R  G K+ F  +R+R  
Sbjct  66   YGKLPLNQSQSRPRRSR--IDITTLTPDMDGTQVLLRARVQTSRMQGSKMVFFNLRQRTD  123

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +LTVAP  VS QM K+A SL  ESIV VEG+       IK AT
Sbjct  124  SVQALLTVAPGKVSKQMAKWAGSLQMESIVLVEGIAKKTPEPIKSAT  170



>ref|XP_006283432.1| hypothetical protein CARUB_v10004480mg [Capsella rubella]
 gb|EOA16330.1| hypothetical protein CARUB_v10004480mg [Capsella rubella]
Length=565

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 47/125 (38%), Positives = 69/125 (55%), Gaps = 18/125 (14%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLK-------SKAVSGRKWSDIGALTAELKDKEVLIRGRAQT  384
            ++D  D  ++NYG++ L +L         +AV G++W+D+  L  E+   EVLIRGR  T
Sbjct  49   VEDEDDEYSSNYGNVNLSELPDPKARKWREAVEGKEWTDVSDLVGEMVGSEVLIRGRVHT  108

Query  385  IRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQ  564
             R     + F+ +R+ G TVQCV           M+++   LS ESIVDV GVVS+P   
Sbjct  109  SR-----LFFVYLRQSGSTVQCVAK------QKNMIRFLKQLSNESIVDVIGVVSLPKDP  157

Query  565  IKGAT  579
            +  AT
Sbjct  158  VTVAT  162



>gb|EEC72451.1| hypothetical protein OsI_05793 [Oryza sativa Indica Group]
Length=490

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 12/128 (9%)
 Frame = +1

Query  229  DDSPDPL--------AANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQT  384
            D+  DPL           YGD+ +      +V G +W+D+ AL  ++  + V +RG A  
Sbjct  7    DNHGDPLQQQPEEEDGGGYGDVAVGG-GLFSVPGYEWADVAALGPDVAGRAVRVRGAAHA  65

Query  385  IRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVS---GQMVKYATSLSKESIVDVEGVVSVP  555
            +RAVG+++AF+V+R+   TVQCV+             + ++A  LS+ES+VDV GVVS+P
Sbjct  66   VRAVGRRVAFLVLRQGSSTVQCVVGGGGGGGGGGDAGVARFAAGLSRESVVDVAGVVSLP  125

Query  556  NVQIKGAT  579
               ++G T
Sbjct  126  REPVRGTT  133



>dbj|BAD10253.1| putative Aspartyl-tRNA synthetase [Oryza sativa Japonica Group]
 gb|EAZ21689.1| hypothetical protein OsJ_05322 [Oryza sativa Japonica Group]
Length=508

 Score = 79.7 bits (195),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 45/128 (35%), Positives = 72/128 (56%), Gaps = 12/128 (9%)
 Frame = +1

Query  229  DDSPDPL--------AANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQT  384
            D+  DPL           YGD+ +      +V G +W+D+ AL  ++  + V +RG A  
Sbjct  7    DNHGDPLQQQPEEEDGGGYGDVAVGG-GLFSVPGYEWADVAALGPDVAGRAVRVRGAAHA  65

Query  385  IRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVS---GQMVKYATSLSKESIVDVEGVVSVP  555
            +RAVG+++AF+V+R+   TVQCV+             + ++A  LS+ES+VDV GVVS+P
Sbjct  66   VRAVGRRVAFLVLRQGSSTVQCVVGGGGGGGGGGDAGVARFAAGLSRESVVDVAGVVSLP  125

Query  556  NVQIKGAT  579
               ++G T
Sbjct  126  REPVRGTT  133



>gb|KHN15295.1| Aspartate--tRNA ligase, cytoplasmic [Glycine soja]
Length=432

 Score = 79.3 bits (194),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 48/58 (83%), Gaps = 0/58 (0%)
 Frame = +1

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +AF+V+R+ GFTVQC++    D VS QMVK+A +LS+ESIVDVEGVVS+P+  IKGAT
Sbjct  1    MAFLVIRENGFTVQCLVQAQADTVSPQMVKFAAALSRESIVDVEGVVSIPSAPIKGAT  58



>ref|XP_005286826.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X1 [Chrysemys 
picta bellii]
 ref|XP_005286827.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Chrysemys 
picta bellii]
Length=501

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL  ++S+  S R    I  LT E  D+ V +RGR  T RA GK+  F+V+R++ F
Sbjct  29   YGVLPL--IQSQEKSDRVLVRINDLTVEKADEVVWVRGRIHTSRAKGKQ-CFLVLRQQQF  85

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             VQ ++ V  D  S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  86   NVQALVAVG-DHASKQMVKFAANINKESIVDVEGVVRKVHQKIGGCT  131



>gb|KIL70777.1| hypothetical protein M378DRAFT_175161 [Amanita muscaria Koide 
BX008]
Length=544

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/113 (43%), Positives = 70/113 (62%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D   A YG +PL+  +S++   R    I +L++  +++ VL+R R QT RA G K+ F+ 
Sbjct  55   DYAVAFYGQLPLN--QSQSRPRRPRVTIASLSSR-EEESVLLRARVQTSRAQGNKMVFLN  111

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  TVQ +L V P+ VS QMVK+A  L+ ESIV VEG+V      IK AT
Sbjct  112  LRQRTDTVQALLLVTPEKVSKQMVKWAAGLADESIVLVEGIVKKSPEPIKSAT  164



>ref|XP_007060951.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Chelonia mydas]
Length=495

 Score = 78.6 bits (192),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 68/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL  ++S+  S R    I  LT E  D+ V +RGR  T RA GK+  F+V+R++ F
Sbjct  23   YGVLPL--IQSQEKSDRVLVRINDLTVEKADEVVWVRGRIHTSRAKGKQ-CFLVLRQQQF  79

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             VQ ++ V  D  S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  80   NVQALVAVG-DHASKQMVKFAANINKESIVDVEGVVRKVHQKIGGCT  125



>gb|KFM63678.1| Aspartate--tRNA ligase, cytoplasmic, partial [Stegodyphus mimosarum]
Length=531

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/108 (38%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            +YG + +  ++S     RK   + +L  +L DK+V +RGR  T RA GK+  F V+R+R 
Sbjct  57   SYGKMAM--IQSATKVCRKLVPVSSLEHDLGDKKVWVRGRLHTSRAKGKQ-CFFVLRQRQ  113

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +T+QC+L+V+ +  S QM+K+  S++KESI+DVEG +     +I+  +
Sbjct  114  YTIQCLLSVS-ETTSKQMIKFVASITKESIIDVEGFIRASPQKIESCS  160



>gb|KJA29186.1| hypothetical protein HYPSUDRAFT_32562 [Hypholoma sublateritium 
FD-334 SS-4]
Length=551

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D    NYG +PL+  +S+    R   DI  L + + +K VL+R R QT RA G K+ F+ 
Sbjct  61   DYATENYGPLPLNQSQSRPRIPR--DDITTLASRVGEK-VLVRARVQTSRAQGAKMVFLN  117

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++  ++Q VL V+P+ VS QMVK+  SL+ ESI+ +EG  +  +  IK AT
Sbjct  118  LRQKTDSIQAVLVVSPETVSKQMVKWTASLADESIILIEGTAAKTSEPIKSAT  170



>ref|XP_007417129.1| hypothetical protein MELLADRAFT_40205 [Melampsora larici-populina 
98AG31]
 gb|EGF99578.1| hypothetical protein MELLADRAFT_40205 [Melampsora larici-populina 
98AG31]
Length=533

