BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C10

Length=567
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009595237.1|  PREDICTED: formimidoyltransferase-cyclodeami...    252   9e-80   Nicotiana tomentosiformis
ref|XP_004243327.1|  PREDICTED: formimidoyltransferase-cyclodeami...    251   2e-79   Solanum lycopersicum
ref|XP_006357514.1|  PREDICTED: formimidoyltransferase-cyclodeami...    251   2e-79   Solanum tuberosum [potatoes]
ref|XP_009758357.1|  PREDICTED: formimidoyltransferase-cyclodeami...    249   2e-78   Nicotiana sylvestris
ref|XP_008230229.1|  PREDICTED: formimidoyltransferase-cyclodeami...    235   9e-73   Prunus mume [ume]
ref|XP_008379557.1|  PREDICTED: formimidoyltransferase-cyclodeami...    233   2e-72   Malus domestica [apple tree]
emb|CDP14716.1|  unnamed protein product                                232   5e-72   Coffea canephora [robusta coffee]
ref|XP_007217258.1|  hypothetical protein PRUPE_ppa008822mg             231   1e-71   Prunus persica
ref|XP_010268809.1|  PREDICTED: formimidoyltransferase-cyclodeami...    230   3e-71   Nelumbo nucifera [Indian lotus]
ref|XP_009357093.1|  PREDICTED: formimidoyltransferase-cyclodeami...    228   9e-71   Pyrus x bretschneideri [bai li]
ref|XP_011085363.1|  PREDICTED: formimidoyltransferase-cyclodeami...    226   1e-69   Sesamum indicum [beniseed]
gb|EYU26110.1|  hypothetical protein MIMGU_mgv1a009671mg                226   1e-69   Erythranthe guttata [common monkey flower]
ref|XP_010095820.1|  hypothetical protein L484_022176                   224   4e-69   
ref|XP_004304114.1|  PREDICTED: formimidoyltransferase-cyclodeami...    224   6e-69   Fragaria vesca subsp. vesca
ref|XP_002278962.2|  PREDICTED: formimidoyltransferase-cyclodeami...    215   3e-65   Vitis vinifera
ref|XP_011467792.1|  PREDICTED: formimidoyltransferase-cyclodeami...    214   4e-65   Fragaria vesca subsp. vesca
ref|XP_006371604.1|  hypothetical protein POPTR_0019s13570g             214   7e-65   
ref|XP_011039770.1|  PREDICTED: formimidoyltransferase-cyclodeami...    214   7e-65   Populus euphratica
ref|XP_007153545.1|  hypothetical protein PHAVU_003G044600g             213   2e-64   Phaseolus vulgaris [French bean]
ref|XP_010268810.1|  PREDICTED: formimidoyltransferase-cyclodeami...    212   3e-64   
ref|XP_002517978.1|  formiminotransferase-cyclodeaminase, putative      207   2e-62   
ref|XP_007043503.1|  Transferases,folic acid binding                    200   2e-59   
ref|XP_002319918.2|  hypothetical protein POPTR_0013s14190g             198   6e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006447367.1|  hypothetical protein CICLE_v10015950mg             198   8e-59   Citrus clementina [clementine]
ref|XP_004139959.1|  PREDICTED: formimidoyltransferase-cyclodeami...    198   9e-59   Cucumis sativus [cucumbers]
ref|NP_001235132.1|  uncharacterized protein LOC100499724               192   3e-58   
gb|KHN09927.1|  Formimidoyltransferase-cyclodeaminase                   196   3e-58   Glycine soja [wild soybean]
ref|NP_001242582.1|  uncharacterized protein LOC100784302               196   6e-58   Glycine max [soybeans]
ref|XP_004487321.1|  PREDICTED: formimidoyltransferase-cyclodeami...    196   7e-58   Cicer arietinum [garbanzo]
gb|KDP24183.1|  hypothetical protein JCGZ_25840                         195   9e-58   Jatropha curcas
ref|XP_010657287.1|  PREDICTED: formimidoyltransferase-cyclodeami...    194   1e-57   
ref|XP_010051646.1|  PREDICTED: formimidoyltransferase-cyclodeami...    194   6e-57   Eucalyptus grandis [rose gum]
gb|KHN07746.1|  Formimidoyltransferase-cyclodeaminase                   193   6e-57   Glycine soja [wild soybean]
ref|XP_011045517.1|  PREDICTED: formimidoyltransferase-cyclodeami...    192   1e-56   Populus euphratica
gb|AFK38686.1|  unknown                                                 183   8e-54   Medicago truncatula
gb|KEH39070.1|  formiminotransferase-cyclodeaminase-like protein        184   3e-53   Medicago truncatula
ref|XP_004982519.1|  PREDICTED: formimidoyltransferase-cyclodeami...    181   2e-52   Setaria italica
ref|XP_004982518.1|  PREDICTED: formimidoyltransferase-cyclodeami...    182   2e-52   
gb|KEH39071.1|  formiminotransferase-cyclodeaminase-like protein        180   6e-52   Medicago truncatula
ref|XP_010905201.1|  PREDICTED: formimidoyltransferase-cyclodeami...    177   5e-51   Elaeis guineensis
gb|KEH39072.1|  formiminotransferase-cyclodeaminase-like protein        176   1e-50   Medicago truncatula
ref|XP_008775448.1|  PREDICTED: formimidoyltransferase-cyclodeami...    172   7e-49   Phoenix dactylifera
ref|XP_003562338.1|  PREDICTED: formimidoyltransferase-cyclodeami...    171   3e-48   Brachypodium distachyon [annual false brome]
gb|EMS48877.1|  Formimidoyltransferase-cyclodeaminase                   168   4e-46   Triticum urartu
gb|EAY90773.1|  hypothetical protein OsI_12376                          165   5e-46   Oryza sativa Indica Group [Indian rice]
ref|NP_001050558.1|  Os03g0582000                                       165   5e-46   
ref|XP_006650273.1|  PREDICTED: formimidoyltransferase-cyclodeami...    165   6e-46   Oryza brachyantha
gb|EMT16419.1|  Formimidoyltransferase-cyclodeaminase                   164   1e-45   
ref|XP_010035674.1|  PREDICTED: formimidoyltransferase-cyclodeami...    166   2e-45   Eucalyptus grandis [rose gum]
ref|XP_008809862.1|  PREDICTED: formimidoyltransferase-cyclodeami...    166   3e-45   
ref|XP_002466878.1|  hypothetical protein SORBIDRAFT_01g015770          162   3e-45   Sorghum bicolor [broomcorn]
ref|XP_010923937.1|  PREDICTED: formimidoyltransferase-cyclodeami...    162   4e-45   
gb|AAS07167.1|  expressed protein                                       160   2e-44   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010923939.1|  PREDICTED: formimidoyltransferase-cyclodeami...    159   6e-44   
ref|XP_010035673.1|  PREDICTED: formimidoyltransferase-cyclodeami...    159   8e-44   Eucalyptus grandis [rose gum]
ref|XP_010035676.1|  PREDICTED: formimidoyltransferase-cyclodeami...    155   2e-42   Eucalyptus grandis [rose gum]
dbj|BAJ93375.1|  predicted protein                                      155   3e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002517979.1|  formiminotransferase-cyclodeaminase, putative      154   4e-42   
gb|AFK49176.1|  unknown                                                 152   1e-41   Medicago truncatula
ref|XP_002272923.1|  PREDICTED: formimidoyltransferase-cyclodeami...    156   1e-41   Vitis vinifera
ref|XP_010657291.1|  PREDICTED: formimidoyltransferase-cyclodeami...    152   2e-41   Vitis vinifera
emb|CBI28922.3|  unnamed protein product                                152   4e-41   Vitis vinifera
gb|KEH39069.1|  formiminotransferase-cyclodeaminase-like protein        151   5e-41   Medicago truncatula
ref|XP_003543353.1|  PREDICTED: formimidoyltransferase-cyclodeami...    151   6e-41   Glycine max [soybeans]
ref|XP_009357127.1|  PREDICTED: formimidoyltransferase-cyclodeami...    154   7e-41   
ref|XP_008230271.1|  PREDICTED: uncharacterized protein LOC103329560    154   1e-40   
ref|XP_007215438.1|  hypothetical protein PRUPE_ppa006201mg             153   1e-40   
gb|AFK43329.1|  unknown                                                 150   2e-40   Lotus japonicus
ref|XP_004487322.1|  PREDICTED: formimidoyltransferase-cyclodeami...    150   2e-40   
ref|XP_006431512.1|  hypothetical protein CICLE_v10001997mg             150   2e-40   Citrus clementina [clementine]
ref|NP_001242633.1|  uncharacterized protein LOC100819129               149   4e-40   Glycine max [soybeans]
ref|XP_002319919.2|  hypothetical protein POPTR_0013s14200g             151   5e-40   
ref|XP_004306007.1|  PREDICTED: uncharacterized protein LOC101302194    152   6e-40   Fragaria vesca subsp. vesca
ref|XP_009630678.1|  PREDICTED: formimidoyltransferase-cyclodeami...    148   7e-40   
gb|KHG15410.1|  Formimidoyltransferase-cyclodeaminase                   147   1e-39   Gossypium arboreum [tree cotton]
ref|XP_008379559.1|  PREDICTED: formimidoyltransferase-cyclodeami...    147   1e-39   
ref|XP_008379561.1|  PREDICTED: uncharacterized protein LOC103442...    150   2e-39   Malus domestica [apple tree]
ref|XP_009405645.1|  PREDICTED: formimidoyltransferase-cyclodeami...    146   4e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010095821.1|  hypothetical protein L484_022177                   145   1e-38   
gb|KJB31733.1|  hypothetical protein B456_005G205100                    148   1e-38   Gossypium raimondii
ref|XP_010268811.1|  PREDICTED: formimidoyltransferase-cyclodeami...    145   1e-38   Nelumbo nucifera [Indian lotus]
emb|CDY13857.1|  BnaA09g43590D                                          147   2e-38   Brassica napus [oilseed rape]
ref|XP_011045516.1|  PREDICTED: formimidoyltransferase-cyclodeami...    147   3e-38   Populus euphratica
ref|XP_011085950.1|  PREDICTED: formimidoyltransferase-cyclodeami...    143   6e-38   Sesamum indicum [beniseed]
ref|XP_006447368.1|  hypothetical protein CICLE_v10017445mg             145   6e-38   
ref|XP_008448205.1|  PREDICTED: formimidoyltransferase-cyclodeami...    145   6e-38   Cucumis melo [Oriental melon]
ref|XP_008448202.1|  PREDICTED: formimidoyltransferase-cyclodeami...    143   7e-38   Cucumis melo [Oriental melon]
ref|XP_006841770.1|  hypothetical protein AMTR_s00003p00265230          143   9e-38   Amborella trichopoda
ref|XP_010268812.1|  PREDICTED: formimidoyltransferase-cyclodeami...    145   1e-37   Nelumbo nucifera [Indian lotus]
ref|XP_009763293.1|  PREDICTED: formimidoyltransferase-cyclodeami...    142   2e-37   Nicotiana sylvestris
ref|XP_006409020.1|  hypothetical protein EUTSA_v10001991mg             144   3e-37   Eutrema salsugineum [saltwater cress]
ref|XP_010540856.1|  PREDICTED: formimidoyltransferase-cyclodeami...    142   3e-37   
ref|XP_008680942.1|  PREDICTED: uncharacterized protein LOC100191...    142   4e-37   
ref|XP_010693555.1|  PREDICTED: formimidoyltransferase-cyclodeami...    140   6e-37   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009117467.1|  PREDICTED: formimidoyltransferase-cyclodeami...    142   1e-36   Brassica rapa
ref|XP_007149888.1|  hypothetical protein PHAVU_005G107300g             140   1e-36   Phaseolus vulgaris [French bean]
ref|XP_003608611.1|  Formimidoyltransferase-cyclodeaminase              139   2e-36   
gb|ACG48197.1|  glutamate formiminotransferase                          139   3e-36   Zea mays [maize]
ref|NP_001130076.1|  uncharacterized protein LOC100191169               139   3e-36   Zea mays [maize]
gb|ACL52709.1|  unknown                                                 139   3e-36   Zea mays [maize]
emb|CDP14715.1|  unnamed protein product                                138   5e-36   Coffea canephora [robusta coffee]
gb|KGN46693.1|  hypothetical protein Csa_6G124080                       138   6e-36   Cucumis sativus [cucumbers]
gb|EYU26109.1|  hypothetical protein MIMGU_mgv1a010739mg                138   6e-36   Erythranthe guttata [common monkey flower]
emb|CDX81982.1|  BnaC08g36190D                                          140   8e-36   
ref|XP_006357513.1|  PREDICTED: formimidoyltransferase-cyclodeami...    137   1e-35   Solanum tuberosum [potatoes]
ref|XP_004139960.1|  PREDICTED: formimidoyltransferase-cyclodeami...    139   1e-35   Cucumis sativus [cucumbers]
gb|EPS60854.1|  hypothetical protein M569_13945                         136   2e-35   Genlisea aurea
gb|KHN04280.1|  Formimidoyltransferase-cyclodeaminase                   137   4e-35   Glycine soja [wild soybean]
ref|XP_006471003.1|  PREDICTED: formimidoyltransferase-cyclodeami...    134   2e-34   
emb|CCH47206.1|  similar to formimidoyltransferase-cyclodeaminase...    135   3e-34   Lupinus angustifolius
ref|XP_004243328.1|  PREDICTED: formimidoyltransferase-cyclodeami...    134   3e-34   Solanum lycopersicum
ref|XP_006299212.1|  hypothetical protein CARUB_v10015359mg             135   3e-34   Capsella rubella
gb|KDO43789.1|  hypothetical protein CISIN_1g039996mg                   129   3e-33   Citrus sinensis [apfelsine]
gb|AFW86110.1|  formiminotransferase-like protein                       130   4e-33   
ref|NP_001148236.1|  formiminotransferase-like                          130   4e-33   
ref|XP_010474973.1|  PREDICTED: formimidoyltransferase-cyclodeami...    130   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010467763.1|  PREDICTED: formimidoyltransferase-cyclodeami...    130   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004964370.1|  PREDICTED: uncharacterized protein LOC101767576    129   2e-32   Setaria italica
ref|XP_010474972.1|  PREDICTED: formimidoyltransferase-cyclodeami...    129   2e-32   Camelina sativa [gold-of-pleasure]
ref|NP_973497.1|  folic acid binding / transferase                      130   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008679597.1|  PREDICTED: uncharacterized protein LOC103654540    128   3e-32   Zea mays [maize]
ref|XP_007043500.1|  Transferases,folic acid binding isoform 1          127   8e-32   
ref|XP_007043501.1|  Transferases,folic acid binding isoform 2          127   8e-32   
ref|XP_010488986.1|  PREDICTED: formimidoyltransferase-cyclodeami...    127   1e-31   Camelina sativa [gold-of-pleasure]
ref|XP_002886308.1|  folic acid binding protein                         129   1e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_010488987.1|  PREDICTED: formimidoyltransferase-cyclodeami...    128   2e-31   Camelina sativa [gold-of-pleasure]
ref|XP_008658585.1|  PREDICTED: formiminotransferase-like isoform X3    126   2e-31   Zea mays [maize]
ref|NP_565488.1|  folic acid binding / transferase                      125   4e-31   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189564.1|  folic acid binding / transferase                   125   1e-30   Arabidopsis thaliana [mouse-ear cress]
gb|AFW65332.1|  hypothetical protein ZEAMMB73_172834                    124   2e-30   
ref|XP_008658584.1|  PREDICTED: formiminotransferase-like isoform X2    120   3e-29   Zea mays [maize]
ref|XP_008658583.1|  PREDICTED: formiminotransferase-like isoform X1    120   4e-29   Zea mays [maize]
dbj|BAK06963.1|  predicted protein                                      120   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_001780549.1|  predicted protein                                  120   4e-29   
gb|ADE76078.1|  unknown                                                 118   3e-28   Picea sitchensis
ref|XP_003576127.1|  PREDICTED: formimidoyltransferase-cyclodeami...    116   9e-28   Brachypodium distachyon [annual false brome]
ref|XP_002437725.1|  hypothetical protein SORBIDRAFT_10g001400          108   1e-24   
ref|XP_002988838.1|  hypothetical protein SELMODRAFT_128752             107   2e-24   
ref|XP_002964559.1|  hypothetical protein SELMODRAFT_438865             107   2e-24   
dbj|BAA83349.1|  formiminotransferase-cyclodeaminase-like               103   4e-23   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006447366.1|  hypothetical protein CICLE_v10015950mg           94.4    4e-20   
ref|XP_002501051.1|  predicted protein                                90.9    2e-18   Micromonas commoda
ref|XP_001696535.1|  hypothetical protein CHLREDRAFT_112842           82.0    2e-15   Chlamydomonas reinhardtii
ref|WP_023175819.1|  glutamate formiminotransferase                   80.5    6e-15   Gloeobacter kilaueensis
dbj|BAL54907.1|  glutamate formiminotransferase                       80.1    8e-15   uncultured Acetothermia bacterium
ref|XP_009102103.1|  PREDICTED: formimidoyltransferase-cyclodeami...  79.7    8e-15   Brassica rapa
ref|WP_040330217.1|  glutamate formiminotransferase                   79.7    1e-14   Clostridium ihumii
ref|WP_021656861.1|  glutamate formimidoyltransferase                 79.3    2e-14   Clostridiales bacterium oral taxon 876
ref|XP_003057262.1|  predicted protein                                78.6    4e-14   Micromonas pusilla CCMP1545
ref|WP_022849287.1|  glutamate formiminotransferase                   77.4    7e-14   
emb|CDY31933.1|  BnaA07g00620D                                        77.0    1e-13   Brassica napus [oilseed rape]
ref|WP_010293009.1|  glutamate formiminotransferase                   77.0    1e-13   Clostridium senegalense
ref|WP_005365812.1|  glutamate formiminotransferase [                 76.6    1e-13   Peptostreptococcaceae bacterium AS15
ref|WP_035307133.1|  glutamate formiminotransferase                   76.6    1e-13   
ref|WP_005661063.1|  glutamate formiminotransferase                   76.3    2e-13   Dethiosulfovibrio peptidovorans
ref|WP_023935986.1|  MULTISPECIES: glutamate formiminotransferase     75.9    3e-13   Porphyromonas crevioricanis
ref|WP_039631226.1|  glutamate formiminotransferase                   75.5    3e-13   Clostridium argentinense
ref|XP_006656574.1|  PREDICTED: formimidoyltransferase-cyclodeami...  74.7    4e-13   
ref|WP_005660978.1|  glutamate formiminotransferase                   75.5    4e-13   Dethiosulfovibrio peptidovorans
ref|WP_023152921.1|  glutamate formimidoyltransferase                 75.1    4e-13   [Eubacterium] brachy
ref|WP_032118636.1|  glutamate formiminotransferase                   75.1    5e-13   Clostridium sp. CL-2
ref|XP_005648505.1|  Formiminotransferase                             75.1    5e-13   Coccomyxa subellipsoidea C-169
ref|WP_008604760.1|  glutamate formiminotransferase                   74.7    5e-13   
ref|XP_003081146.1|  unnamed protein product                          74.7    7e-13   
ref|XP_005340925.1|  PREDICTED: uncharacterized protein LOC101977523  76.6    7e-13   
ref|XP_008533257.1|  PREDICTED: formimidoyltransferase-cyclodeami...  74.7    9e-13   Equus przewalskii [Przewalski horse]
ref|XP_006082790.1|  PREDICTED: formimidoyltransferase-cyclodeami...  75.5    9e-13   
gb|EPQ12294.1|  Formimidoyltransferase-cyclodeaminase                 75.5    9e-13   Myotis brandtii
emb|CEF99013.1|  Formiminotransferas, N-and C-terminal subdomains     74.7    9e-13   Ostreococcus tauri
ref|WP_014224205.1|  glutamate formiminotransferase                   73.9    1e-12   Tannerella forsythia
ref|XP_007494643.1|  PREDICTED: formimidoyltransferase-cyclodeami...  73.6    1e-12   Monodelphis domestica
ref|WP_037993237.1|  glutamate formiminotransferase                   73.2    1e-12   
ref|XP_010800514.1|  PREDICTED: formiminotransferase N-terminal s...  72.8    1e-12   
ref|WP_044826137.1|  glutamate formiminotransferase                   73.6    2e-12   Clostridium aceticum
ref|WP_038049446.1|  formimidoyltransferase-cyclodeaminase            75.5    2e-12   Thermoanaerobaculum aquaticum
ref|WP_018027672.1|  MULTISPECIES: hypothetical protein               73.6    2e-12   Porphyromonas somerae
gb|EHR76717.1|  glutamate formiminotransferase / formiminotetrahy...  74.3    2e-12   uncultured marine group II euryarchaeote
ref|NP_001089428.1|  uncharacterized protein LOC734478                73.6    2e-12   Xenopus laevis [clawed frog]
ref|WP_036791238.1|  glutamate formiminotransferase                   73.2    2e-12   Porphyromonas canoris
ref|WP_036867614.1|  glutamate formiminotransferase                   73.2    2e-12   Porphyromonas canoris
ref|WP_008779292.1|  glutamate formiminotransferase                   73.2    2e-12   Bacteroides sp. 3_1_19
ref|WP_036848090.1|  glutamate formiminotransferase                   73.2    2e-12   Porphyromonas sp. COT-108 OH1349
ref|WP_006301066.1|  glutamate formiminotransferase                   73.2    2e-12   Aminomonas paucivorans
ref|XP_009236219.1|  PREDICTED: formimidoyltransferase-cyclodeami...  73.6    2e-12   
ref|WP_036864217.1|  glutamate formiminotransferase                   73.2    2e-12   Porphyromonas sp. COT-108 OH2963
ref|WP_040193308.1|  glutamate formiminotransferase                   72.8    3e-12   Clostridium sp. CL-6
ref|WP_018107384.1|  hypothetical protein                             73.2    3e-12   Porphyromonas bennonis
ref|XP_005676386.1|  PREDICTED: formimidoyltransferase-cyclodeami...  73.2    3e-12   
ref|WP_037984075.1|  glutamate formiminotransferase                   72.4    4e-12   
ref|XP_010800512.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.8    4e-12   
ref|WP_037979443.1|  glutamate formiminotransferase                   72.4    5e-12   
ref|WP_029450965.1|  glutamate formiminotransferase                   72.4    5e-12   Clostridium algidicarnis
ref|WP_044231927.1|  glutamate formiminotransferase                   72.0    5e-12   Porphyromonas sp. COT-290 OH3588
ref|WP_035288350.1|  glutamate formiminotransferase                   72.0    5e-12   Clostridium sp. KNHs214
ref|XP_007126173.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.4    6e-12   
ref|XP_010800513.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.0    7e-12   
ref|WP_043890086.1|  glutamate formiminotransferase                   71.6    7e-12   Porphyromonas gingivalis
ref|WP_027637874.1|  glutamate formiminotransferase                   71.6    8e-12   Clostridium cadaveris
ref|XP_001089951.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.0    9e-12   
gb|EHH55057.1|  hypothetical protein EGM_04188                        72.0    9e-12   Macaca fascicularis [crab eating macaque]
ref|XP_004005452.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.0    9e-12   
ref|XP_006029822.1|  PREDICTED: formiminotransferase N-terminal s...  70.5    9e-12   
ref|WP_039428991.1|  glutamate formiminotransferase                   71.2    1e-11   Porphyromonas
ref|WP_013048919.1|  glutamate formiminotransferase                   71.2    1e-11   Aminobacterium colombiense
ref|WP_008772698.1|  MULTISPECIES: glutamate formiminotransferase     71.2    1e-11   Bacteroidales
ref|WP_022193267.1|  MULTISPECIES: glutamate formiminotransferase     71.2    1e-11   Parabacteroides distasonis
ref|WP_032120724.1|  glutamate formiminotransferase                   71.2    1e-11   Clostridium amazonitimonense
ref|WP_005859153.1|  MULTISPECIES: glutamate formiminotransferase     71.2    1e-11   Parabacteroides
ref|WP_039417393.1|  glutamate formiminotransferase                   71.2    1e-11   Porphyromonas gingivalis
ref|XP_005574989.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.4    1e-11   
ref|WP_009528290.1|  MULTISPECIES: glutamate formiminotransferase     70.9    1e-11   Peptoanaerobacter stomatis
ref|WP_009525133.1|  MULTISPECIES: glutamate formiminotransferase     70.9    1e-11   Peptoanaerobacter stomatis
dbj|BAK25597.1|  formiminotransferase-cyclodeaminase                  70.9    1e-11   Porphyromonas gingivalis TDC60
ref|XP_002703730.2|  PREDICTED: formimidoyltransferase-cyclodeami...  72.4    1e-11   
ref|XP_003764132.1|  PREDICTED: uncharacterized protein LOC100922037  71.2    1e-11   
ref|WP_026292055.1|  glutamate formiminotransferase                   70.9    2e-11   Porphyromonas gulae
ref|WP_039442196.1|  glutamate formiminotransferase                   70.9    2e-11   Porphyromonas gulae
ref|WP_013278885.1|  glutamate formiminotransferase                   70.9    2e-11   Acetohalobium arabaticum
ref|WP_039418923.1|  glutamate formiminotransferase                   70.9    2e-11   Porphyromonas gulae
ref|XP_006078266.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.0    2e-11   
ref|XP_005873646.1|  PREDICTED: formimidoyltransferase-cyclodeami...  70.9    2e-11   Myotis brandtii
ref|WP_044188335.1|  glutamate formiminotransferase                   70.9    2e-11   Porphyromonas sp. COT-290 OH860
ref|XP_010859231.1|  PREDICTED: formimidoyltransferase-cyclodeami...  70.9    2e-11   Bison bison bison
ref|WP_044824145.1|  glutamate formiminotransferase                   70.5    2e-11   Clostridium aceticum
ref|WP_012449199.1|  glutamate formiminotransferase                   70.5    2e-11   Natranaerobius thermophilus
ref|WP_005874204.1|  glutamate formiminotransferase                   70.5    2e-11   Porphyromonas gingivalis