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 40/113 (35%), Positives = 67/113 (59%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A NYG +PL+  +S+  +   W+ +  + A +  + V ++ R    R+   K+ F+V
Sbjct  48   DYAAQNYGKLPLN--QSQEQNLYTWTKVEQIDATMVGQRVRLQARVHNSRSQSAKLCFLV  105

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++  T+Q +L+  PD +S QMVK+ T +S ESIV VEGV+  P   +KG +
Sbjct  106  LRQQISTIQAILSATPDTISKQMVKFTTGISLESIVIVEGVIQKPIEGVKGCS  158



>gb|KHN87168.1| Aspartate--tRNA ligase, cytoplasmic [Toxocara canis]
Length=533

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG  PL  ++S       + D+G +T  L DKE+ IRGR  T R+ GK   F+VVR+R  
Sbjct  63   YGTYPL--IQSAEKKHLDFVDVGDVTGALNDKEIWIRGRLHTSRSKGK-TCFVVVRQRVH  119

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +L+V  D +S QM+K+ ++L KESI+DV GVV   + +I   T
Sbjct  120  TVQVMLSVG-DKISKQMLKFVSNLPKESIIDVCGVVRQVDQEIASCT  165



>ref|XP_003384922.2| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Amphimedon 
queenslandica]
Length=532

 Score = 77.8 bits (190),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 4/116 (3%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIA  411
            D+ D     YG++P+   +S+  + R WS I  L +    + VL+RGR    RA G  + 
Sbjct  51   DAQDVSKDCYGNLPM--AQSQEKTDRVWSHIKYLDSSKVGQSVLVRGRLHASRATGN-MC  107

Query  412  FIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            F+V+R + +TVQ V  V P   S QMV+YA+++ KESIVD+EG VS    +I G +
Sbjct  108  FLVLRSQQYTVQAVTAVGP-TTSKQMVRYASNVYKESIVDLEGTVSAAPEKITGCS  162



>ref|XP_011122417.1| hypothetical protein AOL_s00079g240 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX49019.1| hypothetical protein AOL_s00079g240 [Arthrobotrys oligospora 
ATCC 24927]
Length=559

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/114 (42%), Positives = 67/114 (59%), Gaps = 3/114 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  + NYG +PL+  +S   +G      G L A  + K+VL R R    RA G K+ F+ 
Sbjct  75   DTASENYGKLPLN--RSTERTGAARIAFGGLNAGDEGKQVLFRARVHNARAQGNKMTFLE  132

Query  421  VRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++  T+Q +L+V  D  VS QMVK+A+S+S ESIV V GVV+ P   IK  T
Sbjct  133  LRQQHQTIQALLSVQADGSVSKQMVKWASSISLESIVLVHGVVAKPYEPIKSTT  186



>ref|XP_002388830.1| hypothetical protein MPER_12111 [Moniliophthora perniciosa FA553]
 gb|EEB89760.1| hypothetical protein MPER_12111 [Moniliophthora perniciosa FA553]
Length=221

 Score = 75.1 bits (183),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 5/108 (5%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKE-VLIRGRAQTIRAVGKKIAFIVVRKRG  435
            YG +PL   +S++  GR    I +L++  +D E VL R R  T RA G K+ F+ +R+R 
Sbjct  64   YGALPLH--QSQSRPGRTRVQISSLSS--RDGETVLFRARVHTSRAQGNKMVFLNLRQRT  119

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             +VQ +L V P+ VS QMVK+A SL+ ESIV VEG+V      IK A+
Sbjct  120  DSVQALLFVTPEKVSKQMVKWAASLADESIVLVEGIVKKTPEPIKSAS  167



>gb|EPT04273.1| hypothetical protein FOMPIDRAFT_1014148 [Fomitopsis pinicola 
FP-58527 SS1]
Length=549

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 63/107 (59%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  KS+A   R    I +LT +    +V +R R QT RA G K+ F  +R+R  
Sbjct  69   YGRLPLN--KSQARPRRPRMHIASLTPDADGTQVFLRARVQTSRAQGSKMVFFNLRQRID  126

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            ++Q +LTV+P  VS QM K+A  L+ ESIV VEG V      IK AT
Sbjct  127  SIQALLTVSPGKVSKQMAKWAAGLAMESIVLVEGTVKKTPEPIKSAT  173



>ref|XP_002155876.2| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Hydra vulgaris]
Length=766

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/96 (44%), Positives = 66/96 (69%), Gaps = 4/96 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YGD+P+   +S+    R W+++  L    K+++VL+R R  T R  GK+  F+++R+R F
Sbjct  101  YGDLPM--AQSQIKISRDWTNVSDLNPLKKNEKVLLRARLHTSRGTGKQ-CFLMLRQRQF  157

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVV  546
            +VQ ++ V  + +S QMVK+AT++SKESIVDVEG V
Sbjct  158  SVQALVAVN-EHISKQMVKFATNISKESIVDVEGTV  192



>ref|XP_002286873.1| aspartate-trna ligase [Thalassiosira pseudonana CCMP1335]
 gb|EED96514.1| aspartate-trna ligase [Thalassiosira pseudonana CCMP1335]
Length=475

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 42/90 (47%), Positives = 60/90 (67%), Gaps = 2/90 (2%)
 Frame = +1

Query  310  KWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQM  489
            KW+ IGAL  E++ K+V++RG   T R VGK  AF+V+R   +TVQCV   + ++ S  M
Sbjct  14   KWTKIGALEKEMEGKKVVVRGHLHTSRGVGKG-AFVVLRSSLYTVQCVAFESIEIPSA-M  71

Query  490  VKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +KY T +  ESIVDV GV++ P   ++GAT
Sbjct  72   IKYMTGVPVESIVDVCGVLTCPEKAVEGAT  101



>emb|CDY06845.1| BnaC01g09440D [Brassica napus]
Length=507

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 71/118 (60%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +++  +  ++NYGD+      ++AV G++ +++  L  E+   EV IRGR    R VGKK
Sbjct  42   LEEEDESFSSNYGDVTPKS-AAEAVEGKELTEVSNLVEEIVGSEVSIRGRVHDHRLVGKK  100

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+  F VQCV+  A   V   M+K+   LS ES+V++ GVVS+P   + G T
Sbjct  101  L-FVILRQSEFRVQCVVEEAR--VGTSMLKFVKQLSHESVVELIGVVSLPKKPLTGTT  155



>emb|CDO77176.1| hypothetical protein BN946_scf184675.g8 [Trametes cinnabarina]
Length=959

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 66/105 (63%), Gaps = 2/105 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPL  N+GD+PL+  +++A   RK+ DI  +  + +  +V+ R R   IR +G KI FI+
Sbjct  117  DPLRDNWGDLPLNMSQTRA--ERKYDDIRDIPQKHEGDQVVFRARVHHIRPLGSKIVFII  174

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVP  555
             R +  TVQ V+T  P+ VS  MV+++  +++ESIV VEG +  P
Sbjct  175  FRHQITTVQGVVTEEPEKVSQTMVRWSEGIARESIVLVEGFIQRP  219



>ref|XP_007378606.1| aspartate-tRNA ligase [Punctularia strigosozonata HHB-11173 SS5]
 gb|EIN13689.1| aspartate-tRNA ligase [Punctularia strigosozonata HHB-11173 SS5]
Length=553

 Score = 77.4 bits (189),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL+  +S++   ++   I +L   +  + VL+R R  T RA G K+ F  
Sbjct  68   DFAADFYGKLPLN--RSQSRPKQQRVSIASLNPNMDGQTVLLRARVHTSRAQGNKMVFFN  125