ref|WP_024821150.1|  glutamate formiminotransferase                   70.5    2e-11   Aminobacterium mobile
ref|WP_017414678.1|  glutamate formiminotransferase                   70.5    2e-11   Clostridium tunisiense
ref|WP_004584814.1|  glutamate formiminotransferase                   70.5    2e-11   Bacteria
ref|WP_043894149.1|  glutamate formiminotransferase                   70.5    2e-11   Porphyromonas gingivalis
gb|ELK24145.1|  Formimidoyltransferase-cyclodeaminase                 71.2    2e-11   Myotis davidii
ref|WP_036611367.1|  glutamate formiminotransferase                   70.5    2e-11   Parabacteroides
ref|WP_044545280.1|  glutamate formiminotransferase                   70.1    2e-11   Parabacteroides distasonis
ref|WP_024821683.1|  glutamate formiminotransferase                   70.5    3e-11   Aminobacterium mobile
ref|XP_006111372.1|  PREDICTED: formimidoyltransferase-cyclodeami...  72.0    3e-11   
ref|WP_012869662.1|  glutamate formiminotransferase                   70.1    3e-11   Thermanaerovibrio acidaminovorans
ref|WP_039426191.1|  glutamate formiminotransferase                   70.1    3e-11   Porphyromonas gulae
ref|WP_006798984.1|  glutamate formiminotransferase                   70.1    3e-11   Dysgonomonas gadei
ref|XP_005070787.1|  PREDICTED: formimidoyltransferase-cyclodeami...  71.6    3e-11   Mesocricetus auratus [Syrian golden hamster]
ref|WP_044349867.1|  glutamate formiminotransferase                   70.1    3e-11   Dethiosulfatarculus sandiegensis
ref|XP_007965245.1|  PREDICTED: uncharacterized protein LOC103218311  71.2    3e-11   Chlorocebus sabaeus
ref|XP_006771874.1|  PREDICTED: formimidoyltransferase-cyclodeami...  70.5    4e-11   
ref|WP_035134405.1|  glutamate formiminotransferase                   69.7    4e-11   Clostridium sulfidigenes
gb|ERJ65512.1|  glutamate formimidoyltransferase                      69.7    4e-11   Porphyromonas gingivalis F0569
gb|ERJ64221.1|  glutamate formimidoyltransferase                      69.7    4e-11   Porphyromonas gingivalis F0570
ref|WP_004573051.1|  glutamate formiminotransferase                   69.3    5e-11   Acetonema longum
ref|WP_011343625.1|  MULTISPECIES: glutamate formiminotransferase     69.3    5e-11   Carboxydothermus
ref|WP_009201259.1|  glutamate formiminotransferase                   69.3    6e-11   
ref|WP_013238800.1|  MULTISPECIES: glutamate formiminotransferase     68.9    6e-11   Clostridium
ref|WP_012065545.1|  glutamate formiminotransferase                   68.9    7e-11   Alkaliphilus metalliredigens
ref|WP_013559544.1|  putative formiminotransferase-cyclodeaminase     70.5    7e-11   Anaerolinea thermophila
ref|WP_018358650.1|  hypothetical protein                             69.3    7e-11   Porphyromonas levii
ref|WP_025835248.1|  glutamate formiminotransferase                   68.9    7e-11   Bacteroides stercorirosoris
ref|WP_007785601.1|  glutamate formiminotransferase                   68.9    8e-11   Desulfosporosinus youngiae
ref|WP_004332682.1|  glutamate formiminotransferase                   68.9    8e-11   Porphyromonas endodontalis
pdb|1QD1|A  Chain A, The Crystal Structure Of The Formiminotransf...  69.3    8e-11   Sus scrofa [pigs]
ref|WP_042683296.1|  glutamate formiminotransferase                   68.9    8e-11   Anaerosalibacter massiliensis
ref|WP_021284526.1|  glutamate formiminotransferase                   68.6    1e-10   Clostridium sp. BL8
ref|WP_034102697.1|  glutamate formiminotransferase                   68.6    1e-10   
ref|WP_013048116.1|  glutamate formiminotransferase                   68.6    1e-10   Aminobacterium colombiense
ref|WP_014806595.1|  glutamate formiminotransferase                   68.6    1e-10   Acetomicrobium
ref|XP_001419526.1|  predicted protein                                68.9    1e-10   Ostreococcus lucimarinus CCE9901
ref|XP_005672111.1|  PREDICTED: formimidoyltransferase-cyclodeami...  68.9    1e-10   
emb|CEA15894.1|  Formimidoyltransferase-cyclodeaminase                68.6    1e-10   Fermentimonas caenicola
ref|WP_014453858.1|  glutamate formiminotransferase                   68.2    1e-10   Caldisericum exile
ref|WP_006841514.1|  glutamate formiminotransferase                   68.2    1e-10   Dysgonomonas mossii
ref|XP_004081729.1|  PREDICTED: formimidoyltransferase-cyclodeami...  68.6    1e-10   Oryzias latipes [Japanese rice fish]
ref|WP_032078500.1|  glutamate formiminotransferase                   68.2    1e-10   Clostridium drakei
ref|XP_003962236.1|  PREDICTED: formimidoyltransferase-cyclodeami...  68.6    1e-10   
ref|WP_022210376.1|  glutamate formiminotransferase                   68.2    1e-10   
ref|WP_025640672.1|  glutamate formiminotransferase                   68.2    1e-10   [Clostridium] ultunense
ref|WP_007212100.1|  MULTISPECIES: glutamate formiminotransferase     68.2    1e-10   Bacteroides
ref|XP_005989575.1|  PREDICTED: uncharacterized protein LOC102348032  68.6    1e-10   Latimeria chalumnae
ref|WP_044534505.1|  glutamate formiminotransferase                   68.2    1e-10   Bacteroides intestinalis
ref|XP_005548545.1|  PREDICTED: formimidoyltransferase-cyclodeami...  69.3    1e-10   
ref|XP_007968901.1|  PREDICTED: formimidoyltransferase-cyclodeami...  69.3    2e-10   Chlorocebus sabaeus
gb|EPY77229.1|  formimidoyltransferase-cyclodeaminase                 68.6    2e-10   Camelus ferus
ref|XP_002919103.1|  PREDICTED: LOW QUALITY PROTEIN: formimidoylt...  69.3    2e-10   Ailuropoda melanoleuca
ref|WP_044272199.1|  glutamate formiminotransferase                   67.8    2e-10   Bacteroides timonensis
ref|WP_005867812.1|  MULTISPECIES: glutamate formiminotransferase     67.8    2e-10   
ref|XP_005548544.1|  PREDICTED: formimidoyltransferase-cyclodeami...  69.3    2e-10   
ref|WP_007662187.1|  glutamate formiminotransferase                   67.8    2e-10   
ref|XP_010990247.1|  PREDICTED: formimidoyltransferase-cyclodeami...  68.2    2e-10   
ref|XP_007968893.1|  PREDICTED: formimidoyltransferase-cyclodeami...  69.3    2e-10   
ref|WP_014162531.1|  glutamate formiminotransferase                   67.8    2e-10   
ref|XP_004328724.1|  PREDICTED: formiminotransferase N-terminal s...  65.5    2e-10   
ref|NP_001106633.1|  uncharacterized protein LOC100127872             68.2    2e-10   
emb|CEK34594.1|  glutamate formiminotransferase,Glutamate formimi...  67.8    2e-10   
ref|XP_008972387.1|  PREDICTED: formiminotransferase N-terminal s...  66.6    2e-10   
ref|XP_005657245.1|  PREDICTED: formimidoyltransferase-cyclodeami...  68.9    2e-10   
ref|WP_019228575.1|  glutamate formiminotransferase                   67.4    2e-10   
ref|NP_999440.1|  formimidoyltransferase-cyclodeaminase               68.9    2e-10   
ref|XP_010970200.1|  PREDICTED: formimidoyltransferase-cyclodeami...  67.8    2e-10   
ref|WP_007955289.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_015869050.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_035150655.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_006583537.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_035172600.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_021168543.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_040212291.1|  glutamate formiminotransferase                   67.4    3e-10   
ref|WP_007786784.1|  glutamate formiminotransferase                   67.0    3e-10   
ref|WP_008710539.1|  glutamate formiminotransferase                   67.0    3e-10   
gb|EKE13145.1|  hypothetical protein ACD_13C00083G0001                67.0    3e-10   
ref|WP_022273265.1|  glutamate formimidoyltransferase                 67.0    3e-10   
ref|WP_031502571.1|  glutamate formiminotransferase                   67.0    4e-10   
ref|WP_026327536.1|  glutamate formiminotransferase                   67.0    4e-10   
ref|WP_022269764.1|  glutamate formiminotransferase                   66.6    5e-10   
ref|WP_007065124.1|  glutamate formiminotransferase                   66.6    5e-10   
ref|WP_026476198.1|  glutamate formiminotransferase                   66.6    5e-10   
emb|CEP78927.1|  glutamate formimidoyltransferase                     66.6    6e-10   
ref|XP_005360288.1|  PREDICTED: formimidoyltransferase-cyclodeami...  67.8    6e-10   
ref|WP_008908508.1|  glutamate formiminotransferase                   66.6    6e-10   
ref|XP_005310398.1|  PREDICTED: uncharacterized protein LOC101953...  66.6    6e-10   
ref|XP_006636508.1|  PREDICTED: uncharacterized protein LOC102694103  66.6    6e-10   
ref|WP_012543909.1|  glutamate formiminotransferase                   66.6    6e-10   
ref|WP_035163671.1|  glutamate formiminotransferase                   66.2    6e-10   
ref|WP_042354888.1|  hypothetical protein                             66.6    6e-10   
ref|WP_025842728.1|  glutamate formiminotransferase                   66.2    6e-10   
ref|WP_021129117.1|  glutamate formiminotransferase [                 66.2    7e-10   
ref|WP_027366104.1|  glutamate formiminotransferase                   66.2    7e-10   
ref|WP_007365334.1|  glutamate formiminotransferase                   66.2    7e-10   
ref|XP_003226127.2|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    7e-10   
ref|WP_006299702.1|  glutamate formiminotransferase                   66.2    7e-10   
ref|XP_005310395.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    7e-10   
ref|WP_038289172.1|  hypothetical protein                             64.7    7e-10   
ref|WP_031450143.1|  glutamate formiminotransferase                   66.2    7e-10   
ref|XP_009442346.1|  PREDICTED: uncharacterized protein LOC459857     67.0    7e-10   
ref|WP_041424633.1|  hypothetical protein                             67.0    7e-10   
ref|XP_010368427.1|  PREDICTED: formimidoyltransferase-cyclodeami...  67.0    8e-10   
ref|WP_022405183.1|  glutamate formiminotransferase                   66.2    8e-10   
ref|WP_018360608.1|  glutamate formiminotransferase                   66.2    8e-10   
ref|WP_036850383.1|  glutamate formiminotransferase                   66.2    8e-10   
ref|WP_035240035.1|  formiminotransferase                             65.9    8e-10   
ref|XP_005310394.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    8e-10   
gb|ACZ41611.1|  glutamate formiminotransferase                        67.0    9e-10   
ref|WP_014187212.1|  glutamate formiminotransferase                   65.9    9e-10   
ref|WP_041534376.1|  hypothetical protein                             64.7    9e-10   
ref|WP_008693887.1|  glutamate formiminotransferase                   65.9    1e-09   
gb|KFM62928.1|  Formimidoyltransferase-cyclodeaminase                 67.0    1e-09   
ref|WP_008646313.1|  glutamate formiminotransferase                   65.9    1e-09   
ref|WP_029166459.1|  glutamate formiminotransferase                   65.9    1e-09   
ref|WP_022162559.1|  glutamate formimidoyltransferase                 65.5    1e-09   
ref|XP_006163190.1|  PREDICTED: formimidoyltransferase-cyclodeami...  67.0    1e-09   
ref|XP_003463208.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    1e-09   
ref|WP_022117637.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_004310875.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_027626829.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_009132616.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_004323668.1|  MULTISPECIES: glutamate formiminotransferase     65.5    1e-09   
ref|WP_027718610.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_037974639.1|  glutamate formiminotransferase                   65.5    1e-09   
ref|WP_013546696.1|  glutamate formiminotransferase                   65.5    1e-09   
gb|EAX09313.1|  formiminotransferase cyclodeaminase, isoform CRA_e    65.1    1e-09   
ref|XP_007172703.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    1e-09   
ref|XP_004416265.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    1e-09   
ref|XP_004824639.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    1e-09   
ref|XP_006745901.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.6    1e-09   
gb|EJF38923.1|  glutamate formimidoyltransferase                      65.1    2e-09   
gb|KGA05144.1|  hypothetical protein GM46_12030                       64.7    2e-09   
ref|WP_035108940.1|  glutamate formiminotransferase                   65.1    2e-09   
ref|WP_011100444.1|  glutamate formiminotransferase                   65.1    2e-09   
ref|XP_004780348.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    2e-09   
ref|XP_007172702.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    2e-09   
ref|XP_009565220.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    2e-09   
ref|WP_003125723.1|  MULTISPECIES: glutamate formiminotransferase     65.1    2e-09   
emb|CBN76612.1|  conserved unknown protein                            65.1    2e-09   
ref|XP_004416264.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    2e-09   
ref|WP_009164701.1|  glutamate formiminotransferase                   65.1    2e-09   
ref|NP_446019.1|  formimidoyltransferase-cyclodeaminase               66.2    2e-09   
ref|WP_008521125.1|  MULTISPECIES: glutamate formiminotransferase     65.1    2e-09   
ref|XP_006992617.1|  PREDICTED: formimidoyltransferase-cyclodeami...  66.2    2e-09   
gb|ABX32071.1|  Glutamate formimidoyltransferase                      65.1    2e-09   
ref|WP_022104768.1|  glutamate formimidoyltransferase                 64.7    2e-09   
ref|WP_005656448.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|NP_543121.1|  formimidoyltransferase-cyclodeaminase               65.9    2e-09   
ref|WP_025838514.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_008023032.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_021842537.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_026368656.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_014904749.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_005585062.1|  Glutamate formiminotransferase @ Glutamate f...  64.7    2e-09   
ref|XP_003939467.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.9    2e-09   
ref|WP_018667859.1|  glutamate formiminotransferase                   64.7    2e-09   
ref|WP_006315114.1|  Glutamate formiminotransferase/ Glutamate fo...  64.7    2e-09   
ref|WP_034849407.1|  glutamate formiminotransferase                   64.7    3e-09   
ref|WP_035933231.1|  glutamate formiminotransferase                   64.7    3e-09   
ref|XP_011284017.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.9    3e-09   
ref|XP_007172700.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.9    3e-09   
ref|WP_003503917.1|  MULTISPECIES: glutamate formiminotransferase     64.3    3e-09   
ref|XP_007172701.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.5    3e-09   
ref|WP_022217900.1|  glutamate formimidoyltransferase                 64.3    3e-09   
ref|WP_013985855.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|WP_005903266.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|WP_038674223.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|WP_040658943.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|WP_035450371.1|  glutamate formiminotransferase                   64.3    3e-09   
gb|EGV98033.1|  Formimidoyltransferase-cyclodeaminase                 65.5    3e-09   
ref|WP_004291207.1|  MULTISPECIES: glutamate formiminotransferase     64.3    3e-09   
ref|WP_009122277.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|XP_010406281.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.5    3e-09   
ref|WP_034599769.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|XP_007639510.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.5    3e-09   
ref|WP_005833514.1|  glutamate formiminotransferase                   64.3    3e-09   
gb|ERE88053.1|  formimidoyltransferase-cyclodeaminase-like protein    65.5    3e-09   
ref|WP_003101238.1|  glutamate formiminotransferase                   64.3    3e-09   
ref|WP_005825654.1|  MULTISPECIES: glutamate formiminotransferase     64.3    3e-09   
ref|XP_007618119.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.5    4e-09   
gb|EAX09312.1|  formiminotransferase cyclodeaminase, isoform CRA_d    65.5    4e-09   
ref|XP_009995320.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|XP_010145122.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|WP_015531718.1|  glutamate formiminotransferase                   64.3    4e-09   
ref|XP_005515327.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|WP_009040604.1|  glutamate formiminotransferase                   63.9    4e-09   
ref|WP_004313464.1|  MULTISPECIES: glutamate formiminotransferase     63.9    4e-09   
ref|XP_004483679.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|XP_004594136.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|WP_011522932.1|  formiminotransferase                             65.1    4e-09   
ref|WP_021328420.1|  hypothetical protein                             65.1    4e-09   
ref|XP_009700058.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|XP_007452543.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|WP_008399391.1|  MULTISPECIES: glutamate formiminotransferase     63.9    4e-09   
gb|KFQ17945.1|  Formimidoyltransferase-cyclodeaminase                 64.7    4e-09   
gb|EAX09311.1|  formiminotransferase cyclodeaminase, isoform CRA_c    65.1    4e-09   
ref|XP_008935466.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    4e-09   
ref|WP_037978129.1|  glutamate formiminotransferase                   64.3    4e-09   
ref|WP_034142050.1|  glutamate formiminotransferase                   63.9    4e-09   
ref|XP_849545.3|  PREDICTED: formimidoyltransferase-cyclodeaminas...  65.1    4e-09   
ref|XP_005639076.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    4e-09   
ref|XP_007541669.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    4e-09   
gb|EXY32480.1|  glutamate formiminotransferase                        63.9    4e-09   
ref|WP_044665573.1|  glutamate formiminotransferase                   63.9    4e-09   
ref|WP_035317174.1|  glutamate formiminotransferase                   63.9    5e-09   
ref|XP_005241387.1|  PREDICTED: formimidoyltransferase-cyclodeami...  65.1    5e-09   
ref|WP_015574747.1|  glutamate formiminotransferase [                 63.9    5e-09   
ref|XP_010115551.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    5e-09   
ref|XP_531505.3|  PREDICTED: formimidoyltransferase-cyclodeaminase    64.7    5e-09   
gb|EOS11476.1|  glutamate formiminotransferase                        63.5    5e-09   
ref|XP_003823853.1|  PREDICTED: LOW QUALITY PROTEIN: formimidoylt...  64.7    5e-09   
ref|XP_004330410.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    5e-09   
ref|XP_006104868.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    5e-09   
ref|WP_039879630.1|  hypothetical protein                             63.2    5e-09   
ref|WP_029597420.1|  glutamate formiminotransferase                   63.5    5e-09   
ref|WP_008661839.1|  glutamate formiminotransferase                   63.5    6e-09   
dbj|GAK60142.1|  putative formiminotransferase-cyclodeaminase         64.7    6e-09   
ref|WP_006744585.1|  glutamate formiminotransferase                   63.5    6e-09   
ref|WP_009125164.1|  glutamate formiminotransferase                   63.5    6e-09   
ref|XP_010964786.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    6e-09   
ref|XP_008529619.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    6e-09   
ref|XP_010980241.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    6e-09   
ref|XP_010634692.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    6e-09   
ref|WP_006556510.1|  glutamate formiminotransferase                   63.5    6e-09   
gb|AAG01853.1|AF289022_1  formiminotransferase cyclodeaminase form C  64.7    6e-09   
ref|WP_029214860.1|  glutamate formiminotransferase                   63.5    6e-09   
gb|EAX09308.1|  formiminotransferase cyclodeaminase, isoform CRA_a    64.7    6e-09   
ref|WP_028308531.1|  glutamate formiminotransferase                   63.5    6e-09   
ref|XP_006205002.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    6e-09   
ref|WP_016660781.1|  glutamate formiminotransferase                   63.5    6e-09   
ref|WP_008711678.1|  MULTISPECIES: glutamate formiminotransferase     63.5    7e-09   
ref|XP_005606260.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
ref|XP_008053732.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
ref|XP_010634693.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.7    7e-09   
ref|XP_004602370.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
ref|XP_006104869.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
ref|WP_021789287.1|  hypothetical protein                             63.5    7e-09   
ref|XP_010634695.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
gb|EGQ80720.1|  glutamate formimidoyltransferase                      63.2    7e-09   
ref|WP_011686906.1|  formiminotransferase                             64.3    7e-09   
ref|XP_009898749.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    7e-09   
gb|AAG01854.1|AF289023_1  formiminotransferase cyclodeaminase form D  64.3    7e-09   
ref|XP_001488216.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
ref|XP_006807666.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.5    8e-09   
ref|XP_003895407.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
ref|XP_008838712.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
gb|KFO96890.1|  Formimidoyltransferase-cyclodeaminase                 64.3    8e-09   
ref|XP_008503111.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
ref|XP_002595560.1|  hypothetical protein BRAFLDRAFT_200763           63.5    8e-09   
ref|XP_005534160.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
ref|XP_009459357.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    8e-09   
ref|WP_012057386.1|  glutamate formiminotransferase                   63.2    8e-09   
ref|WP_010916347.1|  glutamate formiminotransferase                   63.2    9e-09   
gb|KFO28071.1|  Formimidoyltransferase-cyclodeaminase                 64.3    9e-09   
ref|XP_005878983.1|  PREDICTED: formimidoyltransferase-cyclodeami...  64.3    9e-09   
ref|WP_007487329.1|  glutamate formiminotransferase                   63.2    9e-09   
ref|WP_022303293.1|  glutamate formiminotransferase                   63.2    9e-09   
ref|WP_022400667.1|  glutamate formiminotransferase                   63.2    9e-09   
ref|WP_035901309.1|  glutamate formiminotransferase                   63.2    9e-09   
ref|XP_010311563.1|  PREDICTED: LOW QUALITY PROTEIN: formimidoylt...  63.9    9e-09   
ref|WP_024821318.1|  glutamate formiminotransferase                   63.2    1e-08   
ref|XP_009319106.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.9    1e-08   
ref|XP_008143864.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.9    1e-08   
ref|WP_040658960.1|  glutamate formiminotransferase                   63.2    1e-08   
ref|XP_006724024.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.9    1e-08   
ref|XP_005433978.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.9    1e-08   
gb|KFP33472.1|  Formimidoyltransferase-cyclodeaminase                 63.9    1e-08   
ref|WP_041077150.1|  glutamate formiminotransferase                   62.8    1e-08   
ref|XP_009632970.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.9    1e-08   
ref|XP_009891619.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.5    1e-08   
ref|NP_006648.1|  formimidoyltransferase-cyclodeaminase               63.9    1e-08   
ref|XP_008985077.1|  PREDICTED: LOW QUALITY PROTEIN: formimidoylt...  63.5    1e-08   
ref|XP_010204484.1|  PREDICTED: formimidoyltransferase-cyclodeami...  63.5    1e-08   