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  TVQ +LTV P+ VS QM K+A  LS ESIV V+GVV      IK AT
Sbjct  126  LRQRMDTVQALLTVQPEKVSKQMAKWAAGLSMESIVLVQGVVKKSPEIIKSAT  178



>gb|KDQ55235.1| hypothetical protein JAAARDRAFT_37783 [Jaapia argillacea MUCL 
33604]
Length=548

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG  PL+  +S+  +GR    I  L   L+ + VL+R R  T RA G K+ F+ +R+R  
Sbjct  72   YGKQPLN--QSQTRTGRPRVFIHDLNPNLEGQTVLLRARVHTSRAQGNKMVFLNLRQRSD  129

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +LTV P+ VS QMVK+A  L  ESIV VEG+V      IK A+
Sbjct  130  SVQALLTVEPEKVSKQMVKWAAGLQAESIVLVEGIVMKSPDLIKSAS  176



>gb|KIK28495.1| hypothetical protein PISMIDRAFT_90979 [Pisolithus microcarpus 
441]
Length=529

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +P+   +S++   R+  DI  LTA+     VL+R R QT R  G K+ F+ +R+R  
Sbjct  54   YGKLPMH--QSQSRQNRERIDISTLTAQNDGTRVLVRARIQTSRLQGNKMVFLNLRQRTN  111

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +++V  D +S QMVK+A +L+ ESIV VEG V      IK A+
Sbjct  112  TVQALMSVTKDTISKQMVKWAGALADESIVLVEGDVKKSPEPIKSAS  158



>ref|XP_006956313.1| aspartyl-tRNA synthetase [Wallemia sebi CBS 633.66]
 gb|EIM23645.1| aspartyl-tRNA synthetase [Wallemia sebi CBS 633.66]
Length=522

 Score = 77.0 bits (188),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 62/113 (55%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A NYG I +   +   +   +  DI A     KDK V+IR R QT RA G K+ F  
Sbjct  40   DTAAQNYGPIKVHSQERTNIERTQIKDIDA---SYKDKHVVIRARVQTSRAQGAKMVFFG  96

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             R++  T+Q VL V    VS QMVK+A SL  ESIV ++G+V +P   +  AT
Sbjct  97   FRQQDSTIQGVLVVKEPAVSKQMVKWAGSLGDESIVLIDGIVQLPKEPVHSAT  149



>emb|CDW89692.1| aspartyl-trna synthetase [Stylonychia lemnae]
Length=568

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 44/117 (38%), Positives = 76/117 (65%), Gaps = 5/117 (4%)
 Frame = +1

Query  238  PDPLAAN-YGDIPLDDLKS--KAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            P+ ++A+ +GD+ L+  +S  +    R ++ +  L A L+ +EVL+RGR  T RA GK +
Sbjct  72   PNDISAHLFGDLELNRSQSDPELRYARTFTQVKDLDASLQGQEVLVRGRLHTSRATGK-M  130

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             FIV+R++  TVQ VL V+  +  G MV ++  + KESI+D++ +VSVP  +++G +
Sbjct  131  CFIVLREQFATVQSVLFVSEKISKG-MVDFSRRIPKESIIDLKAIVSVPEKEVQGCS  186



>ref|XP_006117110.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Pelodiscus sinensis]
Length=501

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 67/107 (63%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL  ++S+    R    I  LT E  D+ V IRGR  T RA GK+  F+V+R++ F
Sbjct  29   YGVLPL--IQSQEKPDRVLVRIKDLTVEKTDEVVWIRGRIHTSRAKGKQ-CFLVLRQQQF  85

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             VQ ++ V  D  S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  86   NVQALVAVG-DHASKQMVKFAANINKESIVDVEGVVRKVHQKIGGCT  131



>ref|NP_984057.1| ADL039Cp [Ashbya gossypii ATCC 10895]
 gb|AAS51881.1| ADL039Cp [Ashbya gossypii ATCC 10895]
 gb|AEY96179.1| FADL039Cp [Ashbya gossypii FDAG1]
Length=556

 Score = 76.6 bits (187),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 66/109 (61%), Gaps = 3/109 (3%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG +PL  ++S + +G K      LTAE + KEVL+R R  T+R  G  +AF+++R+R 
Sbjct  76   NYGALPL--IQSASRTGEKRIQFAELTAEDEGKEVLLRSRVHTVRQQGATLAFLMLRQRS  133

Query  436  FTVQCVLTV-APDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
              +Q ++   A   VS QMVK+A SL+ ESIV V GVV      +K AT
Sbjct  134  SLIQALVKANAEGTVSKQMVKWAGSLNLESIVLVRGVVRKVEEPVKSAT  182



>gb|EMD32133.1| hypothetical protein CERSUDRAFT_144292 [Ceriporiopsis subvermispora 
B]
Length=950

 Score = 77.4 bits (189),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 47/116 (41%), Positives = 67/116 (58%), Gaps = 5/116 (4%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DPL  NYGD PL+  +S+A     +  +  +  +   + V+ RGR   IR +G KI FIV
Sbjct  105  DPLRDNYGDFPLN--QSQAREEPHYIPLKDIAEKQDGERVVFRGRVHHIRPLGSKIVFIV  162

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVP---NVQIKGAT  579
             R +  TVQ VLT     VS  MV++A  +++ES+V VEGVV  P     +++GAT
Sbjct  163  FRHQLTTVQGVLTETDGAVSQTMVRWAEGINRESVVKVEGVVQRPPPDQEEVRGAT  218



>ref|NP_588352.1| cytoplasmic aspartate-tRNA ligase Drs1 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|O74407.1|SYDC_SCHPO RecName: Full=Aspartate--tRNA ligase, cytoplasmic; AltName: Full=Aspartyl-tRNA 
synthetase; Short=AspRS [Schizosaccharomyces 
pombe 972h-]
 emb|CAA20876.1| cytoplasmic aspartate-tRNA ligase Drs1 (predicted) [Schizosaccharomyces 
pombe]
Length=580

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YGD+PL+  +S A  GR ++ I  ++A+   + VL+R R  T R  G K+ F  
Sbjct  70   DYSAGKYGDLPLN--RSTARPGRTYTQISDISAKNDGQTVLLRARVYTSRLQGNKMCFFS  127

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++  T+Q +  V  D +S QMVK+  S+S ESIV VEG+V      IK AT
Sbjct  128  LRQKYDTIQALAVVNKDTISKQMVKWCGSISLESIVLVEGIVKKSPEIIKSAT  180



>gb|KFP01245.1| Aspartate--tRNA ligase, cytoplasmic, partial [Calypte anna]
Length=479

 Score = 76.3 bits (186),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 4/113 (4%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D     YG  P+  ++S+  SGR    I  LT E  D+ V +RGR  T RA GK+  F+V
Sbjct  1    DYAKERYGVSPM--IQSQEKSGRVLIRIKDLTVEKADEVVWVRGRIHTSRAKGKQ-CFLV  57

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++ F +Q ++ V     S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  58   LRQQQFNIQALVAVGQH-ASKQMVKFAANINKESIVDVEGVVRKAHQKIGGCT  109



>ref|XP_003400609.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like isoform 
1 [Bombus terrestris]
Length=532

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG+I L   K K    RK++D+  L   L+++ + +RGR  T RA GK+  FIV+R++ +
Sbjct  58   YGEIGLIQSKEKHTE-RKFTDVKNLNPSLENQTIWLRGRLHTSRAKGKQ-CFIVLRQQSY  115