>ref|XP_009595237.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Nicotiana 
tomentosiformis]
Length=316

 Score =   252 bits (643),  Expect = 9e-80, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 139/157 (89%), Gaps = 1/157 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            M +N+ +  +KK+VMQS+LLCCKL+ISESRN+EALE I+RAAK DPETVI+N F+DR+YN
Sbjct  1    MESNSISKDKKKNVMQSMLLCCKLYISESRNKEALEPIERAAKLDPETVIINKFQDRDYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R+NYTLVSYVIHD +TG PIY PL QTVV++ AAAYD INLE HSGAHPRLGVVDDI +H
Sbjct  61   RVNYTLVSYVIHD-STGCPIYSPLHQTVVSMVAAAYDAINLEQHSGAHPRLGVVDDILIH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            PLARASLDEAAWLAK++AA+ GNRFQVPVYLY  AHP
Sbjct  120  PLARASLDEAAWLAKKVAADIGNRFQVPVYLYAAAHP  156



>ref|XP_004243327.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Solanum lycopersicum]
Length=316

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 119/157 (76%), Positives = 137/157 (87%), Gaps = 1/157 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            M +N+    +KKS+ QS+LLCCKL+ISESRNREALE I+RAAK DPETVI+N F+DR+YN
Sbjct  1    MDSNSECKDKKKSITQSMLLCCKLYISESRNREALEPIERAAKLDPETVIINKFQDRDYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R+NYTLVSYVIHD +TG PIY PL QTVVA+ AAAYD INLE HSGAHPRLGVVDDI +H
Sbjct  61   RVNYTLVSYVIHD-STGCPIYSPLHQTVVAMVAAAYDAINLEQHSGAHPRLGVVDDILIH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            PLARASLDEA+WLAK++AA+ GNRFQVPVYLY  AHP
Sbjct  120  PLARASLDEASWLAKKIAADIGNRFQVPVYLYAAAHP  156



>ref|XP_006357514.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Solanum 
tuberosum]
Length=316

 Score =   251 bits (641),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 121/156 (78%), Positives = 138/156 (88%), Gaps = 4/156 (3%)
 Frame = +1

Query  106  NPNSK---EKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNR  276
            +PNS+   +KKSV QS+LLCCKL+ISESRNREALE I+RAAK DPETVI+N F+DR+YNR
Sbjct  2    DPNSECMDKKKSVTQSMLLCCKLYISESRNREALEPIERAAKLDPETVIINKFQDRDYNR  61

Query  277  INYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHP  456
            +NYTLVSYVIHD +TG PIY PL QTVVA+ AAAYD INLE HSGAHPRLGVVDDI +HP
Sbjct  62   VNYTLVSYVIHD-STGCPIYSPLHQTVVAMVAAAYDAINLEQHSGAHPRLGVVDDILIHP  120

Query  457  LARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            LARASLDEA+WLAK++AA+ GNRFQVPVYLY  AHP
Sbjct  121  LARASLDEASWLAKKVAADIGNRFQVPVYLYAAAHP  156



>ref|XP_009758357.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Nicotiana 
sylvestris]
Length=316

 Score =   249 bits (635),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 118/157 (75%), Positives = 138/157 (88%), Gaps = 1/157 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            M +N+ +  +KK+V+ S+LLCCKL+ISESRN+EALE I+RAAK DPETVI+N F+DR+YN
Sbjct  1    MDSNSVSKDKKKNVIHSMLLCCKLYISESRNKEALEPIERAAKLDPETVIINKFQDRDYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R+NYTLVSYVIHD +TG PIY PL QTVVA+ AAAYD INLE HSGAHPRLGVVDDI +H
Sbjct  61   RVNYTLVSYVIHD-STGCPIYSPLHQTVVAMVAAAYDAINLEQHSGAHPRLGVVDDILIH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            PLARASLDEAAWLAK++AA+ GNRFQVPVYLY  AHP
Sbjct  120  PLARASLDEAAWLAKKVAADIGNRFQVPVYLYAAAHP  156



>ref|XP_008230229.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Prunus 
mume]
Length=344

 Score =   235 bits (599),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 120/183 (66%), Positives = 145/183 (79%), Gaps = 4/183 (2%)
 Frame = +1

Query  25   PLLNQEVKEKKELRIEIKPARGKMAANNP--NSKEKKSVMQSVLLCCKLHISESRNREAL  198
            P L+  VK+   L  +IK  R +M  ++P    K+KK++ QS+LLCCKL+ISESRN  AL
Sbjct  4    PCLSGLVKKTLTLAAKIKHWREEMD-HSPACKDKKKKTIDQSMLLCCKLYISESRNHAAL  62

Query  199  ESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAA  378
            ++I+RAA+ DPE+VIVN FEDR YNR+ YT+VSYV+HD +TGS IY PLQQTV+A+A AA
Sbjct  63   DAIERAARLDPESVIVNKFEDRAYNRVRYTIVSYVMHD-STGSAIYSPLQQTVMAMAEAA  121

Query  379  YDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDA  558
            +  INLE HSGAHPRLGVVDDI  HPLARASLDEAAWLAK +A + GNRFQVPVYLY  A
Sbjct  122  FGAINLEQHSGAHPRLGVVDDIVFHPLARASLDEAAWLAKAVAVDIGNRFQVPVYLYAAA  181

Query  559  HPT  567
            HPT
Sbjct  182  HPT  184



>ref|XP_008379557.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Malus 
domestica]
Length=309

 Score =   233 bits (593),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK++ QS+LLCCKL+ISESRN  AL++I+RAA+ DPE+VIVN FEDREYNR+ YT+VS
Sbjct  10   KKKKTIDQSMLLCCKLYISESRNLAALDTIERAARLDPESVIVNKFEDREYNRVRYTIVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD +TGS IY PLQQTV+A+  AA+  INLE HSGAHPRLGVVDDI  HPLARASLD
Sbjct  70   YVMHD-STGSAIYSPLQQTVMAMTEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +A + GNRFQVPVYLY  AHPT
Sbjct  129  EAAWLAKAVAVDIGNRFQVPVYLYAAAHPT  158