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            T+Q ++ V  + VS QM+K+ ++++KESIVD+E VV     QI+  T
Sbjct  116  TIQGLVAVN-EKVSKQMIKFISNITKESIVDIEAVVKCVPSQIESCT  161



>ref|XP_003400610.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like isoform 
2 [Bombus terrestris]
Length=534

 Score = 76.3 bits (186),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG+I L   K K    RK++D+  L   L+++ + +RGR  T RA GK+  FIV+R++ +
Sbjct  60   YGEIGLIQSKEKHTE-RKFTDVKNLNPSLENQTIWLRGRLHTSRAKGKQ-CFIVLRQQSY  117

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            T+Q ++ V  + VS QM+K+ ++++KESIVD+E VV     QI+  T
Sbjct  118  TIQGLVAVN-EKVSKQMIKFISNITKESIVDIEAVVKCVPSQIESCT  163



>ref|XP_002423869.1| aspartyl-tRNA synthetase, putative [Pediculus humanus corporis]
 gb|EEB11131.1| aspartyl-tRNA synthetase, putative [Pediculus humanus corporis]
Length=532

 Score = 76.3 bits (186),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 41/89 (46%), Positives = 61/89 (69%), Gaps = 2/89 (2%)
 Frame = +1

Query  313  WSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMV  492
            +S++  L  +L    V +RGR QT RA GK+  FIV+R++ +T+QC L V  D+VS QMV
Sbjct  74   FSEVKNLNEKLSGVLVKVRGRLQTSRAKGKQ-CFIVLRQQQYTIQCFLCVN-DVVSKQMV  131

Query  493  KYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            K+A+ +SKESI+DV+GV+     +I+  T
Sbjct  132  KFASVISKESIIDVDGVIQTVAQKIESCT  160



>ref|XP_002185644.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|ACI65114.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=579

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/111 (41%), Positives = 67/111 (60%), Gaps = 6/111 (5%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            N+GD PL  ++S+ ++ + W+ I  L   L  + VL+RG  QT RAVGK  AF++VR   
Sbjct  85   NFGDAPL--IQSQIITDKVWTPIQNLKPSLAGESVLVRGHLQTARAVGKG-AFVLVRSSL  141

Query  436  FTVQCVLTVAPD---LVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            ++VQ V   + D    VS  M+KY   L  ES+VD+ G+V+VP+  +  AT
Sbjct  142  YSVQGVAFESKDDDGAVSSAMIKYMAGLPAESVVDMRGIVTVPDQPVDSAT  192



>ref|XP_007359937.1| aspartate-tRNA ligase [Dichomitus squalens LYAD-421 SS1]
 gb|EJF66647.1| aspartate-tRNA ligase [Dichomitus squalens LYAD-421 SS1]
Length=542

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S++   R+   I +LT E   + VL+R R QT RA G K+ F+ +R+R  
Sbjct  59   YGKLPLN--QSQSRPRRERVQIASLTPEHDGQTVLVRARVQTSRAQGSKMVFLNLRQRID  116

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +L + P  VS QM+K+A  L  ESIV  EGVV      IK AT
Sbjct  117  SVQALLVLTPGKVSKQMLKWAAGLQTESIVLAEGVVKKSPEPIKSAT  163



>ref|XP_011109344.1| hypothetical protein H072_3369 [Dactylellina haptotyla CBS 200.50]
 gb|EPS42658.1| hypothetical protein H072_3369 [Dactylellina haptotyla CBS 200.50]
Length=559

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/114 (39%), Positives = 68/114 (60%), Gaps = 3/114 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  + NYG +PL+  +S   +G     I +L+A    KEVL+R R    RA G K+ F+ 
Sbjct  75   DTASENYGKLPLN--QSTERTGATRLAISSLSAADAGKEVLLRARVHNARAQGNKMTFLE  132

Query  421  VRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++ +TVQ +++V  D  +S QMVK+A  ++ ESI+ V GVV  P+  IK  T
Sbjct  133  LRQQQYTVQALMSVQNDGSISKQMVKWAAGINLESIILVHGVVVKPDEAIKSTT  186



>gb|EMD41820.1| hypothetical protein CERSUDRAFT_110384 [Ceriporiopsis subvermispora 
B]
Length=548

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 60/107 (56%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+    R    I AL   +  + VLIR R QT RA G K+ F   R+R  
Sbjct  68   YGKLPLN--QSQTRPRRPRVQIAALNPNMDGETVLIRARVQTSRAQGNKMVFFNFRQRID  125

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +L VAP  VS QM K+A  L  ESIV VEGVV      IK AT
Sbjct  126  SVQGLLIVAPGKVSKQMAKWAAGLQMESIVLVEGVVKKSPEPIKSAT  172



>ref|XP_001011634.1| tRNA synthetases class II [Tetrahymena thermophila]
 gb|EAR91389.1| cytoplasmic aspartyl-tRNA synthetase [Tetrahymena thermophila 
SB210]
Length=551

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 61/113 (54%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D L  NYGD  L  ++S   + +KW  I  +      K +LIRGR   +R +G   AF++
Sbjct  64   DSLKENYGDYQL--VQSLQQTNKKWIQIKDIDDSFLGKNILIRGRLHNLRIIGN-CAFLI  120

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            VR++   +Q V     D+ S  M+K+   +  ESI+D+ G+V  PN+ I  A+
Sbjct  121  VRQQSQNIQVVAQKQADITSKTMIKWIKKIHLESIIDIHGIVQKPNIPINCAS  173



>gb|KIJ27385.1| hypothetical protein M422DRAFT_271448 [Sphaerobolus stellatus 
SS14]
Length=540

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL+  +SK   GR    I +LT   + + V  R R    RA G K+ F  
Sbjct  58   DYSAQRYGKLPLN--QSKEREGRPRIQISSLTPSQEGQTVFFRARVTASRAQGSKMVFFN  115

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R++  ++Q ++ V+P+ VS QMVK+A ++  ESIV VEG V +P  ++K A+
Sbjct  116  LRQKTDSIQALVVVSPEKVSKQMVKWAGTIPDESIVLVEGTVQLPLEEVKSAS  168



>ref|XP_007852806.1| aspartate-trna ligase [Moniliophthora roreri MCA 2997]
 gb|ESK87893.1| aspartate-trna ligase [Moniliophthora roreri MCA 2997]
Length=541

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 67/108 (62%), Gaps = 5/108 (5%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKE-VLIRGRAQTIRAVGKKIAFIVVRKRG  435
            YG +PL   +S++  GR    I +L++  +D E VL R R  T RA G K+ F+ +R+R 
Sbjct  63   YGALPLH--QSQSRPGRTRVQISSLSS--RDGETVLFRARVHTSRAQGNKMVFLNLRQRT  118

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             +VQ +L V P+ VS QMVK+A SL+ ESIV VEGVV      IK A+
Sbjct  119  DSVQALLIVTPEKVSKQMVKWAASLADESIVLVEGVVKKTPEPIKSAS  166



>ref|XP_007878981.1| hypothetical protein PFL1_03273 [Pseudozyma flocculosa PF-1]
 gb|EPQ28983.1| hypothetical protein PFL1_03273 [Pseudozyma flocculosa PF-1]
Length=560

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  + NYG +PL+   S+  +GRK++ I  +  E   ++VL+  R QT R+   K+ F+ 
Sbjct  72   DFASQNYGKLPLN--MSQERTGRKFTAIADINEERDGEQVLLSARIQTSRSPSAKLVFVT  129

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R   VQ  L  AP+ VS QM K+A SL+ E+IV VEG +      I+ AT
Sbjct  130  LRQRTDCVQATLAQAPEKVSKQMTKWAASLAAETIVLVEGTIVRAPKPIESAT  182



>gb|KDN49617.1| aspartyl-tRNA synthetase [Tilletiaria anomala UBC 951]
Length=570

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/103 (38%), Positives = 64/103 (62%), Gaps = 2/103 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A NYG +PL+  +S+   G +++ +GA++AE   + V ++ R Q  R+   K+AF+V
Sbjct  81   DFAAQNYGQLPLN--QSQERHGIEFTPLGAISAERDGERVFVQARLQLCRSTSAKLAFLV  138

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVS  549
            +R R   VQ VL   PD VS +MVK+  SL  E+++++E  +S
Sbjct  139  LRNRFDCVQAVLAETPDQVSRKMVKWTASLPVETLLNLEASIS  181



>ref|XP_004537437.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Ceratitis 
capitata]
Length=539

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 49/111 (44%), Positives = 70/111 (63%), Gaps = 5/111 (5%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTA-ELKDKEVLIRGRAQTIRAVGKKI  408
            D+ D  A  YG   L   K K    RK+  +  L+  E +D+ V +RGR  T RA GK+ 
Sbjct  55   DAVDVSAGRYGSTGLIQSKEK-FEERKFVSVNELSQPEYRDQVVWVRGRVHTSRAKGKQ-  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVPN  558
             F+V+R++  TVQC+L V  + VS QMVK++ ++SKESI+DV+  VV+VPN
Sbjct  113  CFLVLRQQSSTVQCILAVN-ERVSKQMVKFSGNVSKESIIDVQAKVVTVPN  162



>ref|XP_003702833.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic-like [Megachile 
rotundata]
Length=531

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YGD+ L   K K  S RK+ DI  L  +L+++ V +RGR  T RA GK+  FIV+R++ +
Sbjct  57   YGDMGLIQSKDK-YSERKFVDIKNLKPDLENQTVWLRGRLHTSRAKGKQ-CFIVLRQQSY  114

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ  L    + VS QM+K+ ++++KESIVD+E VV +   +I+  T
Sbjct  115  TVQG-LAAINETVSKQMIKFISNITKESIVDIEAVVKLVPSKIESCT  160



>ref|XP_007265163.1| aspartyl-tRNA synthetase [Fomitiporia mediterranea MF3/22]
 gb|EJD03562.1| aspartyl-tRNA synthetase [Fomitiporia mediterranea MF3/22]
Length=585

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 65/107 (61%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+  + R    I +L  +L  + VL+R R QT RA G K+ F+++R+R  
Sbjct  107  YGKLPLN--RSQERANRHRDTIASLPGKL-GQNVLLRARVQTSRATGNKMVFLMLRQRID  163

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            TVQ +L      VS  M+K+  SL+ ESIV VEGVV  P  ++K AT
Sbjct  164  TVQGLLMAEEGKVSRPMIKWVASLADESIVLVEGVVDNPKEEVKSAT  210



>emb|CDY35247.1| BnaA01g07840D [Brassica napus]
Length=529

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/118 (36%), Positives = 70/118 (59%), Gaps = 4/118 (3%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +++  +  ++NYGD+      ++AV G++ +D+  L  E+   EV IRGR    R VGKK
Sbjct  42   LEEEDESFSSNYGDVTPKS-AAEAVEGKELTDVSNLVEEIVGSEVSIRGRVHNHRLVGKK  100

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+++R+   +VQCV+  A   V   M K+   LS ES+V++ GVVS+P   + G T
Sbjct  101  L-FVILRQSVSSVQCVVEEAR--VGTSMFKFVRQLSHESVVELIGVVSLPKKPLTGTT  155



>ref|XP_004339518.1| aspartate-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR17505.1| aspartate-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=627

 Score = 75.9 bits (185),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 67/108 (62%), Gaps = 3/108 (3%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            N+G  PL  ++S+  + + ++++G L+A    + V +R R  T+R  G K+AF+V+R+R 
Sbjct  106  NFGVRPL--IRSEERTHKVYTNVGNLSAAKDGETVFVRARLYTVRGTGNKLAFVVLRQRT  163

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ VL    + VS +M+K+   + +ES+VDVEGVV+    +I   T
Sbjct  164  ATVQAVLE-KNETVSVEMIKFTKGIHRESLVDVEGVVTKAGTEIASCT  210



>ref|XP_003493969.1| PREDICTED: aspartyl-tRNA synthetase, cytoplasmic-like [Bombus 
impatiens]
Length=532

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 69/107 (64%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG+I L   K K    RK++D+  L   L+++ + +RGR  T RA GK+  FIV+R++ +
Sbjct  58   YGEIGLIQSKEKHTE-RKFTDVKNLNPNLENQTIWLRGRLHTSRAKGKQ-CFIVLRQQSY  115

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            T+Q ++ V  + VS QM+K+ ++++KESIVDVE VV     +I+  T
Sbjct  116  TIQGLVAVN-EKVSKQMIKFISNITKESIVDVEAVVKCVPSKIESCT  161



>gb|KIM48152.1| hypothetical protein M413DRAFT_223063 [Hebeloma cylindrosporum 
h7]
Length=543

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 69/113 (61%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL+  +S+    R    I  L +++ +K VL+R R QT RA G K+ F+ 
Sbjct  59   DFAAGLYGPLPLNQSQSRTRIER--DRISLLPSKIGEK-VLLRARVQTSRAQGTKMVFLN  115

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  +VQ +LTV P+ VS QMVK+A  L+ ESIV +EG+    +  IK A+
Sbjct  116  LRQRTDSVQALLTVTPEKVSKQMVKWAAGLADESIVLIEGIAVKTHEPIKSAS  168



>gb|KDR85046.1| hypothetical protein GALMADRAFT_218132 [Galerina marginata CBS 
339.88]
Length=542

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 65/107 (61%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S++   R   +I +L+    +  VL R R Q  RA G K+ F+ +R+R  
Sbjct  64   YGPLPLN--QSQSRPRRTRDEIVSLSGRAGEP-VLFRARVQASRAQGNKMVFLNLRQRTD  120

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ +L VAP+ VS QMVK+A SL+ ESIV VEGV       IK AT
Sbjct  121  SVQALLVVAPEKVSKQMVKWAASLADESIVLVEGVAEKTQEPIKSAT  167



>ref|XP_968957.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Tribolium castaneum]
 gb|EFA00049.1| hypothetical protein TcasGA2_TC002857 [Tribolium castaneum]
Length=533

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/114 (41%), Positives = 71/114 (62%), Gaps = 8/114 (7%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSG---RKWSDIGALTAELKDKEVLIRGRAQTIRAV  396
            + D  D     YG++PL  ++S + +    RK+  +  L   L   +V +R R  T+RA 
Sbjct  46   VADENDVSVGKYGNLPL--IRSDSTNTNKDRKFIYVKELNKSLAGNDVWVRARLHTVRAR  103

Query  397  GKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVP  555
            GK+  FIV+R+R FTVQ +L V+ + VS  MVK+A++++KESI+DVE  VV VP
Sbjct  104  GKQ-CFIVLRQREFTVQLLLNVS-ETVSKSMVKFASNITKESIIDVEAKVVQVP  155



>ref|XP_008492572.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Calypte anna]
Length=468

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/99 (44%), Positives = 63/99 (64%), Gaps = 2/99 (2%)
 Frame = +1