>emb|CDP14716.1| unnamed protein product [Coffea canephora]
Length=318

 Score =   232 bits (592),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 110/146 (75%), Positives = 128/146 (88%), Gaps = 1/146 (1%)
 Frame = +1

Query  130  SVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            +VM S+LLCCKL+ISE+RN EAL+SI+RAAK DPETVIVN FEDR+YNR+ YTLVSYV+H
Sbjct  15   TVMHSMLLCCKLYISEARNAEALDSIERAAKRDPETVIVNKFEDRDYNRVCYTLVSYVVH  74

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
            D +TG PIY PLQQ+VVA+A AAY+ INLE H G HPRLGV+DDI  HPLARASLDEAAW
Sbjct  75   D-STGCPIYSPLQQSVVAMAEAAYEAINLEQHLGTHPRLGVMDDILCHPLARASLDEAAW  133

Query  490  LAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LA+++AAE GNRFQVPVYLY  A+PT
Sbjct  134  LAQKVAAEIGNRFQVPVYLYGAANPT  159



>ref|XP_007217258.1| hypothetical protein PRUPE_ppa008822mg [Prunus persica]
 gb|EMJ18457.1| hypothetical protein PRUPE_ppa008822mg [Prunus persica]
Length=318

 Score =   231 bits (589),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 129/150 (86%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK++ QS+LLCCKL+ISESRN  AL++I+RAA+ DPE+VIVN FEDR YNR+ YT+VS
Sbjct  10   KKKKTIDQSMLLCCKLYISESRNHAALDAIERAARLDPESVIVNKFEDRAYNRVRYTIVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD +TGS IY PLQQTV+A+A AA+  INLE HSGAHPRLGVVDDI  HPLARASLD
Sbjct  70   YVMHD-STGSAIYSPLQQTVMAMAEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +A + GNRFQVPVYLY  AHPT
Sbjct  129  EAAWLAKAVAVDIGNRFQVPVYLYAAAHPT  158



>ref|XP_010268809.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Nelumbo nucifera]
Length=321

 Score =   230 bits (587),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/150 (73%), Positives = 128/150 (85%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK+V QS+LLCCKL+ISE+RN  ALESI+RAA+ +PETVIVN F+D  YNR+ +TLVS
Sbjct  10   KKKKTVQQSMLLCCKLYISETRNNSALESIERAARLNPETVIVNKFQDGVYNRVRFTLVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV HD +TGSPIY PLQQTV+A+  AAY+ INLELHSGAHPRLGVVD I  HPLARASLD
Sbjct  70   YVAHD-STGSPIYSPLQQTVLAMVGAAYEAINLELHSGAHPRLGVVDHICFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +AA+ GNR QVPV+LY  AHPT
Sbjct  129  EAAWLAKLVAADIGNRLQVPVFLYEAAHPT  158



>ref|XP_009357093.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Pyrus 
x bretschneideri]
Length=309

 Score =   228 bits (582),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 109/150 (73%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK++ QS+LLCCKL ISESRN  AL +I+RAA+ DPE+VIVN FEDR YNR  YT+VS
Sbjct  10   KKKKTIDQSMLLCCKLFISESRNLAALNAIERAARLDPESVIVNKFEDRAYNRARYTIVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD +TGS IY PLQQTV+A+  AA+  INLE HSGAHPRLGVVDDI  HPLARASLD
Sbjct  70   YVVHD-STGSAIYSPLQQTVMAMTEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +A + GNRFQVPVYLY+ AHPT
Sbjct  129  EAAWLAKAVAVDIGNRFQVPVYLYDAAHPT  158



>ref|XP_011085363.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Sesamum indicum]
Length=318

 Score =   226 bits (576),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 127/152 (84%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            ++ +KK+  QS+LLCCK++ISESRN+EAL+SI+R A+ +PETVIVN F D +YNR+ YTL
Sbjct  8    SNDKKKTTKQSMLLCCKVYISESRNKEALDSIERGARSEPETVIVNKFMDNDYNRVAYTL  67

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV HD + G PIY PLQQ+VVA+A AAY+ INLE H GAHPRLGV+DDI  HPL RAS
Sbjct  68   VSYVAHD-SIGCPIYTPLQQSVVAMARAAYEAINLESHCGAHPRLGVIDDIVCHPLGRAS  126

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +A++ GNRFQVPVYLY  AHPT
Sbjct  127  LDEAAWLAKTIASDLGNRFQVPVYLYAAAHPT  158



>gb|EYU26110.1| hypothetical protein MIMGU_mgv1a009671mg [Erythranthe guttata]
Length=335

 Score =   226 bits (577),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/170 (66%), Positives = 131/170 (77%), Gaps = 4/170 (2%)
 Frame = +1

Query  67   IEIKPARGKMAANNP---NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPET  237
            I  K  + KM   +P   N K+K    QS+LLCCK++ISESRNRE L+SI+RAA+HD ET
Sbjct  4    ISCKRKQRKMDYFDPSYNNDKKKAMAKQSMLLCCKVYISESRNRETLDSIERAARHDQET  63

Query  238  VIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAH  417
            VIVN F+D EYNR+ YTLVSYV HD + G PIY PL Q+VVA+A  AY+ INLELH GAH
Sbjct  64   VIVNKFKDHEYNRVGYTLVSYVAHD-SIGCPIYTPLHQSVVAMAEVAYEAINLELHCGAH  122

Query  418  PRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            PRLGV+DDI  HPLARASL EAAWLAK +A++ G RFQVPVYLY  AHPT
Sbjct  123  PRLGVIDDIVCHPLARASLHEAAWLAKTIASDVGIRFQVPVYLYGAAHPT  172



>ref|XP_010095820.1| hypothetical protein L484_022176 [Morus notabilis]
 gb|EXB62288.1| hypothetical protein L484_022176 [Morus notabilis]
Length=310

 Score =   224 bits (571),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 106/150 (71%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            ++KK+  QS+LLCCKL ISES NR  L++I+RAA+HDPE+VIV  F+DR YNR  YT+VS
Sbjct  2    EKKKAADQSMLLCCKLFISESHNRSVLDAIERAARHDPESVIVTKFDDRAYNRARYTIVS  61

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD T G+ +Y PLQQTVVA+A AA+D INLE HSGAHPRLGVVDDI  HPLA ASLD
Sbjct  62   YVVHDCTGGA-VYSPLQQTVVAMAEAAFDAINLETHSGAHPRLGVVDDIVFHPLAHASLD  120

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +A + GNRFQVPVYLY  AHPT
Sbjct  121  EAAWLAKAVALDIGNRFQVPVYLYAAAHPT  150



>ref|XP_004304114.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Fragaria vesca subsp. vesca]
Length=318

 Score =   224 bits (571),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 107/150 (71%), Positives = 126/150 (84%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK++ QS+LLCCKL ISESRN   L++I+RAA+ D E+VIVN FEDR YNR+ YT+VS
Sbjct  10   KKKKTIDQSMLLCCKLFISESRNLTVLDAIERAARLDLESVIVNKFEDRAYNRVRYTIVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD +TGS IY PLQQTV+A+A AA+  INLE HSGAHPRLGVVDDI  HPLARASLD
Sbjct  70   YVLHD-STGSAIYSPLQQTVLAMAEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK + A+ GN+FQVPVYLY  AHPT
Sbjct  129  EAAWLAKAVGADIGNKFQVPVYLYAAAHPT  158



>ref|XP_002278962.2| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Vitis vinifera]
 emb|CBI28921.3| unnamed protein product [Vitis vinifera]
Length=345

 Score =   215 bits (548),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 116/186 (62%), Positives = 147/186 (79%), Gaps = 5/186 (3%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKELRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISESRN  186
            S+  S+P+ ++E K K++   + KP R +    NP  K+KKS+ QS+LLCCKL+ISESRN
Sbjct  3    SIYISAPI-SRETKAKQQ---KGKPRRREEMDLNPGCKDKKSIKQSMLLCCKLYISESRN  58

Query  187  REALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAI  366
              AL+SI+RAA+ D ETVIVN F+DR YNRI YTLVSY++HD +TG+ IY PLQQT++++
Sbjct  59   HTALDSIERAARLDGETVIVNKFQDRAYNRIGYTLVSYIVHD-STGNIIYSPLQQTLLSM  117

Query  367  AAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYL  546
              AAY+ INLELH GAHPRLGVVDDI  HPLARASL+EAAW AK  AA+ GN+FQVPV+L
Sbjct  118  VEAAYEAINLELHHGAHPRLGVVDDIVFHPLARASLEEAAWFAKMAAADIGNKFQVPVFL  177

Query  547  YNDAHP  564
            Y+ AHP
Sbjct  178  YDAAHP  183



>ref|XP_011467792.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Fragaria vesca subsp. vesca]
Length=300

 Score =   214 bits (544),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 102/141 (72%), Positives = 118/141 (84%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +LLCCKL ISESRN   L++I+RAA+ D E+VIVN FEDR YNR+ YT+VSYV+HD +TG
Sbjct  1    MLLCCKLFISESRNLTVLDAIERAARLDLESVIVNKFEDRAYNRVRYTIVSYVLHD-STG  59

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            S IY PLQQTV+A+A AA+  INLE HSGAHPRLGVVDDI  HPLARASLDEAAWLAK +
Sbjct  60   SAIYSPLQQTVLAMAEAAFGAINLEQHSGAHPRLGVVDDIVFHPLARASLDEAAWLAKAV  119

Query  505  AAEFGNRFQVPVYLYNDAHPT  567
             A+ GN+FQVPVYLY  AHPT
Sbjct  120  GADIGNKFQVPVYLYAAAHPT  140



>ref|XP_006371604.1| hypothetical protein POPTR_0019s13570g [Populus trichocarpa]
 gb|ERP49401.1| hypothetical protein POPTR_0019s13570g [Populus trichocarpa]
Length=316

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 102/155 (66%), Positives = 127/155 (82%), Gaps = 1/155 (1%)
 Frame = +1

Query  103  NNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRIN  282
            ++ + + K++  +S+L+ C L+ISE+RNR  L+ I+RAA+ DPE+VIVN FEDR YNRI 
Sbjct  3    SDSSCENKRTANESMLVSCMLYISEARNRAVLDLIERAARLDPESVIVNKFEDRVYNRIR  62

Query  283  YTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLA  462
            +T+VSYV+ D +TGSPIY PL QTV+A+  AAY  INLELHSGAHPRLGVVDDI  HPLA
Sbjct  63   FTIVSYVVVD-STGSPIYSPLHQTVLAMVEAAYGAINLELHSGAHPRLGVVDDIVFHPLA  121

Query  463  RASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            RASLDEAAWLAK +AA+ G+RFQVPV+LY  AHPT
Sbjct  122  RASLDEAAWLAKTVAADIGSRFQVPVFLYAAAHPT  156



>ref|XP_011039770.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Populus 
euphratica]
Length=316

 Score =   214 bits (544),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            + + K++  +S+L+CC L+ISE+RNR  L+ I++AA+ DPE+VIVN FEDR YNRI +T+
Sbjct  6    SCENKRTANESMLVCCMLYISEARNRAVLDLIEQAARLDPESVIVNKFEDRVYNRIRFTI  65

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+ D +TGSPIY PL QTV+ +  AAY  INLELHSGAHPRLGVVDDI  HPLARAS
Sbjct  66   VSYVVVD-STGSPIYSPLHQTVLTMVEAAYGAINLELHSGAHPRLGVVDDIVFHPLARAS  124

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ G+RFQVPV+LY  AHPT
Sbjct  125  LDEAAWLAKTVAADIGSRFQVPVFLYAAAHPT  156



>ref|XP_007153545.1| hypothetical protein PHAVU_003G044600g [Phaseolus vulgaris]
 gb|ESW25539.1| hypothetical protein PHAVU_003G044600g [Phaseolus vulgaris]
Length=317

 Score =   213 bits (541),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 101/158 (64%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            M  N     +KK V QS+LLCCK  +SESR    LE+I+ AA+ +PETVIVN F DR YN
Sbjct  1    MDFNCTAKDQKKGVDQSILLCCKFFVSESRRMATLEAIECAARSNPETVIVNKFHDRAYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R  +TLVSYV+HD T GSP+Y PL QTV+A+A AA++ INLE H GAHPRLG VDDI  H
Sbjct  61   RARFTLVSYVLHDCT-GSPVYSPLHQTVIAMAEAAFNTINLEFHDGAHPRLGAVDDIVFH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            PL RASLDEAAWLAK ++A+ GNRF VPV+LY  AHPT
Sbjct  120  PLGRASLDEAAWLAKAVSADIGNRFSVPVFLYAAAHPT  157



>ref|XP_010268810.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Nelumbo nucifera]
Length=314

 Score =   212 bits (540),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 122/150 (81%), Gaps = 8/150 (5%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K+KK+V QS+LLCCKL+ISE+RN  ALESI+RAA+ +PETVIVN F+D  YNR+ +TLVS
Sbjct  10   KKKKTVQQSMLLCCKLYISETRNNSALESIERAARLNPETVIVNKFQDGVYNRVRFTLVS  69

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV HD +TGSPIY PLQQTV+A+  AAY+ INLELHSGAHPRLGVVD I  HPLARASLD
Sbjct  70   YVAHD-STGSPIYSPLQQTVLAMVGAAYEAINLELHSGAHPRLGVVDHICFHPLARASLD  128

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +AA+ GNR Q        AHPT
Sbjct  129  EAAWLAKLVAADIGNRLQA-------AHPT  151



>ref|XP_002517978.1| formiminotransferase-cyclodeaminase, putative [Ricinus communis]
 gb|EEF44496.1| formiminotransferase-cyclodeaminase, putative [Ricinus communis]
Length=300

 Score =   207 bits (527),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 100/141 (71%), Positives = 115/141 (82%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +LLCCKL ISESRNR AL+SI+RAA+ +PETVIVN FEDR YNRI YTLVSYV+ D + G
Sbjct  1    MLLCCKLFISESRNRTALDSIERAARLNPETVIVNKFEDRAYNRIRYTLVSYVVLD-SIG  59

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            + IY PLQQTV+ +  AAY  INLE H GAHPRLGVVDDI  HPL+ ASLDEA+WLAK +
Sbjct  60   TAIYSPLQQTVLVMVEAAYGAINLESHCGAHPRLGVVDDIVFHPLSWASLDEASWLAKAV  119

Query  505  AAEFGNRFQVPVYLYNDAHPT  567
            AAE G+RFQVPV+LY  AH T
Sbjct  120  AAEIGSRFQVPVFLYAAAHST  140



>ref|XP_007043503.1| Transferases,folic acid binding [Theobroma cacao]
 gb|EOX99334.1| Transferases,folic acid binding [Theobroma cacao]
Length=325

 Score =   200 bits (508),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 103/150 (69%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K K +  QS+LLCCK+ +SESRNR AL++I+RAA+ DPETV+VN FEDR YNR  YTLVS
Sbjct  17   KIKTAANQSMLLCCKIFVSESRNRAALDAIERAARLDPETVVVNKFEDRAYNRSRYTLVS  76

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+HD +TG+ IY PLQ+TV+ +  A Y+ INLELHSGAHPRLGVVDDI +HPLAR+SLD
Sbjct  77   YVVHD-STGTAIYSPLQRTVLTMVEAVYEAINLELHSGAHPRLGVVDDIVLHPLARSSLD  135

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +AA+ GN  QVPV+LY  AHPT
Sbjct  136  EAAWLAKAVAADIGNILQVPVFLYGAAHPT  165



>ref|XP_002319918.2| hypothetical protein POPTR_0013s14190g [Populus trichocarpa]
 gb|EEE95841.2| hypothetical protein POPTR_0013s14190g [Populus trichocarpa]
Length=316

 Score =   198 bits (504),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/150 (70%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K KK+  +S+L+CC L ISE+RNR AL+ I+R+A+ DPE+VIVN FEDR YNRI +T+VS
Sbjct  8    KNKKTANESMLICCMLFISEARNRAALDLIERSARIDPESVIVNKFEDRVYNRIRFTIVS  67

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            YV+ D +TGSPIY PL QTV+AI  AAY  INLELHSGAHPRLGVVDDI  HPLA ASLD
Sbjct  68   YVVVD-STGSPIYSPLHQTVLAIVEAAYGAINLELHSGAHPRLGVVDDIAFHPLAEASLD  126

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            EAAWLAK +AA+ G+RFQVPV+LY  AHPT
Sbjct  127  EAAWLAKAVAADIGSRFQVPVFLYAAAHPT  156



>ref|XP_006447367.1| hypothetical protein CICLE_v10015950mg [Citrus clementina]
 ref|XP_006469847.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Citrus 
sinensis]
 gb|ESR60607.1| hypothetical protein CICLE_v10015950mg [Citrus clementina]
 gb|KDO43790.1| hypothetical protein CISIN_1g020781mg [Citrus sinensis]
Length=321

 Score =   198 bits (503),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 1/143 (1%)
 Frame = +1

Query  139  QSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDAT  318
            QS+L+CCKL ISESRN  AL++I+RAA+ D ETVIVN FEDR YNR  YTLVSYV+HD +
Sbjct  18   QSILVCCKLFISESRNLAALDAIERAARLDTETVIVNKFEDRIYNRARYTLVSYVVHD-S  76

Query  319  TGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAK  498
            TG+ IY PL+QT++A+A AAY  INLE HSGAHPRLGVVDDI  HPLARASLDEAAWLAK
Sbjct  77   TGTAIYSPLRQTIIAMADAAYGAINLETHSGAHPRLGVVDDIVFHPLARASLDEAAWLAK  136

Query  499  RLAAEFGNRFQVPVYLYNDAHPT  567
             +AA+ G+RFQVPV+LY  AHPT
Sbjct  137  AVAADIGSRFQVPVFLYAAAHPT  159



>ref|XP_004139959.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Cucumis 
sativus]
 ref|XP_004154537.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Cucumis 
sativus]
 gb|KGN46695.1| hypothetical protein Csa_6G124100 [Cucumis sativus]
Length=324