Query  283  LKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTV  462
            ++S+  SGR    I  LT E  D+ V +RGR  T RA GK+  F+V+R++ F +Q ++ V
Sbjct  2    IQSQEKSGRVLIRIKDLTVEKADEVVWVRGRIHTSRAKGKQ-CFLVLRQQQFNIQALVAV  60

Query  463  APDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
                 S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  61   GQH-ASKQMVKFAANINKESIVDVEGVVRKAHQKIGGCT  98



>ref|XP_007861098.1| aspartyl-tRNA synthetase [Gloeophyllum trabeum ATCC 11539]
 gb|EPQ60768.1| aspartyl-tRNA synthetase [Gloeophyllum trabeum ATCC 11539]
Length=543

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 49/107 (46%), Positives = 62/107 (58%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S +   R    I  L+  L  + VL+R R QT RA G K+ F+ +R+R  
Sbjct  64   YGKLPLN--QSSSRPRRTRHQIKDLSESLDGQTVLLRCRIQTSRAQGNKMVFLNLRQRTD  121

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ VLTV    VS QM K+A  LS ESIV VEGVV      IK AT
Sbjct  122  SVQAVLTVKQGEVSKQMAKWAAGLSMESIVLVEGVVKKAPEIIKSAT  168



>ref|XP_011208424.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Bactrocera dorsalis]
Length=539

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 48/111 (43%), Positives = 69/111 (62%), Gaps = 5/111 (5%)
 Frame = +1

Query  232  DSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTA-ELKDKEVLIRGRAQTIRAVGKKI  408
            DS D  A  YG   L   K K    RK+  +  L+    +D+ V +RGR  T R+ GK+ 
Sbjct  55   DSVDVSAGRYGSAGLIQSKEK-FEDRKFVSVSELSQPAYRDQLVWVRGRVHTSRSKGKQ-  112

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVPN  558
             F+V+R++  TVQC+L V  D +S QMVK++ ++S+ESI+DV+  VVSVPN
Sbjct  113  CFLVLRQQSSTVQCILAVG-DRISKQMVKFSGNVSRESIIDVQAKVVSVPN  162



>ref|XP_002490206.1| Cytoplasmic aspartyl-tRNA synthetase, homodimeric enzyme [Komagataella 
pastoris GS115]
 emb|CAY67925.1| Cytoplasmic aspartyl-tRNA synthetase, homodimeric enzyme [Komagataella 
pastoris GS115]
 emb|CCA37004.1| aspartyl-tRNA synthetase [Komagataella pastoris CBS 7435]
Length=555

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKK  405
            +D + D    NYG +PL+  +S    G K  +IG+LTA    KEV+ R R    R  G  
Sbjct  66   LDAANDTAKENYGRLPLN--QSTTKPGIKRIEIGSLTAADDGKEVVFRARIYNTRKQGTT  123

Query  406  IAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + F+ +R+R   +Q VL    D VS QMVK+A+++S ESIV V G +S     +K AT
Sbjct  124  MVFLSLRQRTELIQAVLKANGDSVSKQMVKWASAISLESIVTVHGTISKVVEPVKSAT  181



>gb|ETE73729.1| Aspartyl-tRNA synthetase, cytoplasmic, partial [Ophiophagus hannah]
Length=532

 Score = 74.3 bits (181),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/101 (44%), Positives = 65/101 (64%), Gaps = 5/101 (5%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +P+  ++S+    R    I  LT E  D+ V +RGR  T RA GK+  F+V+R++ F
Sbjct  72   YGILPM--IQSQEKPDRVLVRIKDLTGEKADETVWVRGRIHTSRAKGKQ-CFLVIRQQQF  128

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVV-SVPN  558
             +Q ++ V  D  S QMVK+A +++KESIVD+EGV+  VPN
Sbjct  129  NIQALVAVG-DHASKQMVKFAANINKESIVDIEGVIRKVPN  168



>ref|XP_002112894.1| hypothetical protein TRIADDRAFT_56497 [Trichoplax adhaerens]
 gb|EDV25004.1| hypothetical protein TRIADDRAFT_56497 [Trichoplax adhaerens]
Length=535

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 40/108 (37%), Positives = 69/108 (64%), Gaps = 4/108 (4%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG + L  ++S   +GRKWS I  L  ++  + VL+R R    R  GK+  F+V+R++ 
Sbjct  61   NYGIMKL--IQSTEKTGRKWSKIRDLNEKVAGQSVLLRARLHNSRGKGKQ-CFLVLRQQS  117

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +++Q +  V+ + VS  MVK+A++++KES+VDVEG+V     +I+  +
Sbjct  118  YSIQGIAAVS-ETVSKAMVKFASNVNKESVVDVEGIVKAVTTKIEACS  164



>gb|KIK06941.1| hypothetical protein K443DRAFT_673834 [Laccaria amethystina LaAM-08-1]
Length=538

 Score = 74.3 bits (181),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 48/112 (43%), Positives = 69/112 (62%), Gaps = 6/112 (5%)
 Frame = +1

Query  250  AAN-YGDIPLDDLKSKAVSGR-KWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVV  423
            AAN YG +PL+  +S+    R K +D+ +   E+    V++R R QT RA G K+ F+ +
Sbjct  56   AANLYGALPLNQSQSRPRRPRDKIADLSSRVGEI----VVLRARVQTSRAQGNKMVFLNL  111

Query  424  RKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            R+   TVQ +LTV P+ VS QMVK+  SL+ ESI+ VEG V+     IK A+
Sbjct  112  RQTTDTVQALLTVTPEKVSKQMVKWTASLADESIILVEGNVTRVQEPIKSAS  163



>ref|XP_393437.2| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Apis mellifera]
Length=533

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 43/107 (40%), Positives = 67/107 (63%), Gaps = 3/107 (3%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG+  L   K K  + RK+ DI  L   L+++ V +RGR  T RA GK+  FIV+R++ +
Sbjct  58   YGETGLIQSKEK-YAERKFIDIKDLNPNLENQNVWLRGRLHTSRAKGKQ-CFIVLRQQSY  115

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            T+Q  L    + VS QM+K+ ++++KESIVD+E +V   + QI+  T
Sbjct  116  TIQG-LAAVNNKVSKQMIKFISNITKESIVDIEAIVKCVSSQIESCT  161



>ref|XP_001986463.1| GH21379 [Drosophila grimshawi]
 gb|EDW01330.1| GH21379 [Drosophila grimshawi]
Length=533

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/113 (40%), Positives = 73/113 (65%), Gaps = 7/113 (6%)
 Frame = +1

Query  229  DDSPDPLAANYGDIPLDDLKSKAV-SGRKWSDIGALTAELKDKEVL-IRGRAQTIRAVGK  402
            D++ D  A  YG   +  ++SK   S R++  +  L+  + DK +L +RGR  T RA GK
Sbjct  48   DNAADHAADRYGLYEM--IQSKETRSERQFVSVSELSNHVNDKGLLWVRGRVHTSRAKGK  105

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVPN  558
            +  F+++R++  TVQC+L V  D++S QMVK+A ++ KESI+D++   V+VPN
Sbjct  106  Q-CFLILRQQSSTVQCILAVG-DVISKQMVKFAGNIPKESIIDIQAKAVAVPN  156



>ref|XP_011301459.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Fopius arisanus]
Length=540