 Score =   198 bits (503),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 96/158 (61%), Positives = 119/158 (75%), Gaps = 1/158 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            MA +     +K+S+ Q VLLCCK ++SESRNR  LE+I+ AA+ DP++VIVN FED  YN
Sbjct  1    MAFHLTAKDKKRSLDQKVLLCCKYYVSESRNRSVLEAIEGAAREDPDSVIVNKFEDGAYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R  YT+VSYV+HD TTG+ IY PL QTV+++   A+  INLE HSG HPRLGVVDDI  H
Sbjct  61   RTRYTIVSYVVHD-TTGNAIYSPLLQTVLSMTQVAFSHINLESHSGTHPRLGVVDDIVFH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            PLARASL EAAWLAK +A +    FQVPV+LY+ AHP+
Sbjct  120  PLARASLHEAAWLAKAVAKDIAAMFQVPVFLYSAAHPS  157



>ref|NP_001235132.1| uncharacterized protein LOC100499724 [Glycine max]
 gb|ACU13381.1| unknown [Glycine max]
Length=190

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            N ++KK++ QS+LLCCK  +SESRN   L +I+R A+ +PETVIVN+F DR YNR  Y L
Sbjct  4    NKEQKKTIDQSILLCCKFFVSESRNNATLNAIERVARSNPETVIVNMFHDRSYNRARYDL  63

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+HD T G+PIY PL QTV+A+A A ++ INLE H GAHPRLG +DDI  HPL  AS
Sbjct  64   VSYVLHDCT-GNPIYSPLHQTVIAMAEATFNAINLEFHEGAHPRLGALDDIIFHPLGHAS  122

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ GNRF VPV+LY  AHPT
Sbjct  123  LDEAAWLAKAVAADIGNRFSVPVFLYAAAHPT  154



>gb|KHN09927.1| Formimidoyltransferase-cyclodeaminase [Glycine soja]
Length=286

 Score =   196 bits (497),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            N ++KK+V QS+LLCCK  +SESRN   L +I+RAA+ +PETVIVN+F DR YNR  Y L
Sbjct  8    NKEQKKTVDQSILLCCKFFVSESRNNATLNAIERAARSNPETVIVNMFHDRAYNRARYDL  67

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+HD T G+PIY PL QTV+A+A A ++ +NLE H GAHPRLG VDDI  HPL  AS
Sbjct  68   VSYVLHDCT-GNPIYSPLHQTVIAMAEATFNAVNLEFHEGAHPRLGAVDDIVFHPLGHAS  126

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ GNRF VPV+LY  AHPT
Sbjct  127  LDEAAWLAKAVAADIGNRFSVPVFLYAAAHPT  158



>ref|NP_001242582.1| uncharacterized protein LOC100784302 [Glycine max]
 gb|ACU20769.1| unknown [Glycine max]
Length=318

 Score =   196 bits (498),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 119/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            N ++KK+V QS+LLCCK  +SESRN   L +I+RAA+ +PETVIVN+F DR YNR  Y L
Sbjct  8    NKEQKKTVDQSILLCCKFFVSESRNNATLNAIERAARSNPETVIVNMFHDRAYNRARYDL  67

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+HD T G+PIY PL QTV+A+A A ++ +NLE H GAHPRLG VDDI  HPL  AS
Sbjct  68   VSYVLHDCT-GNPIYSPLHQTVIAMAEATFNAVNLEFHEGAHPRLGAVDDIVFHPLGHAS  126

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ GNRF VPV+LY  AHPT
Sbjct  127  LDEAAWLAKAVAADIGNRFSVPVFLYAAAHPT  158



>ref|XP_004487321.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Cicer 
arietinum]
Length=318

 Score =   196 bits (497),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 123/158 (78%), Gaps = 1/158 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            MA N     +KK+V QS+LLCCK  ISE RN   L++++R A+ +PETVIVN F DR YN
Sbjct  1    MAFNYTAKDKKKTVDQSMLLCCKFFISEGRNIATLDAVERVARSNPETVIVNKFHDRTYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R  Y+LVSYV+HD T G+ IY PLQQTVVA+A AA++ INLELH GAHPRLG VDDI  H
Sbjct  61   RARYSLVSYVLHDCT-GNAIYSPLQQTVVAMAEAAFNSINLELHDGAHPRLGAVDDIVFH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            PLARAS+DEAAWLAK +AA+ GN+F VPV+LY  AHPT
Sbjct  120  PLARASMDEAAWLAKAVAADIGNQFNVPVFLYAAAHPT  157



>gb|KDP24183.1| hypothetical protein JCGZ_25840 [Jatropha curcas]
Length=317

 Score =   195 bits (496),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 105/158 (66%), Positives = 126/158 (80%), Gaps = 1/158 (1%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            M  N+    +KK++ +S+L+CCKL ISESRNR ALE I+RAA+  PETV+VN FED +YN
Sbjct  1    MDFNSSCKNDKKTICESMLVCCKLFISESRNRTALEQIERAARLHPETVMVNKFEDSDYN  60

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            RI Y LVSYV+ D +TGS IY PLQQTV+A+  AAY+ INLE H GAHPRLGVVD+I  H
Sbjct  61   RIRYDLVSYVVLD-STGSAIYSPLQQTVLAMVEAAYEAINLESHIGAHPRLGVVDEIAFH  119

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            PLARASLDEAAWLAK +AA+ G+R QVPV+LY  AHPT
Sbjct  120  PLARASLDEAAWLAKAVAADIGSRCQVPVFLYAAAHPT  157



>ref|XP_010657287.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Vitis vinifera]
 ref|XP_010657289.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Vitis vinifera]
 ref|XP_010657290.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Vitis vinifera]
Length=301

 Score =   194 bits (494),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 99/140 (71%), Positives = 119/140 (85%), Gaps = 1/140 (1%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +LLCCKL+ISESRN  AL+SI+RAA+ D ETVIVN F+DR YNRI YTLVSY++HD +TG
Sbjct  1    MLLCCKLYISESRNHTALDSIERAARLDGETVIVNKFQDRAYNRIGYTLVSYIVHD-STG  59

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            + IY PLQQT++++  AAY+ INLELH GAHPRLGVVDDI  HPLARASL+EAAW AK  
Sbjct  60   NIIYSPLQQTLLSMVEAAYEAINLELHHGAHPRLGVVDDIVFHPLARASLEEAAWFAKMA  119

Query  505  AAEFGNRFQVPVYLYNDAHP  564
            AA+ GN+FQVPV+LY+ AHP
Sbjct  120  AADIGNKFQVPVFLYDAAHP  139



>ref|XP_010051646.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010051652.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010051657.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010051663.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 gb|KCW89493.1| hypothetical protein EUGRSUZ_A01786 [Eucalyptus grandis]
Length=326

 Score =   194 bits (492),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 110/163 (67%), Positives = 130/163 (80%), Gaps = 2/163 (1%)
 Frame = +1

Query  82   ARGKMAANNPNSKEKKSVMQ-SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFE  258
            + G +AA+N   KE K +   S+LLCCKL ISESRNR  L+SI+RAA  DPET+IVN FE
Sbjct  5    SEGDLAASNDGCKENKKISSTSMLLCCKLFISESRNRAVLDSIERAAHLDPETIIVNKFE  64

Query  259  DREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVD  438
            DR YNR+ YTLVS+V+HD T G  +Y PLQQTV+A+A AA++ INLELHSGAHPRLGVVD
Sbjct  65   DRAYNRVRYTLVSHVVHDCT-GQAVYSPLQQTVMAMAEAAFEAINLELHSGAHPRLGVVD  123

Query  439  DITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            DI  HPLARASLDEAAWLAK +AA+ G + QVPV+LY  AHPT
Sbjct  124  DIVFHPLARASLDEAAWLAKAVAADIGLKLQVPVFLYAAAHPT  166



>gb|KHN07746.1| Formimidoyltransferase-cyclodeaminase [Glycine soja]
Length=314

 Score =   193 bits (490),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 118/152 (78%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            N ++KK++ QS+LLCCK  +SESRN   L +I+R A+ +PETVIVN+F DR YNR  Y L
Sbjct  4    NKEQKKTIDQSILLCCKFFVSESRNNATLNAIERVARSNPETVIVNMFHDRSYNRARYDL  63

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+HD T G+PIY PL QTV+A+A A ++ INLE H GAHPRLG +DDI  HPL  AS
Sbjct  64   VSYVLHDCT-GNPIYSPLHQTVIAMAEATFNAINLEFHEGAHPRLGALDDIIFHPLGHAS  122

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ GNRF VPV+LY  AHPT
Sbjct  123  LDEAAWLAKAVAADIGNRFSVPVFLYAAAHPT  154



>ref|XP_011045517.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Populus 
euphratica]
Length=306

 Score =   192 bits (488),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 1/152 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            + K KK+  +S+L+CC L ISE+RNR AL+ I+RAA+ DPE+VIVN FE R YNR  +T+
Sbjct  6    SCKNKKNANESMLICCMLFISEARNRAALDLIERAARIDPESVIVNKFEVRVYNRNRFTI  65

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VSYV+ D +TGSPIY PL QTV+AI  AAY  INLELHSGAHPRLGVVDDI  HPLA AS
Sbjct  66   VSYVVAD-STGSPIYSPLHQTVLAIVEAAYGAINLELHSGAHPRLGVVDDIAFHPLAEAS  124

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            LDEAAWLAK +AA+ G+RFQVPV+LY  AHPT
Sbjct  125  LDEAAWLAKAVAADIGSRFQVPVFLYAAAHPT  156



>gb|AFK38686.1| unknown [Medicago truncatula]
Length=255

 Score =   183 bits (465),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            V QS+LLCCK  ISE RN   L++++RAA+ +PETVIVN F  R YNR  Y+LVSYV+HD
Sbjct  16   VDQSMLLCCKFFISEGRNIATLDAVERAARSNPETVIVNKFHGRSYNRARYSLVSYVLHD  75

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             T G+ IY PLQQTVVA+A AA++ INLELH G+HPRLG VDDI  HPLA ASLD+AAWL
Sbjct  76   CT-GNAIYSPLQQTVVAMAEAAFNTINLELHDGSHPRLGAVDDIVFHPLACASLDDAAWL  134

Query  493  AKRLAAEFGNRFQVPVYLYNDAHPT  567
            AK +AA+FGN+F VPV+LY  AHPT
Sbjct  135  AKAVAADFGNQFSVPVFLYAAAHPT  159



>gb|KEH39070.1| formiminotransferase-cyclodeaminase-like protein [Medicago truncatula]
Length=320

 Score =   184 bits (466),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 116/145 (80%), Gaps = 1/145 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            V QS+LLCCK  ISE RN   L++++RAA+ +PETVIVN F  R YNR  Y+LVSYV+HD
Sbjct  16   VDQSMLLCCKFFISEGRNIATLDAVERAARSNPETVIVNKFHGRSYNRARYSLVSYVLHD  75

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             T G+ IY PLQQTVVA+A AA++ INLELH G+HPRLG VDDI  HPLA ASLD+AAWL
Sbjct  76   CT-GNAIYSPLQQTVVAMAEAAFNTINLELHDGSHPRLGAVDDIVFHPLACASLDDAAWL  134

Query  493  AKRLAAEFGNRFQVPVYLYNDAHPT  567
            AK +AA+FGN+F VPV+LY  AHPT
Sbjct  135  AKAVAADFGNQFNVPVFLYAAAHPT  159



>ref|XP_004982519.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Setaria italica]
Length=325

 Score =   181 bits (460),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  PNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYT  288
            PN+K+  S+M S  +CCKL+ISESRN  A+++I  AAK DP+  +++ FED  YNR+ YT
Sbjct  16   PNAKDNLSMMYSKFICCKLYISESRNPTAIDAIDLAAKTDPQVAVLSKFEDCLYNRVRYT  75

Query  289  LVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARA  468
            LVSY+I D++T   IY P+++ ++A+  AA+  INLELHSGAHPR+GV DD++ HPL +A
Sbjct  76   LVSYIIDDSST-EVIYSPIRKVLLAMMEAAFSAINLELHSGAHPRMGVNDDLSFHPLGQA  134

Query  469  SLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++++AA LAK++A++ GN FQVPV+LY  AHPT
Sbjct  135  TMEDAASLAKQVASDIGNGFQVPVFLYAAAHPT  167



>ref|XP_004982518.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Setaria italica]
Length=339

 Score =   182 bits (461),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 83/153 (54%), Positives = 119/153 (78%), Gaps = 1/153 (1%)
 Frame = +1

Query  109  PNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYT  288
            PN+K+  S+M S  +CCKL+ISESRN  A+++I  AAK DP+  +++ FED  YNR+ YT
Sbjct  30   PNAKDNLSMMYSKFICCKLYISESRNPTAIDAIDLAAKTDPQVAVLSKFEDCLYNRVRYT  89

Query  289  LVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARA  468
            LVSY+I D++T   IY P+++ ++A+  AA+  INLELHSGAHPR+GV DD++ HPL +A
Sbjct  90   LVSYIIDDSST-EVIYSPIRKVLLAMMEAAFSAINLELHSGAHPRMGVNDDLSFHPLGQA  148

Query  469  SLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++++AA LAK++A++ GN FQVPV+LY  AHPT
Sbjct  149  TMEDAASLAKQVASDIGNGFQVPVFLYAAAHPT  181



>gb|KEH39071.1| formiminotransferase-cyclodeaminase-like protein [Medicago truncatula]
Length=301

 Score =   180 bits (456),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 94/141 (67%), Positives = 113/141 (80%), Gaps = 1/141 (1%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +LLCCK  ISE RN   L++++RAA+ +PETVIVN F  R YNR  Y+LVSYV+HD T G
Sbjct  1    MLLCCKFFISEGRNIATLDAVERAARSNPETVIVNKFHGRSYNRARYSLVSYVLHDCT-G  59

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            + IY PLQQTVVA+A AA++ INLELH G+HPRLG VDDI  HPLA ASLD+AAWLAK +
Sbjct  60   NAIYSPLQQTVVAMAEAAFNTINLELHDGSHPRLGAVDDIVFHPLACASLDDAAWLAKAV  119

Query  505  AAEFGNRFQVPVYLYNDAHPT  567
            AA+FGN+F VPV+LY  AHPT
Sbjct  120  AADFGNQFNVPVFLYAAAHPT  140



>ref|XP_010905201.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Elaeis 
guineensis]
Length=312

 Score =   177 bits (450),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/148 (57%), Positives = 113/148 (76%), Gaps = 1/148 (1%)
 Frame = +1

Query  121  EKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSY  300
            +K  +  + L+C KL+ISESRN  AL+ I++AAK DPE  IVN F+DR YNR+ YTLVSY
Sbjct  7    KKMELKDTKLICVKLYISESRNNSALDMIEQAAKIDPEAAIVNKFQDRNYNRVRYTLVSY  66

Query  301  VIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDE  480
            ++H++ TG   Y P++QT++A+  AAY  INLE+HSGAHPRLGVVD I  HPL R++L++
Sbjct  67   LVHNSVTGI-TYTPVRQTLLAMVEAAYTAINLEMHSGAHPRLGVVDHICFHPLVRSTLED  125

Query  481  AAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            AA +AK +A++ GN  QVPV+LY  AHP
Sbjct  126  AARVAKLVASDIGNGLQVPVFLYEAAHP  153



>gb|KEH39072.1| formiminotransferase-cyclodeaminase-like protein [Medicago truncatula]
Length=272

 Score =   176 bits (445),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 91/145 (63%), Positives = 114/145 (79%), Gaps = 1/145 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            V QS+LLCCK  +SE RN   L++++RA + +PE VIV+ F DR YNR  Y+LVSYV+HD
Sbjct  2    VDQSMLLCCKFFVSEGRNIATLDAVERAVRMNPEIVIVHKFHDRAYNRARYSLVSYVLHD  61

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             T G+ IY PLQQ V+A+A AA++ INLELH GAHPRLG +DDI  HPLA AS+D+AAWL
Sbjct  62   CT-GNAIYNPLQQIVLAMAEAAFNAINLELHDGAHPRLGAIDDIVFHPLACASMDDAAWL  120

Query  493  AKRLAAEFGNRFQVPVYLYNDAHPT  567
            AK +AA+FGN+F VPV+LY  AHPT
Sbjct  121  AKAVAADFGNQFNVPVFLYAAAHPT  145



>ref|XP_008775448.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Phoenix 
dactylifera]
Length=316

 Score =   172 bits (437),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 82/139 (59%), Positives = 108/139 (78%), Gaps = 1/139 (1%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+C KL+ISESRN  AL+ I++A+K DPE  IVN F+DR YNR+ YTLVSYV+HDA  G 
Sbjct  20   LICVKLYISESRNSSALDMIEQASKIDPEAAIVNKFQDRNYNRVRYTLVSYVVHDAVAGI  79

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
              + P+++T++A+  AAY  INLE+HSGAHPRLGVVD I  HPLA+A+L++AA +AK +A
Sbjct  80   -TFSPMRRTLLAMVEAAYAAINLEMHSGAHPRLGVVDHICFHPLAQATLEDAARVAKLVA  138

Query  508  AEFGNRFQVPVYLYNDAHP  564
            ++ G   QVPV+LY  AHP
Sbjct  139  SDIGIGLQVPVFLYEAAHP  157



>ref|XP_003562338.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Brachypodium 
distachyon]
Length=320

 Score =   171 bits (432),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/151 (51%), Positives = 115/151 (76%), Gaps = 1/151 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            K K S+M S ++CCKL+ISES+N   +++I R  + DPE V+++ FED  YNR+ YTLVS
Sbjct  12   KAKLSMMHSKVICCKLYISESQNAMVVDAISRIGQKDPEVVLLSKFEDEYYNRVRYTLVS  71

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASL  474
            Y+I +++TG  I+ P+++ ++A+  AA+  INLE+H G HPR+GVVDD++ HPL++ A++
Sbjct  72   YIISNSSTGEVIFSPIRKVLLAMIEAAFSNINLEVHCGTHPRIGVVDDMSFHPLSQAATM  131

Query  475  DEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++AA LAK LA++ GN  QVPV+LY  AHPT
Sbjct  132  EDAAQLAKLLASDIGNGLQVPVFLYAAAHPT  162



>gb|EMS48877.1| Formimidoyltransferase-cyclodeaminase [Triticum urartu]
Length=429

 Score =   168 bits (425),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/151 (50%), Positives = 111/151 (74%), Gaps = 1/151 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            + K S M S ++CCKL+ISES+N   +++I R  + DPE V++N FED  YNR+ YTLVS
Sbjct  8    QAKLSTMHSKVICCKLYISESQNAAVVDAISRIGQKDPEVVLLNKFEDEYYNRVRYTLVS  67

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASL  474
            Y+  ++ TG  ++ P+++ ++A+  AA+  INLE+H G HPR+GVVDDI+ HPL + A++
Sbjct  68   YINSESATGEAVFSPIRKVLLAMIEAAFSAINLEVHCGTHPRIGVVDDISFHPLTQAATM  127

Query  475  DEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++AA LAK +A++ GN  QVPV+LY  AHPT
Sbjct  128  EDAAQLAKLVASDIGNGLQVPVFLYAAAHPT  158


 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 65/139 (47%), Positives = 103/139 (74%), Gaps = 1/139 (1%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            + K S M   ++CCKL+ISES+N   ++SI R  + DPE V+++ FED  YNR+ YTLVS
Sbjct  259  QAKLSTMHPKVICCKLYISESQNGAVVDSISRIGQKDPEVVLLSKFEDEYYNRVRYTLVS  318

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASL  474
            Y+  +++TG  ++ P+++ ++A+  AA+  INLE+HSG HPR+GVVDD++ HPL++ A++
Sbjct  319  YITSESSTGEAVFSPIRKVLLAMIEAAFSAINLEVHSGTHPRIGVVDDMSFHPLSQAATM  378

Query  475  DEAAWLAKRLAAEFGNRFQ  531
            ++AA LAK +A++ GN  Q
Sbjct  379  EDAAQLAKLVASDIGNGLQ  397



>gb|EAY90773.1| hypothetical protein OsI_12376 [Oryza sativa Indica Group]
Length=318

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/152 (46%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
             +K K S+++S ++CCKL+ISES+N + +++I R  + DPE V+++ FED  YNR+ YTL
Sbjct  9    KAKAKLSMLKSKVICCKLYISESQNAKVVDAITRIGQKDPEVVLLSKFEDDHYNRVRYTL  68

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
             SY+I++ +TG   + P+++ ++ +   A+  INLE H+G HPR+GV+DD++ HPL +A+
Sbjct  69   ASYIINENSTGEVKFSPMRRVLLEMIEKAFSTINLETHTGTHPRIGVIDDMSFHPLNQAT  128

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            +++AA LAK +A++ GN  QVPV+LY  AHPT
Sbjct  129  MEDAAQLAKTVASDIGNFLQVPVFLYGAAHPT  160



>ref|NP_001050558.1| Os03g0582000 [Oryza sativa Japonica Group]
 gb|AAS07168.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF97307.1| formiminotransferase-cyclodeaminase, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12472.1| Os03g0582000 [Oryza sativa Japonica Group]
 gb|EAZ27600.1| hypothetical protein OsJ_11547 [Oryza sativa Japonica Group]
Length=318

 Score =   165 bits (417),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 70/151 (46%), Positives = 113/151 (75%), Gaps = 0/151 (0%)
 Frame = +1

Query  115  SKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLV  294
            +K K S+++S ++CCKL+ISES+N + +++I R  + DPE V+++ FED  YNR+ YTL 
Sbjct  10   AKAKLSMLKSKVICCKLYISESQNAKVVDAITRIGQKDPEVVLLSKFEDDHYNRVRYTLA  69

Query  295  SYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASL  474
            SY+I++ +TG   + P+++ ++ +   A+  INLE H+G HPR+GV+DD++ HPL +A++
Sbjct  70   SYIINENSTGEVKFSPMRRVLLEMIEKAFSTINLETHTGTHPRIGVIDDMSFHPLNQATM  129

Query  475  DEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++AA LAK +A++ GN  QVPV+LY  AHPT
Sbjct  130  EDAAQLAKTVASDIGNFLQVPVFLYGAAHPT  160



>ref|XP_006650273.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Oryza 
brachyantha]
Length=318

 Score =   165 bits (417),  Expect = 6e-46, Method: Compositional matrix adjust.
 Identities = 69/152 (45%), Positives = 113/152 (74%), Gaps = 0/152 (0%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
             +K K ++++S ++CCKL+ISES+N + +++I    + DPE V+++ FED  YNR+ YTL
Sbjct  9    KAKAKLTLLKSKVICCKLYISESQNAKVVDAISHIVQKDPEVVLLSKFEDDHYNRVRYTL  68

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
             SY+++D++TG     P+++ ++ +   A+  INLE+H+G HPR+GVVDD++ HPL +A+
Sbjct  69   ASYIVNDSSTGEVKLSPMRRVLLEMTETAFSTINLEMHTGTHPRIGVVDDMSFHPLNQAT  128

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            +++AA LAK +A++ GN  QVPV+LY  AHPT
Sbjct  129  MEDAAQLAKMVASDIGNGLQVPVFLYGAAHPT  160



>gb|EMT16419.1| Formimidoyltransferase-cyclodeaminase [Aegilops tauschii]
Length=320

 Score =   164 bits (415),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/153 (48%), Positives = 112/153 (73%), Gaps = 1/153 (1%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            N K K S M   ++CCKL+ISES+N   +++I R  + DPE  +++ FED  YNR+ YTL
Sbjct  10   NVKAKLSTMHLKVICCKLYISESQNAAVVDAISRIGQKDPEVGLLSKFEDEYYNRVRYTL  69

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-A  468
            VSY+  +++TG  ++ P+++ ++A+  AA+  INLE+H G HPR+GVVDD++ HPL++ A
Sbjct  70   VSYITSESSTGEAVFSPIRKVLLAMIEAAFSAINLEVHCGTHPRIGVVDDMSFHPLSQAA  129

Query  469  SLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
            ++++AA LAK +A++ GN  QVPV+LY  AHPT
Sbjct  130  TMEDAAQLAKLVASDIGNGLQVPVFLYAAAHPT  162



>ref|XP_010035674.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Eucalyptus grandis]
Length=439

 Score =   166 bits (420),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 84/189 (44%), Positives = 121/189 (64%), Gaps = 7/189 (4%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKE----LRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHIS  174
            +L D  P +  E +  +E    LR++ +     + A   N    K +++ +L CCK++IS
Sbjct  94   ALLDGYPTMEPEDERVQEMMGHLRLKFRAVCASLGAKLENRGYLKGMLKMMLACCKVYIS  153

Query  175  ESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQT  354
            ESRNR ALE+I+RAAK  PET ++N FED  YNR+ YT+VS +   +++ S   CPL+  
Sbjct  154  ESRNRSALEAIERAAKLFPETAVLNKFEDEIYNRVGYTVVSRLAQKSSSDS---CPLRSA  210

Query  355  VVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQV  534
            V+A+   A+D I+LE HSG+HPRLGVVD I  HPL + SLD+ A +A+ LA + G+  QV
Sbjct  211  VLAMVKTAFDAIDLESHSGSHPRLGVVDHICFHPLGQTSLDQVAAIARSLAVDIGSGLQV  270

Query  535  PVYLYNDAH  561
            P +LY  AH
Sbjct  271  PAFLYGAAH  279



>ref|XP_008809862.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Phoenix dactylifera]
Length=449

 Score =   166 bits (419),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 106/148 (72%), Gaps = 3/148 (2%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            +EK+ +++S+L CCKL+ISESRN  ALESI+ AAK  PE V++N F+D  YNR+ YTLVS
Sbjct  145  REKQKMLKSMLACCKLYISESRNSLALESIELAAKLYPEAVVINKFKDEAYNRVGYTLVS  204

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
                  TT SP   PL+  V+++  AA++ INLELHSG HPRLGVVD I  HPL   SLD
Sbjct  205  CF---DTTSSPDVAPLKNAVLSMVKAAFETINLELHSGTHPRLGVVDHICFHPLVHGSLD  261

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            +AA +AK +AA+ G + +VP +LY  AH
Sbjct  262  KAAGIAKSVAADIGRKLRVPTFLYGAAH  289



>ref|XP_002466878.1| hypothetical protein SORBIDRAFT_01g015770 [Sorghum bicolor]
 gb|EER93876.1| hypothetical protein SORBIDRAFT_01g015770 [Sorghum bicolor]
Length=317

 Score =   162 bits (411),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 76/156 (49%), Positives = 113/156 (72%), Gaps = 2/156 (1%)
 Frame = +1

Query  100  ANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRI  279
            AN P  K K S+  S  + CKL+ISE+RN  A+++I+ A+K D + V+V+   D  YNR 
Sbjct  6    ANKP--KPKLSMKHSKFIFCKLYISETRNTMAMDTIEHASKSDAQVVVVSQLGDHHYNRF  63

Query  280  NYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPL  459
             YTLVSY++ D++TG  IY P+++ ++A+  AA+  INLE  SG HPR+GVVDD++ HP+
Sbjct  64   RYTLVSYIVDDSSTGEVIYSPIRKVLLAMIEAAFATINLESQSGTHPRIGVVDDLSFHPV  123

Query  460  ARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHPT  567
             +A++++AA LAK++A++ GN  QVPV+LY  AHPT
Sbjct  124  GQATIEDAASLAKQVASDIGNGLQVPVFLYAAAHPT  159



>ref|XP_010923937.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Elaeis guineensis]
Length=319

 Score =   162 bits (411),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 80/148 (54%), Positives = 108/148 (73%), Gaps = 3/148 (2%)
 Frame = +1

Query  118  KEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVS  297
            +EK  +++S+L CCKL+ISESRN  ALESI+ AAK  PE V++N F+D  YNR+ YTLVS
Sbjct  15   QEKPKMLKSMLACCKLYISESRNSLALESIELAAKLYPEAVVINKFKDEAYNRVGYTLVS  74

Query  298  YVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLD  477
            Y   D T+   +  PL+  V+++  AA++ INLELHSG HPRLGVVD I  HPL + SLD
Sbjct  75   YF--DTTSLHDV-APLKNAVLSMVKAAFESINLELHSGTHPRLGVVDHICFHPLVQDSLD  131

Query  478  EAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            +AA +AK +AA+ G++ QVP ++Y  AH
Sbjct  132  QAAGIAKSVAADIGHKLQVPTFVYGAAH  159



>gb|AAS07167.1| expressed protein [Oryza sativa Japonica Group]
 gb|ABF97308.1| formiminotransferase-cyclodeaminase, putative, expressed [Oryza 
sativa Japonica Group]
Length=303

 Score =   160 bits (405),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 109/145 (75%), Gaps = 0/145 (0%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S ++CCKL+ISES+N + +++I R  + DPE V+++ FED  YNR+ YTL SY+I++
Sbjct  1    MLKSKVICCKLYISESQNAKVVDAITRIGQKDPEVVLLSKFEDDHYNRVRYTLASYIINE  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +TG   + P+++ ++ +   A+  INLE H+G HPR+GV+DD++ HPL +A++++AA L
Sbjct  61   NSTGEVKFSPMRRVLLEMIEKAFSTINLETHTGTHPRIGVIDDMSFHPLNQATMEDAAQL  120

Query  493  AKRLAAEFGNRFQVPVYLYNDAHPT  567
            AK +A++ GN  QVPV+LY  AHPT
Sbjct  121  AKTVASDIGNFLQVPVFLYGAAHPT  145



>ref|XP_010923939.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Elaeis guineensis]
Length=300

 Score =   159 bits (402),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 78/147 (53%), Positives = 104/147 (71%), Gaps = 11/147 (7%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYV---  303
            +++S+L CCKL+ISESRN  ALESI+ AAK  PE V++N F+D  YNR+ YTLVSY    
Sbjct  1    MLKSMLACCKLYISESRNSLALESIELAAKLYPEAVVINKFKDEAYNRVGYTLVSYFDTT  60

Query  304  -IHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDE  480
             +HD         PL+  V+++  AA++ INLELHSG HPRLGVVD I  HPL + SLD+
Sbjct  61   SLHDVA-------PLKNAVLSMVKAAFESINLELHSGTHPRLGVVDHICFHPLVQDSLDQ  113

Query  481  AAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            AA +AK +AA+ G++ QVP ++Y  AH
Sbjct  114  AAGIAKSVAADIGHKLQVPTFVYGAAH  140



>ref|XP_010035673.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Eucalyptus grandis]
 gb|KCW47129.1| hypothetical protein EUGRSUZ_K00936 [Eucalyptus grandis]
Length=300

 Score =   159 bits (401),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 103/143 (72%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALE+I+RAAK  PET ++N FED  YNR+ YT+VS +   
Sbjct  1    MLKMMLACCKVYISESRNRSALEAIERAAKLFPETAVLNKFEDEIYNRVGYTVVSRLAQK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            +++ S   CPL+  V+A+   A+D I+LE HSG+HPRLGVVD I  HPL + SLD+ A +
Sbjct  61   SSSDS---CPLRSAVLAMVKTAFDAIDLESHSGSHPRLGVVDHICFHPLGQTSLDQVAAI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP +LY  AH
Sbjct  118  ARSLAVDIGSGLQVPAFLYGAAH  140



>ref|XP_010035676.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035677.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035678.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035679.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035680.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035681.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 ref|XP_010035682.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Eucalyptus 
grandis]
 gb|KCW47126.1| hypothetical protein EUGRSUZ_K00933 [Eucalyptus grandis]
Length=300

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALE I++AAK  PE  ++N FED  YNR+ YT+VS +   
Sbjct  1    MLKMMLACCKVYISESRNRSALEVIEQAAKQFPEAAVLNKFEDEIYNRVGYTVVSRLAQK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            + + S   CPL+  V+A+  AA+D I+LE HSG+HPRLGVVD I  HPL + SLD+ A +
Sbjct  61   SPSDS---CPLRSAVLAMVKAAFDAIDLESHSGSHPRLGVVDHICFHPLGQTSLDQVATI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP +LY  AH
Sbjct  118  ARSLAVDIGSGLQVPAFLYGVAH  140



>dbj|BAJ93375.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=316

 Score =   155 bits (391),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 68/144 (47%), Positives = 107/144 (74%), Gaps = 1/144 (1%)
 Frame = +1

Query  139  QSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDAT  318
             S ++CCKL+ISESRN   +++I R  + +PE V+++ F+D+ YNR+ YTLVSY+  +++
Sbjct  15   HSKVICCKLYISESRNAAIVDAISRIGQKNPEVVLLSKFDDKYYNRVRYTLVSYITSESS  74

Query  319  TGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLA-RASLDEAAWLA  495
             G  ++ P+++ ++ +  AA+  INL+ HSG HPR+GVVDDI+ HPL+  A++++AA LA
Sbjct  75   AGEAVFGPIRKVLLEMIEAAFSAINLQAHSGTHPRIGVVDDISFHPLSPAATMEDAAQLA  134

Query  496  KRLAAEFGNRFQVPVYLYNDAHPT  567
            K +A++ GN  QVPV+LY  AHPT
Sbjct  135  KLVASDIGNGLQVPVFLYAAAHPT  158



>ref|XP_002517979.1| formiminotransferase-cyclodeaminase, putative [Ricinus communis]
 gb|EEF44497.1| formiminotransferase-cyclodeaminase, putative [Ricinus communis]
Length=299

 Score =   154 bits (390),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++  L CCK++ISE+RN+ AL SI++AAK  P+  I+N FED  YNR+ YTLVS +   
Sbjct  1    MLKWTLACCKVYISETRNKAALASIEKAAKLFPQAPIINRFEDATYNRVGYTLVSSLAPK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             ++GS   C L+  V+A+  AA++ I+ E HSG+HPRLGVVD I  HPLARASLD+ A +
Sbjct  61   PSSGS---CSLRSAVLAMVKAAFEAIDFEQHSGSHPRLGVVDHICFHPLARASLDQVAEI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA + G+  QVP +LY  AH
Sbjct  118  AKSLAVDVGSGLQVPTFLYGAAH  140



>gb|AFK49176.1| unknown [Medicago truncatula]
Length=246

 Score =   152 bits (383),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++++L CCK++ISESRN+ ALESI++AAK  P   I+N FED  YNR+ YTLVS +  D
Sbjct  1    MLKTILGCCKVYISESRNKSALESIEKAAKFFPLAPIINKFEDVAYNRVGYTLVSEL--D  58

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            + +     C L   V+A+  AA+D ++ E+HSG HPRLGVVD I  HPL  ASLD+AA  
Sbjct  59   SVSSGKSSCDLTNAVLAMVKAAFDNVDFEVHSGTHPRLGVVDHICFHPLVDASLDQAART  118

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA++ G+  +VP +LY  AH
Sbjct  119  ARCLASDMGSSLEVPTFLYGAAH  141



>ref|XP_002272923.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Vitis vinifera]
Length=455

 Score =   156 bits (394),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 79/150 (53%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            +S+E + +++ +L CCK++ISESRNR ALE I+RAA+  PE  I+N FED  YNR+ YTL
Sbjct  148  SSEEGERMLKLMLACCKVYISESRNRAALELIERAARLFPEAPIINKFEDETYNRVGYTL  207

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VS +   A   S   C L+  V+A+  AA++ INLE+H G HPRLGVVD I  HPLA AS
Sbjct  208  VSKL---APKPSSDTCALRGAVLAMVKAAFEAINLEMHCGNHPRLGVVDHICFHPLADAS  264

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            L + A +AK LAA+ G+  QVP +LY  AH
Sbjct  265  LKQTAGIAKSLAADIGSNLQVPTFLYGAAH  294



>ref|XP_010657291.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Vitis vinifera]
 ref|XP_010657292.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Vitis vinifera]
Length=301

 Score =   152 bits (385),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALE I+RAA+  PE  I+N FED  YNR+ YTLVS +   
Sbjct  1    MLKLMLACCKVYISESRNRAALELIERAARLFPEAPIINKFEDETYNRVGYTLVSKL---  57