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 74/119 (62%), Gaps = 5/119 (4%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSKAVSG-RKWSDIGALTAELKDKEVLIRGRAQTIRAVGK  402
            ++++ D     YG + L  ++S    G RK++D+  L  ++KD+ V +RGR  T RA GK
Sbjct  57   VENAEDISLGRYGQMGL--IQSSESHGERKFTDVKDLQPKIKDQNVWVRGRLHTSRAKGK  114

Query  403  KIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +  FIV+R++ +TVQ +  V  + +S QM+K+ +++SKESI+DV+  V     +I+  T
Sbjct  115  Q-CFIVIRQQSYTVQGLAAVN-ERISKQMIKFISNISKESIIDVKASVKTVETKIESCT  171



>gb|KIK71060.1| hypothetical protein GYMLUDRAFT_90054 [Gymnopus luxurians FD-317 
M1]
Length=539

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 66/113 (58%), Gaps = 3/113 (3%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D  A  YG +PL   +S+    R   DI +L + + D  VL+R R    RA G K+ F+ 
Sbjct  55   DYAAEFYGQLPLHQSQSRPRKSR--VDIVSLPSHVGDT-VLLRARIHNSRAQGSKMVFLN  111

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  +VQ ++ V+P+ VS QMVK+A  L+ ESI+ VEG+V      IK AT
Sbjct  112  LRQRTESVQALMIVSPEKVSKQMVKWAAGLATESIILVEGIVKQSPEIIKSAT  164



>gb|KJE94928.1| aspartyl-tRNA synthetase, variant 2 [Capsaspora owczarzaki ATCC 
30864]
Length=513

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  AANYGDIPLDDLKSKAVSGRKWSDIGALTA-ELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
            A  YG  P++  ++K  + R W+ I  L+A +   K VL+R R    R  GK+ AF+V+R
Sbjct  27   AGLYGVEPINQSQTK--TNRVWTRIDELSAAKHTGKTVLLRARVHNTRGTGKQ-AFLVLR  83

Query  427  KRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVP  555
            +R  T+Q V+ V P  VS QMVK+  SLSKES VDVEG +V VP
Sbjct  84   QRFVTLQGVIFVGP-AVSKQMVKFVASLSKESFVDVEGTIVGVP  126



>gb|KJE94927.1| aspartyl-tRNA synthetase, variant 1 [Capsaspora owczarzaki ATCC 
30864]
Length=519

 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  AANYGDIPLDDLKSKAVSGRKWSDIGALTA-ELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
            A  YG  P++  +S+  + R W+ I  L+A +   K VL+R R    R  GK+ AF+V+R
Sbjct  33   AGLYGVEPIN--QSQTKTNRVWTRIDELSAAKHTGKTVLLRARVHNTRGTGKQ-AFLVLR  89

Query  427  KRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVP  555
            +R  T+Q V+ V P  VS QMVK+  SLSKES VDVEG +V VP
Sbjct  90   QRFVTLQGVIFVGP-AVSKQMVKFVASLSKESFVDVEGTIVGVP  132



>ref|XP_007390434.1| hypothetical protein PHACADRAFT_247281 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM60997.1| hypothetical protein PHACADRAFT_247281 [Phanerochaete carnosa 
HHB-10118-sp]
Length=556

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 47/113 (42%), Positives = 66/113 (58%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            D   A+YG   L+  +S++   R+   I +L   +  + VL+R R QT RA G K+ F+ 
Sbjct  70   DYAVASYGKESLN--QSQSRPRRQRVQICSLNPSMDGETVLLRARVQTSRAQGNKMVFLN  127

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +R+R  +VQ +L V P+ VS QMVK+A SL  ESIV VEG V      IK A+
Sbjct  128  LRQRTDSVQALLIVTPEKVSKQMVKWAASLQDESIVLVEGAVKKSPEVIKSAS  180



>ref|XP_007299157.1| aspartyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
 gb|EIM92906.1| aspartyl-tRNA synthetase [Stereum hirsutum FP-91666 SS1]
Length=548

 Score = 73.6 bits (179),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 64/107 (60%), Gaps = 2/107 (2%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL+  +S+     K   I +L+  L  + V++R R  T+RA G K+ F+ +R+R  
Sbjct  72   YGKLPLN--QSQTRPNIKRVQITSLSPNLDGQTVVLRARIHTLRAQGNKMVFLNLRQRIE  129

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            +VQ ++TV    VS QMVK+A SL  ESIV VEGVV      IK AT
Sbjct  130  SVQALITVTEGKVSKQMVKWAGSLGSESIVLVEGVVKTAPEIIKSAT  176



>ref|XP_009129024.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Brassica rapa]
Length=534

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 69/122 (57%), Gaps = 7/122 (6%)
 Frame = +1

Query  226  IDDSPDPLAANYGDIPLDDLKSK----AVSGRKWSDIGALTAELKDKEVLIRGRAQTIRA  393
            +++  +  ++NYGD+       +    AV G++ +D+  L  E+   EV IRGR    R 
Sbjct  42   LEEEDESFSSNYGDVTPKSAAGRCWREAVEGKELTDVSNLVEEIVGSEVSIRGRVHNHRL  101

Query  394  VGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKG  573
            VGKK+ F+++R+   +VQCV+  A   V   M K+   LS ES+V++ GVVS+P   + G
Sbjct  102  VGKKL-FVILRQSVSSVQCVVEEAR--VGTSMFKFVKQLSHESVVELIGVVSLPKKPLTG  158

Query  574  AT  579
             T
Sbjct  159  TT  160



>ref|XP_003687768.1| hypothetical protein TPHA_0K02010 [Tetrapisispora phaffii CBS 
4417]
 emb|CCE65334.1| hypothetical protein TPHA_0K02010 [Tetrapisispora phaffii CBS 
4417]
Length=557

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 62/116 (53%), Gaps = 1/116 (1%)
 Frame = +1

Query  235  SPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAF  414
            +PD  AANYG +PL      A +         LT ++ DKEVL R R    R  G  +AF
Sbjct  66   APDSAAANYGKLPLVQSLPSARTNESRIKFEDLTEDMNDKEVLFRARVHNTRQQGATLAF  125

Query  415  IVVRKRGFTVQCVLTVAPD-LVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            + +R++   +Q +L V  +  VS +M K+A SL  ESIV V GVV   +  IK AT
Sbjct  126  LTLRQQSQLIQALLRVNKEGSVSKKMTKWAGSLHLESIVLVRGVVKKVDEPIKSAT  181



>gb|KIY72817.1| aspartyl-tRNA synthetase [Cylindrobasidium torrendii FP15055 
ss-10]
Length=541

 Score = 73.6 bits (179),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 47/108 (44%), Positives = 62/108 (57%), Gaps = 3/108 (3%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG +PL+  +S +   R+  +I  L     DK VL R R QT RA G K+ F+ +R+R 
Sbjct  62   NYGSLPLN--QSGSRPRRERVNIADLNKHY-DKPVLFRARIQTSRAQGNKMVFLNLRQRI  118

Query  436  FTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             TVQ +  V  D +S QMVK+  +L  ESIV VEGV   P   IK A+
Sbjct  119  DTVQALAVVNSDTISKQMVKWIATLPDESIVLVEGVAKQPPEPIKSAS  166



>ref|XP_004346141.2| aspartyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
 gb|KJE94926.1| aspartyl-tRNA synthetase [Capsaspora owczarzaki ATCC 30864]
Length=536

 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 6/104 (6%)
 Frame = +1

Query  250  AANYGDIPLDDLKSKAVSGRKWSDIGALTA-ELKDKEVLIRGRAQTIRAVGKKIAFIVVR  426
            A  YG  P++  ++K  + R W+ I  L+A +   K VL+R R    R  GK+ AF+V+R
Sbjct  50   AGLYGVEPINQSQTK--TNRVWTRIDELSAAKHTGKTVLLRARVHNTRGTGKQ-AFLVLR  106