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            A   S   C L+  V+A+  AA++ INLE+H G HPRLGVVD I  HPLA ASL + A +
Sbjct  58   APKPSSDTCALRGAVLAMVKAAFEAINLEMHCGNHPRLGVVDHICFHPLADASLKQTAGI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LAA+ G+  QVP +LY  AH
Sbjct  118  AKSLAADIGSNLQVPTFLYGAAH  140



>emb|CBI28922.3| unnamed protein product [Vitis vinifera]
Length=297

 Score =   152 bits (383),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 75/139 (54%), Positives = 97/139 (70%), Gaps = 3/139 (2%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +L CCK++ISESRNR ALE I+RAA+  PE  I+N FED  YNR+ YTLVS +    ++ 
Sbjct  1    MLACCKVYISESRNRAALELIERAARLFPEAPIINKFEDETYNRVGYTLVSKLAPKPSSD  60

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            +   C L+  V+A+  AA++ INLE+H G HPRLGVVD I  HPLA ASL + A +AK L
Sbjct  61   T---CALRGAVLAMVKAAFEAINLEMHCGNHPRLGVVDHICFHPLADASLKQTAGIAKSL  117

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+  QVP +LY  AH
Sbjct  118  AADIGSNLQVPTFLYGAAH  136



>gb|KEH39069.1| formiminotransferase-cyclodeaminase-like protein [Medicago truncatula]
Length=302

 Score =   151 bits (382),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 100/143 (70%), Gaps = 2/143 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++++L CCK++ISESRN+ ALESI++AAK  P   I+N FED  YNR+ YTLVS +  D
Sbjct  1    MLKTILGCCKVYISESRNKSALESIEKAAKFFPLAPIINKFEDVAYNRVGYTLVSEL--D  58

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            + +     C L   V+A+  AA+D ++ E+HSG HPRLGVVD I  HPL  ASLD+AA  
Sbjct  59   SVSSGKSSCDLTNAVLAMVKAAFDNVDFEVHSGTHPRLGVVDHICFHPLVDASLDQAART  118

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA++ G+  +VP +LY  AH
Sbjct  119  ARCLASDMGSSLEVPTFLYGAAH  141



>ref|XP_003543353.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Glycine 
max]
Length=298

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 98/143 (69%), Gaps = 6/143 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S++ CCK++ISESRNR ALESI+RA+K  P   I+N FED  YNR+ YTLVS + H 
Sbjct  1    MLKSIVGCCKVYISESRNRTALESIERASKLFPLAPIINKFEDVTYNRVGYTLVSELGHS  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                    C L  +V+A+  AA+D I+ E+HSG HPRLGVVD I  HPL  ASLD+AA  
Sbjct  61   GP------CHLANSVLAMVKAAFDTIDFEVHSGTHPRLGVVDHICFHPLLDASLDQAANA  114

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP YLY  AH
Sbjct  115  ARCLATDMGSTLQVPTYLYGAAH  137



>ref|XP_009357127.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Pyrus 
x bretschneideri]
Length=458

 Score =   154 bits (390),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 80/150 (53%), Positives = 104/150 (69%), Gaps = 3/150 (2%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            + +E + +++S+L CCK++ISESRNR ALESI+RAAK   E  IVN FED  YNR+ YTL
Sbjct  147  DEQEGEKMLKSMLGCCKVYISESRNRAALESIERAAKLFLEAPIVNKFEDETYNRVGYTL  206

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VS +   A   S   CPL+  V+A+  AA++ I+LE H G+HPRLGVVD I  HPL  AS
Sbjct  207  VSKL---APKPSVDPCPLKMAVLAMVKAAFETIDLESHCGSHPRLGVVDHICFHPLLGAS  263

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            L++ A +A  LAAE G+  QVP +LY  AH
Sbjct  264  LEQVAGVANSLAAEVGSSLQVPTFLYGAAH  293



>ref|XP_008230271.1| PREDICTED: uncharacterized protein LOC103329560 [Prunus mume]
Length=447

 Score =   154 bits (388),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 78/157 (50%), Positives = 105/157 (67%), Gaps = 3/157 (2%)
 Frame = +1

Query  91   KMAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREY  270
            K  + + + +  + +++S+L CCK++ISESRNR ALE I+RAAK   E  IVN FED  Y
Sbjct  134  KQMSYSTDEQGGEKMLKSMLGCCKVYISESRNRAALEGIERAAKLFSEAPIVNKFEDETY  193

Query  271  NRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITV  450
            NR+ YTLVS +   A   S   CPL+  V+A+  AA++ I+LE+H G+HPRLGVVD I  
Sbjct  194  NRVGYTLVSKL---APKPSEDPCPLRMAVLAMVKAAFETIDLEMHCGSHPRLGVVDHICF  250

Query  451  HPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            HPL  ASLD+ A +A  L A+ G+  QVP +LY  AH
Sbjct  251  HPLLGASLDQVAGVANSLGADVGSNLQVPTFLYGAAH  287



>ref|XP_007215438.1| hypothetical protein PRUPE_ppa006201mg [Prunus persica]
 gb|EMJ16637.1| hypothetical protein PRUPE_ppa006201mg [Prunus persica]
Length=422

 Score =   153 bits (386),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 101/145 (70%), Gaps = 3/145 (2%)
 Frame = +1

Query  127  KSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVI  306
            + +++S+L CCK++ISESRNR ALE+I+RAAK   E  IVN FED  YNR+ YTLVS + 
Sbjct  121  EKMLKSMLGCCKVYISESRNRAALEAIERAAKLFSEAPIVNKFEDETYNRVGYTLVSKL-  179

Query  307  HDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
              A   S   CPL+  V+A+  AA++ I+LE+H G+HPRLGVVD I  HPL  ASLD+ A
Sbjct  180  --APKPSEDPCPLRMAVLAMVKAAFETIDLEMHCGSHPRLGVVDHICFHPLLGASLDQVA  237

Query  487  WLAKRLAAEFGNRFQVPVYLYNDAH  561
             +A  L A+ G+  QVP +LY  AH
Sbjct  238  GVANSLGADVGSNLQVPTFLYGAAH  262



>gb|AFK43329.1| unknown [Lotus japonicus]
Length=303

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 101/145 (70%), Gaps = 5/145 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRNR ALESI++AAK  P   IVN FED  YNR+ YTLVS +  D
Sbjct  1    MLKSILGCCKVYISESRNRSALESIEKAAKLFPLAPIVNKFEDVAYNRVGYTLVSQLDLD  60

Query  313  --ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
               +TG    C L+  V+A+  AA+D I+ + H+G HPRLGVVD I  HPLA ASL++AA
Sbjct  61   PVQSTGP---CHLKNAVLAMVKAAFDSIDFQQHTGTHPRLGVVDHICFHPLAEASLNQAA  117

Query  487  WLAKRLAAEFGNRFQVPVYLYNDAH  561
              A+ LA + G+  QVP +LY  AH
Sbjct  118  STARCLAMDMGSNLQVPTFLYGAAH  142



>ref|XP_004487322.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Cicer arietinum]
 ref|XP_004487323.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Cicer arietinum]
Length=301

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRN+ ALESI+RAAK  P   I+N FED  YNR+ YTLVS  +  
Sbjct  1    MLKSILGCCKVYISESRNKSALESIERAAKLFPLAPIINKFEDVAYNRVGYTLVSE-LDS  59

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             ++  P  C L   V+A+  AA++ I+ ELHSG HPR+GVVD I  HPL  ASLD+AA  
Sbjct  60   VSSAQP--CHLTNAVLAMVKAAFENIDFELHSGTHPRVGVVDHICFHPLVDASLDQAART  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP +LY  AH
Sbjct  118  ARCLATDMGSSLQVPTFLYGAAH  140



>ref|XP_006431512.1| hypothetical protein CICLE_v10001997mg [Citrus clementina]
 gb|ESR44752.1| hypothetical protein CICLE_v10001997mg [Citrus clementina]
Length=300

 Score =   150 bits (378),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 74/143 (52%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRN+ ALESI++AAK   E  IVN FED  YNR+ YT+VS +   
Sbjct  1    MLKLMLACCKVYISESRNKAALESIEQAAKLFSEAAIVNKFEDVTYNRVGYTVVSKLAPK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             ++ S    PL+ TV A+  AA++ I+L++HSG+HPRLGVVD I  HPLA A LD+ A +
Sbjct  61   PSSNSH---PLKSTVFAMVKAAFENIDLDMHSGSHPRLGVVDHICFHPLASAPLDQVAEI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA + G+  QVP +LY  AH
Sbjct  118  AKSLAGDIGSDLQVPTFLYGAAH  140



>ref|NP_001242633.1| uncharacterized protein LOC100819129 [Glycine max]
 gb|ACU24134.1| unknown [Glycine max]
Length=298

 Score =   149 bits (376),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S++ CCK++ISESRNR ALESI+RA+K  P   I+N FED  YNR+ YTLVS + H 
Sbjct  1    MLKSIVGCCKVYISESRNRTALESIERASKLFPLAPIINKFEDVAYNRVGYTLVSELGHS  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                    C L   V+A+  AA+D I+ E+H+G HPRLGVVD I  HPL  ASLD AA  
Sbjct  61   GP------CHLSNAVLAMVKAAFDSIDFEVHTGTHPRLGVVDHICFHPLLDASLDHAANA  114

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP YLY  AH
Sbjct  115  ARCLATDMGSTLQVPTYLYGAAH  137



>ref|XP_002319919.2| hypothetical protein POPTR_0013s14200g [Populus trichocarpa]
 gb|EEE95842.2| hypothetical protein POPTR_0013s14200g [Populus trichocarpa]
Length=429

 Score =   151 bits (382),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 101/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRN+ ALESI+RAAK  PE  IVN FED  YNR+ YTLVS +   
Sbjct  131  MLKMMLACCKVYISESRNKVALESIERAAKLFPEAPIVNKFEDVTYNRVGYTLVSSLAPK  190

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +  S   CPL+  V+A+  AA + I+  LH G+HPRLGVVD I  HPLA++SLD+AA +
Sbjct  191  PSLDS---CPLKGVVLAMVKAALETIDFGLHCGSHPRLGVVDHICFHPLAQSSLDQAAGI  247

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA + G+  QVP +LY  A+
Sbjct  248  AKSLAVDAGSSLQVPTFLYGAAN  270



>ref|XP_004306007.1| PREDICTED: uncharacterized protein LOC101302194 [Fragaria vesca 
subsp. vesca]
Length=467

 Score =   152 bits (383),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 77/149 (52%), Positives = 104/149 (70%), Gaps = 3/149 (2%)
 Frame = +1

Query  115  SKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLV  294
            SKE+  +++S+L CCK++ISESRN+ ALESI++AAK   E  +VN FED  YNR+ YTLV
Sbjct  160  SKEEGKMLKSMLGCCKVYISESRNKLALESIEQAAKRFSEAPVVNKFEDETYNRVGYTLV  219

Query  295  SYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASL  474
            S  +    +G P  CPL+  V+A+  AA++ I+LE H G+HPRLGVVD I  HPL  ASL
Sbjct  220  SK-LAPKPSGDP--CPLRMAVLAMVKAAFETIDLESHCGSHPRLGVVDHICFHPLLDASL  276

Query  475  DEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            ++ A +A  LA + G+  QVP +LY  AH
Sbjct  277  EQMAGVANSLAEDVGSSLQVPTFLYGAAH  305



>ref|XP_009630678.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Nicotiana tomentosiformis]
Length=301

 Score =   148 bits (374),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/143 (53%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALESI++AAK  PE  IVN FED  YNR+ YTLVS +  +
Sbjct  1    MLKLMLACCKVYISESRNRAALESIEKAAKLFPEVPIVNKFEDEIYNRVGYTLVSKLYPN  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +T S   CPL+    A+  AA++ I+L+ H G HPRLGVVD +  HPLA  SL+  A  
Sbjct  61   PSTES---CPLKNASFAMVKAAFETIDLQQHCGTHPRLGVVDHVCFHPLAITSLELVAST  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA E G+  QVP YLY  AH
Sbjct  118  AKSLAFEVGSNLQVPTYLYGAAH  140



>gb|KHG15410.1| Formimidoyltransferase-cyclodeaminase [Gossypium arboreum]
Length=299

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 96/142 (68%), Gaps = 3/142 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            ++  +L C K++ISESRNR ALESI+RAAK  PE  IVN F D  YNR+ YT+VS +   
Sbjct  1    MLSKMLACGKVYISESRNRAALESIERAAKLFPEAAIVNKFIDDTYNRVGYTVVSRLTPK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +  S   CPL+  V AI   A + ++ ELHSG HPRLGVVD I  HPLA ASLD+ A +
Sbjct  61   PSQDS---CPLKDAVFAIVKVALETVDFELHSGTHPRLGVVDHICFHPLAHASLDQTAVV  117

Query  493  AKRLAAEFGNRFQVPVYLYNDA  558
            AK LAA+ G++ +VP +LY  A
Sbjct  118  AKSLAADIGSKLKVPTFLYGAA  139



>ref|XP_008379559.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Malus domestica]
 ref|XP_008379560.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Malus domestica]
Length=305

 Score =   147 bits (372),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/143 (54%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRNR ALES++RAAK   E  IVN FED  YNR+ YTLVS +   
Sbjct  1    MLKSMLGCCKVYISESRNRAALESVERAAKLFSEAPIVNKFEDETYNRVGYTLVSTL---  57

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            A   S    PL+  V+A+  AA++ I+LE H G+HPRLGVVD I  HPL  ASL++ A +
Sbjct  58   APKPSVDPSPLKMAVLAMVKAAFETIDLESHCGSHPRLGVVDHICFHPLLGASLEQVAGV  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A  LAAE G+  QVP +LY  AH
Sbjct  118  ANSLAAEVGSSLQVPTFLYGAAH  140



>ref|XP_008379561.1| PREDICTED: uncharacterized protein LOC103442537 isoform X2 [Malus 
domestica]
Length=437

 Score =   150 bits (379),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 78/150 (52%), Positives = 103/150 (69%), Gaps = 3/150 (2%)
 Frame = +1

Query  112  NSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTL  291
            + +E + +++S+L CCK++ISESRNR ALES++RAAK   E  IVN FED  YNR+ YTL
Sbjct  126  DEQEGEKMLKSMLGCCKVYISESRNRAALESVERAAKLFSEAPIVNKFEDETYNRVGYTL  185

Query  292  VSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARAS  471
            VS +   A   S    PL+  V+A+  AA++ I+LE H G+HPRLGVVD I  HPL  AS
Sbjct  186  VSTL---APKPSVDPSPLKMAVLAMVKAAFETIDLESHCGSHPRLGVVDHICFHPLLGAS  242

Query  472  LDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            L++ A +A  LAAE G+  QVP +LY  AH
Sbjct  243  LEQVAGVANSLAAEVGSSLQVPTFLYGAAH  272



>ref|XP_009405645.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Musa acuminata 
subsp. malaccensis]
Length=302

 Score =   146 bits (369),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            + +S+L CCKL+ISESRN  +L  I++AAK  PE V++N F+D  YNR+ YTLVS +  D
Sbjct  1    MFKSMLACCKLYISESRNPTSLALIEQAAKAYPEAVVINKFKDEIYNRVGYTLVSPLTMD  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            + +      PL   V  +  AA++ I+LE HSG HPRLGVVD I  HP+A+ASLD+AA +
Sbjct  61   SLSD---VTPLSNAVFEMVKAAFESIDLETHSGTHPRLGVVDHICFHPMAKASLDQAAGI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK +AA+  ++ QVP YLY  A+
Sbjct  118  AKSVAADISHKLQVPTYLYGAAN  140



>ref|XP_010095821.1| hypothetical protein L484_022177 [Morus notabilis]
 gb|EXB62289.1| hypothetical protein L484_022177 [Morus notabilis]
Length=305

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 74/145 (51%), Positives = 105/145 (72%), Gaps = 2/145 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRNR+ALESI+RAA+  PE  I+N FED  YNR+ YTLVS +  +
Sbjct  1    MLKSMLGCCKVYISESRNRKALESIERAARLIPEAPIINKFEDDTYNRVGYTLVSKLSPE  60

Query  313  -ATTGSPIYCPLQQTVVAIAAAAY-DGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
             +++ S   CPL+  V ++    + + I+LE+HSG+HPRLGVVD +  HPL  ASLD+A+
Sbjct  61   PSSSSSSSSCPLRNAVFSMCRVFHVESIDLEMHSGSHPRLGVVDHVCFHPLLSASLDQAS  120

Query  487  WLAKRLAAEFGNRFQVPVYLYNDAH  561
             +AK LAA+  +  QVP +LY  AH
Sbjct  121  TIAKSLAADVSHALQVPTFLYGAAH  145



>gb|KJB31733.1| hypothetical protein B456_005G205100 [Gossypium raimondii]
Length=468

 Score =   148 bits (374),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 98/145 (68%), Gaps = 3/145 (2%)
 Frame = +1

Query  124  KKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYV  303
            ++ ++  +L C K++ISESRNR ALESI+RAAK  PE  IVN F D  YNR+ YT+VS +
Sbjct  167  EEKMLSKMLACGKVYISESRNRAALESIERAAKLFPEAAIVNKFIDDTYNRVGYTVVSRL  226

Query  304  IHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEA  483
                +  S   CPL+  V AI   A + I+ ELHSG HPRLGVVD I  HPLA ASLD+ 
Sbjct  227  TPKPSQDS---CPLKDAVFAIVKVALETIDFELHSGTHPRLGVVDHICFHPLAHASLDQT  283

Query  484  AWLAKRLAAEFGNRFQVPVYLYNDA  558
            A +AK LAA+ G++ +VP +LY  A
Sbjct  284  AVVAKSLAADIGSKLKVPTFLYGAA  308



>ref|XP_010268811.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X1 [Nelumbo 
nucifera]
Length=301