Query  427  KRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVP  555
            +R  T+Q V+ V P  VS QMVK+  SLSKES VDVEG +V VP
Sbjct  107  QRFVTLQGVIFVGP-AVSKQMVKFVASLSKESFVDVEGTIVGVP  149



>ref|XP_005049720.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Ficedula albicollis]
Length=503

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +1

Query  283  LKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTV  462
            ++S+    R    I  LT E  D+EV +RGR  T RA GK+  F+V+R++ F +Q ++ V
Sbjct  37   IQSQEKPDRVLVRIKDLTVEKADEEVWVRGRIHTSRAKGKQ-CFLVLRQQQFNIQALVAV  95

Query  463  APDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
                 S QMVK+A +++KESIVD+EGVV   + +I G T
Sbjct  96   GQH-ASKQMVKFAANITKESIVDIEGVVRKAHQKIGGCT  133



>ref|XP_002006462.1| GI18555 [Drosophila mojavensis]
 gb|EDW10397.1| GI18555 [Drosophila mojavensis]
Length=533

 Score = 73.2 bits (178),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 44/110 (40%), Positives = 69/110 (63%), Gaps = 4/110 (4%)
 Frame = +1

Query  229  DDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            D++ D  AA YG   +   K K  S R++  +  L+A +    V +RGR  T RA GK+ 
Sbjct  49   DNAADHAAARYGLSEMIQSKDKR-SEREFVTVPELSAHVGKGLVWVRGRVHTTRAKGKQ-  106

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEG-VVSVP  555
             F+++R++  TVQC+L V  D++S QMVK+A ++ KESI+D++   V+VP
Sbjct  107  CFLILRQQSSTVQCILAVG-DIISKQMVKFAGNIPKESIIDIQAKAVAVP  155



>ref|XP_003215139.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Anolis carolinensis]
Length=503

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/107 (43%), Positives = 66/107 (62%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG +PL  ++S+    R    +  LT E  D+ V +RGR  T RA GK+  F+V+R++ F
Sbjct  31   YGVLPL--IQSQDKPDRVLVRVKDLTGEKADEVVWVRGRVHTSRAKGKQ-CFLVLRQQQF  87

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             VQ ++ V  D  S QMVK+A +++KESIVD+EGVV     +I G T
Sbjct  88   NVQALVAVG-DHASKQMVKFAANINKESIVDIEGVVRKVPHKIGGCT  133



>gb|ELT90819.1| hypothetical protein CAPTEDRAFT_148058 [Capitella teleta]
Length=530

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/107 (35%), Positives = 69/107 (64%), Gaps = 4/107 (4%)
 Frame = +1

Query  259  YGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGF  438
            YG++P+  ++S+    R+   I A+   +  +++ +RGR  T R  GK+  F V+R+R +
Sbjct  61   YGNLPM--IQSREKVDRELKPIAAVDQSMDGQKIWVRGRLHTSRGAGKQ-CFFVLRQRQY  117

Query  439  TVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
            T+Q +L+V  + VS  MVK+A++++ ESI+DVEG+V   +V++   +
Sbjct  118  TIQALLSVGSE-VSKPMVKFASTINLESIIDVEGIVRTTDVKVTSCS  163



>ref|XP_005519661.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic [Pseudopodoces 
humilis]
Length=503

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/99 (42%), Positives = 62/99 (63%), Gaps = 2/99 (2%)
 Frame = +1

Query  283  LKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTV  462
            ++S+    R    I  LT E  D+EV +RGR  T RA GK+  F+V+R++ F +Q ++ V
Sbjct  37   IQSQEKPDRVLVRIKDLTVEKADEEVWVRGRIHTSRAKGKQ-CFLVLRQQQFNIQALVAV  95

Query  463  APDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
                 S QMVK+A +++KESIVD+EGVV   + +I G T
Sbjct  96   GQH-ASKQMVKFAANITKESIVDIEGVVRKAHQKIGGCT  133



>ref|XP_005153817.1| PREDICTED: aspartate--tRNA ligase, cytoplasmic isoform X2 [Melopsittacus 
undulatus]
Length=499

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 4/117 (3%)
 Frame = +1

Query  229  DDSPDPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKI  408
            + S D     YG  P+  ++S+    R    I  LT E  D+ V +RGR  T RA GK+ 
Sbjct  17   ESSSDYAKERYGVSPM--IQSQEKPDRVLIRIKDLTVEKADEVVWVRGRIHTSRAKGKQ-  73

Query  409  AFIVVRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             F+V+R++ F +Q ++ V     S QMVK+A +++KESIVDVEGVV   + +I G T
Sbjct  74   CFLVLRQQQFNIQALVAVGQH-ASKQMVKFAANINKESIVDVEGVVRKAHQKIGGCT  129



>ref|XP_007213075.1| hypothetical protein PRUPE_ppa021187mg, partial [Prunus persica]
 gb|EMJ14274.1| hypothetical protein PRUPE_ppa021187mg, partial [Prunus persica]
Length=359

 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 37/65 (57%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +1

Query  322  IGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRGFTVQCVLTVAPDLVSGQMVKYA  501
            + ALT  L++  V I G+A TIR VGK +AF+VVR+R FTVQCV+TV P  VS QMVKY 
Sbjct  30   VAALTNALENS-VRIGGKAHTIRVVGKNMAFVVVRERWFTVQCVVTVQPSTVSRQMVKYV  88

Query  502  TSLSK  516
               S+
Sbjct  89   AGFSE  93



>emb|CDK27411.1| unnamed protein product [Kuraishia capsulata CBS 1993]
Length=554

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/113 (41%), Positives = 62/113 (55%), Gaps = 2/113 (2%)
 Frame = +1

Query  241  DPLAANYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIV  420
            DP  ANYG +PL+  +S   +G        L+A    KEV+ R R  T R  G  I F+ 
Sbjct  70   DPAKANYGKLPLN--QSSTKTGIPRVKFHTLSAADDGKEVVFRARVHTSRQQGASIVFLS  127

Query  421  VRKRGFTVQCVLTVAPDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
             R++   +Q +L    D VS QM+K+A SL+ ESIV V GVV   + +IK AT
Sbjct  128  FRQQSDLIQGLLKAEGDSVSKQMIKWAGSLNLESIVLVHGVVRKVDEEIKSAT  180



>gb|AGO11735.1| AaceriADL039Cp [Saccharomycetaceae sp. 'Ashbya aceri']
Length=556

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 63/109 (58%), Gaps = 3/109 (3%)
 Frame = +1

Query  256  NYGDIPLDDLKSKAVSGRKWSDIGALTAELKDKEVLIRGRAQTIRAVGKKIAFIVVRKRG  435
            NYG +PL  ++S   SG K      LTA  + KEVL+R R  T+R  G  +AF+++R+R 
Sbjct  76   NYGALPL--IQSTIRSGEKRIQFAELTAADEGKEVLLRARVHTVRQQGATLAFLMLRQRA  133

Query  436  FTVQCVLTV-APDLVSGQMVKYATSLSKESIVDVEGVVSVPNVQIKGAT  579
              +Q ++   A   VS QMVK+  SL+ ESIV V GVV      +K AT
Sbjct  134  SLIQALVKANAEGTVSKQMVKWVGSLNLESIVLVRGVVRKVEEPVKSAT  182



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 710292972220