 Score =   145 bits (365),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 102/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRNR ALESI++AA    E  IVN F+D  YNR+ YTLVS +  +
Sbjct  1    MLKSMLACCKVYISESRNRAALESIEQAALLYREASIVNKFQDETYNRVGYTLVSKLAPN  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +  S     L+  V+++  AA++ INLE HSG+HPRLGVVD I  HPLA+ SL++ A L
Sbjct  61   PSMDS---VSLRGAVLSMVNAAFEAINLESHSGSHPRLGVVDHICFHPLAQTSLEQVALL  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK +AA+ G++ QVP +LY  A+
Sbjct  118  AKTVAADIGSKLQVPTFLYGAAN  140



>emb|CDY13857.1| BnaA09g43590D [Brassica napus]
Length=426

 Score =   147 bits (372),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 79/187 (42%), Positives = 116/187 (62%), Gaps = 5/187 (3%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKELRIEIKPARGKMAAN--NPNSKEKKSVMQSVLLCCKLHISES  180
            +L D  P+++ E + K E++  ++     + A+   P  + ++ + + +L CCK++ISE+
Sbjct  84   ALLDKFPMMDPEDETKDEIKDGLRVKFNIICASLGVPKKQLEEMLRREMLGCCKVYISEA  143

Query  181  RNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVV  360
            RN+ ALE+I+R+AK  P   IVN FED  Y R+ YTLVS + H+   GS    PL+  V 
Sbjct  144  RNKTALEAIERSAKTFPPAAIVNKFEDAAYGRVGYTLVSALAHE---GSSSSSPLKSAVF  200

Query  361  AIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPV  540
            A+   A D INLELH G+HPRLGVVD I  HPL   S+D+ + +A  LA + G+  +VP 
Sbjct  201  AMVKTALDAINLELHCGSHPRLGVVDHICFHPLYETSIDQVSSVATSLARDIGSILRVPT  260

Query  541  YLYNDAH  561
            YLY  AH
Sbjct  261  YLYGAAH  267



>ref|XP_011045516.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Populus 
euphratica]
Length=464

 Score =   147 bits (371),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 99/143 (69%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRN+ ALESI+RAAK  PE  IVN FED  YNR+ YTLVS +   
Sbjct  166  MLKMMLACCKVYISESRNKVALESIERAAKLFPEAPIVNKFEDVTYNRVGYTLVSSLAPK  225

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +  S   C L+  V+A+  AA + I+  LH G+HPRLGVVD I  HPLA++SLD+AA +
Sbjct  226  PSLDS---CALKGAVLAMVKAALETIDFGLHCGSHPRLGVVDHICFHPLAQSSLDQAAGI  282

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA + G   QVP +LY  A+
Sbjct  283  AKSLAVDVGCSLQVPTFLYGAAN  305



>ref|XP_011085950.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085951.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085952.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085953.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085954.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085955.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085956.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085957.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085958.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
 ref|XP_011085959.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Sesamum 
indicum]
Length=300

 Score =   143 bits (361),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 95/143 (66%), Gaps = 5/143 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L C K+++SESRNR ALE+++RAAK  P   IVN FED  YNR+ YTLVS +  +
Sbjct  1    MLKQMLACSKVYVSESRNRAALEAVERAAKLFPAAPIVNKFEDVTYNRVGYTLVSEMGEN  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                 P  CPL+  V+ +  AA+  I+L++H G+HPRLGVVD I  HPLA  SLD  A  
Sbjct  61   -----PSSCPLKNAVLEMVKAAFQAIDLQMHCGSHPRLGVVDHICFHPLAGVSLDHVAGT  115

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LAA+ G+  QV  +LY  AH
Sbjct  116  AKSLAADVGSGLQVATFLYGAAH  138



>ref|XP_006447368.1| hypothetical protein CICLE_v10017445mg [Citrus clementina]
 gb|ESR60608.1| hypothetical protein CICLE_v10017445mg [Citrus clementina]
Length=424

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 79/177 (45%), Positives = 112/177 (63%), Gaps = 5/177 (3%)
 Frame = +1

Query  34   NQEVKEKKE-LRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQ  210
            N+ V+E  E LR++ +  R            +K +++ +L CCK++ISES+N+ ALESI+
Sbjct  108  NESVQEIMEALRLKFRIIRAAFGVKLEYDGWRK-MLKLMLTCCKVYISESQNKAALESIE  166

Query  211  RAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGI  390
            +AA+     +IVN FED  YNR+ YT+VS +   A T S   CPL+ TV A+  AA++ I
Sbjct  167  QAARLFSAAIIVNKFEDVTYNRVGYTVVSKL---APTLSSDSCPLKSTVFAMIKAAFENI  223

Query  391  NLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
               +HSG+HPRLGVVD I  HPLA A LD+ A +AK +  + G+  QVP +LY  AH
Sbjct  224  EPGMHSGSHPRLGVVDHICFHPLASAPLDQVAGIAKSVVGDIGSGLQVPTFLYGAAH  280



>ref|XP_008448205.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X2 [Cucumis 
melo]
Length=427

 Score =   145 bits (367),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 82/178 (46%), Positives = 110/178 (62%), Gaps = 7/178 (4%)
 Frame = +1

Query  34   NQEVKEKKE-LRIEIKPARGKMAAN-NPNSKEKKSVMQSVLLCCKLHISESRNREALESI  207
            N++V+E  E LR++ +     +      N K K S +  +L CCK++ISESRN+ ALESI
Sbjct  96   NEQVQELMEGLRLKFRAISATLGVKLEYNVKRKMSKL--ILACCKVYISESRNKAALESI  153

Query  208  QRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDG  387
            +RA K  P+  I+N F D  YNR+ YTLVS +    +  S   C L   V+ +  AA+  
Sbjct  154  ERATKLFPDAPIINKFTDEVYNRVGYTLVSKLPSQPSGKS---CSLISAVLNMVKAAFSA  210

Query  388  INLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            I+   H G+HPRLGVVD I  HPLA ASL++AA +AK LAA+ G R QVP +LY  AH
Sbjct  211  IDFNSHCGSHPRLGVVDHICFHPLASASLEDAALIAKYLAADVGYRLQVPTFLYGAAH  268



>ref|XP_008448202.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X1 [Cucumis 
melo]
 ref|XP_008448204.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X1 [Cucumis 
melo]
Length=299

 Score =   143 bits (360),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 92/139 (66%), Gaps = 3/139 (2%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +L CCK++ISESRN+ ALESI+RA K  P+  I+N F D  YNR+ YTLVS +    +  
Sbjct  5    ILACCKVYISESRNKAALESIERATKLFPDAPIINKFTDEVYNRVGYTLVSKLPSQPSGK  64

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            S   C L   V+ +  AA+  I+   H G+HPRLGVVD I  HPLA ASL++AA +AK L
Sbjct  65   S---CSLISAVLNMVKAAFSAIDFNSHCGSHPRLGVVDHICFHPLASASLEDAALIAKYL  121

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G R QVP +LY  AH
Sbjct  122  AADVGYRLQVPTFLYGAAH  140



>ref|XP_006841770.1| hypothetical protein AMTR_s00003p00265230 [Amborella trichopoda]
 gb|ERN03445.1| hypothetical protein AMTR_s00003p00265230 [Amborella trichopoda]
Length=296

 Score =   143 bits (360),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 76/142 (54%), Positives = 96/142 (68%), Gaps = 9/142 (6%)
 Frame = +1

Query  139  QSVLLCCKLHISESRNREALESIQRAAK-HDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            QS+L CCKL+ISESRN  AL+SI+RAAK   P+  IVN F+D  YNR+ YTLV  +   +
Sbjct  4    QSLLACCKLYISESRNASALDSIERAAKPFHPQAAIVNKFQDLPYNRVGYTLVGQI---S  60

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G+     L +  +A+  AA+  INLE H+G+HPRLGVVD I  HPLA ASL++A  LA
Sbjct  61   ALGA-----LHRAALAMVEAAFRVINLESHTGSHPRLGVVDHICFHPLAEASLEDATRLA  115

Query  496  KRLAAEFGNRFQVPVYLYNDAH  561
            +  A E GN+ QVP YLY  AH
Sbjct  116  RSAANELGNKLQVPTYLYGAAH  137



>ref|XP_010268812.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X2 [Nelumbo 
nucifera]
Length=437

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 102/143 (71%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCK++ISESRNR ALESI++AA    E  IVN F+D  YNR+ YTLVS +  +
Sbjct  137  MLKSMLACCKVYISESRNRAALESIEQAALLYREASIVNKFQDETYNRVGYTLVSKLAPN  196

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +  S     L+  V+++  AA++ INLE HSG+HPRLGVVD I  HPLA+ SL++ A L
Sbjct  197  PSMDS---VSLRGAVLSMVNAAFEAINLESHSGSHPRLGVVDHICFHPLAQTSLEQVALL  253

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK +AA+ G++ QVP +LY  A+
Sbjct  254  AKTVAADIGSKLQVPTFLYGAAN  276



>ref|XP_009763293.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Nicotiana sylvestris]
Length=301

 Score =   142 bits (357),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/143 (52%), Positives = 95/143 (66%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L C K++ISESRNR ALESI++AAK  PE  IVN FED  YNR+ YTLVS +  +
Sbjct  1    MLKLMLACGKVYISESRNRAALESIEKAAKLFPEAPIVNKFEDEIYNRVGYTLVSKLSPN  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             +T S   CPL+     +  AA++ I+L+ H G HPRLGVVD I  HPLA  SL+  A  
Sbjct  61   PSTES---CPLKNASFEMVKAAFETIDLQQHCGTHPRLGVVDHICFHPLAITSLELVAST  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA E G+  QVP YLY  AH
Sbjct  118  AKSLAFEVGSNLQVPTYLYGAAH  140



>ref|XP_006409020.1| hypothetical protein EUTSA_v10001991mg [Eutrema salsugineum]
 gb|ESQ50473.1| hypothetical protein EUTSA_v10001991mg [Eutrema salsugineum]
Length=431

 Score =   144 bits (363),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 79/190 (42%), Positives = 117/190 (62%), Gaps = 10/190 (5%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKELRIEIKPARGKMAANNPNSKEK-----KSVMQSVLLCCKLHI  171
            +L D  PLL+ E + K EL+ +++     + A+   SK++     + + + +L CCK++I
Sbjct  87   ALLDKFPLLDPEDESKDELKDDLRVKFNIICASLGISKKQLVWSEEMLRREMLGCCKVYI  146

Query  172  SESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQ  351
            SE+RN+ ALE+I+RAAK  P   IVN FED  Y R+ YTLVS + H  ++      PL+ 
Sbjct  147  SEARNKTALEAIERAAKPFPPAAIVNKFEDLAYGRVGYTLVSTLAHGGSS-----SPLKN  201

Query  352  TVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQ  531
             V A+   A D INL+LH G+HPRLGVVD I  HPL+  S+++ + +A  LA + G+  +
Sbjct  202  AVFAMVKTALDTINLDLHRGSHPRLGVVDHICFHPLSHTSIEQVSAVANALAMDIGSILR  261

Query  532  VPVYLYNDAH  561
            VP YLY  A 
Sbjct  262  VPTYLYGAAQ  271



>ref|XP_010540856.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Tarenaya hassleriana]
 ref|XP_010540857.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Tarenaya hassleriana]
 ref|XP_010540858.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Tarenaya hassleriana]
 ref|XP_010540859.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Tarenaya hassleriana]
Length=299

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 71/142 (50%), Positives = 94/142 (66%), Gaps = 3/142 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISE RN+ ALE+I+RAAK  P   IVN FED  Y R+ YT+VS + H+
Sbjct  1    MLRQLLGCCKVYISEGRNKMALEAIERAAKLFPPAAIVNKFEDVSYGRVGYTVVSRLAHE  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                 P    L+    A+  AA D I+LELHSG+HPRLGVVD I  HPL + S++E A +
Sbjct  61   P---DPDSSSLKNAAFAMVKAALDTIDLELHSGSHPRLGVVDHICFHPLGQTSMEEVAAI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDA  558
            AK LA + G+  QVP YLY  A
Sbjct  118  AKSLAIDIGSVLQVPTYLYGAA  139



>ref|XP_008680942.1| PREDICTED: uncharacterized protein LOC100191169 isoform X1 [Zea 
mays]
Length=328

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/163 (43%), Positives = 110/163 (67%), Gaps = 8/163 (5%)
 Frame = +1

Query  100  ANNPNSKEKKSVMQ-SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNR  276
            AN P  + K S  + S  + CKL+ISESRN  A+++++RA+K DP+ V+V+ F D  YNR
Sbjct  6    ANKPKPRPKLSATKHSKFISCKLYISESRNATAVDAVERASKSDPQVVVVSQFGDHHYNR  65

Query  277  INYTLVSYVIHDATTGSP-------IYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVV  435
              YTLVSY++     GS        ++ P+++ ++A+  AA+  I+LE  SGAHPR+GVV
Sbjct  66   FRYTLVSYIVVVDGGGSSAAGEATVVHSPIRKVLLAMIEAAFSSIDLESQSGAHPRIGVV  125

Query  436  DDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            DD++ HP+ +A++++AA LA+++A++      VPV+LY  AHP
Sbjct  126  DDLSFHPVGQATIEDAASLARQVASDIACIAAVPVFLYAAAHP  168



>ref|XP_010693555.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010693556.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Beta vulgaris 
subsp. vulgaris]
Length=303

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 69/143 (48%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++  L CCKL+ISESRN+ ALESI+RAAK   E  ++N FED  YNR+ YTLVS +   
Sbjct  1    MLKMTLACCKLYISESRNKAALESIERAAKLFHEAKLINKFEDETYNRVGYTLVSKLPPK  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
              +G   + PL+    A+  +AY  I+  +HSG+HPRLGVVD I +HPLA A+ ++ A +
Sbjct  61   LPSG---FFPLKDAPFAMVESAYKAIDFNVHSGSHPRLGVVDHICLHPLANATSEQTANI  117

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G + +VPV+LY  AH
Sbjct  118  ARSLARDIGTKLEVPVFLYGAAH  140



>ref|XP_009117467.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Brassica 
rapa]
Length=436

 Score =   142 bits (359),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 80/197 (41%), Positives = 116/197 (59%), Gaps = 15/197 (8%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKELRIEIKPARGKMAAN-NPNSK-----------EKKSVMQSVL  150
            +L D  P+++ E + K E++  ++     + A+  P  K           E++ + + +L
Sbjct  84   ALLDKFPMMDPEDETKDEIKDGLRVKFNIICASLGPTKKAFILFVYLSWSEEEMLRREML  143

Query  151  LCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSP  330
             CCK++ISE+RN+ ALE+I+R+AK  P   IVN FED  Y R+ YTLVS + H+   GS 
Sbjct  144  GCCKVYISEARNKTALEAIERSAKTFPPAAIVNKFEDAAYGRVGYTLVSALAHE---GSS  200

Query  331  IYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAA  510
               PL+  V A+   A D INLE H G+HPRLGVVD I  HPL   S+D+ + +A  LA 
Sbjct  201  SSSPLKSAVFAMVKTALDAINLESHCGSHPRLGVVDHICFHPLYETSIDQVSSVATSLAR  260

Query  511  EFGNRFQVPVYLYNDAH  561
            + G+  +VP YLY  AH
Sbjct  261  DIGSILRVPTYLYGAAH  277



>ref|XP_007149888.1| hypothetical protein PHAVU_005G107300g [Phaseolus vulgaris]
 ref|XP_007149889.1| hypothetical protein PHAVU_005G107300g [Phaseolus vulgaris]
 gb|ESW21882.1| hypothetical protein PHAVU_005G107300g [Phaseolus vulgaris]
 gb|ESW21883.1| hypothetical protein PHAVU_005G107300g [Phaseolus vulgaris]
Length=298

 Score =   140 bits (352),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 73/143 (51%), Positives = 96/143 (67%), Gaps = 6/143 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S++ CCK++ISESRNR ALESI+ A+K  P   I+N FED  YNR+ YTLVS    +
Sbjct  1    MLKSIVGCCKVYISESRNRIALESIEGASKLFPLAPIINKFEDVAYNRVGYTLVS----E  56

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                 P +  L   V+A+  A++D I+ E+HSG HPRLGVVD I  HPL  ASLD+AA  
Sbjct  57   LDLSGPSH--LANAVLAMVKASFDTIDFEVHSGTHPRLGVVDHICFHPLLDASLDQAATT  114

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LA + G+  QVP YLY  AH
Sbjct  115  ARCLAMDMGSNLQVPTYLYGAAH  137



>ref|XP_003608611.1| Formimidoyltransferase-cyclodeaminase [Medicago truncatula]
Length=268

 Score =   139 bits (349),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/134 (50%), Positives = 94/134 (70%), Gaps = 2/134 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++++L CCK++ISESRN+ ALESI++AAK  P   I+N FED  YNR+ YTLVS +  D
Sbjct  112  MLKTILGCCKVYISESRNKSALESIEKAAKFFPLAPIINKFEDVAYNRVGYTLVSEL--D  169

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            + +     C L   V+A+  AA+D ++ E+HSG HPRLGVVD I  HPL  ASLD+AA  
Sbjct  170  SVSSGKSSCDLTNAVLAMVKAAFDNVDFEVHSGTHPRLGVVDHICFHPLVDASLDQAART  229

Query  493  AKRLAAEFGNRFQV  534
            A+ LA++ G+  +V
Sbjct  230  ARCLASDMGSSLEV  243



>gb|ACG48197.1| glutamate formiminotransferase [Zea mays]
Length=332

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/167 (41%), Positives = 108/167 (65%), Gaps = 12/167 (7%)
 Frame = +1

Query  100  ANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRI  279
            AN P  + K S   S  + CKL+ISESRN  A+++++RA+K DP+ V+V+ F D  YNR 
Sbjct  6    ANKPKPRPKLSAKHSKFISCKLYISESRNATAVDAVERASKSDPQVVVVSQFGDHHYNRF  65

Query  280  NYTLVSYVIHDATTGSP------------IYCPLQQTVVAIAAAAYDGINLELHSGAHPR  423
             YTLVSY++ D                  ++ P+++ ++A+  AA+  I+LE  SGAHPR
Sbjct  66   RYTLVSYIVVDDDGVDGGGGSSAAGEAIVVHSPIRKVLLAMMEAAFSSIDLESQSGAHPR  125

Query  424  LGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            +GVVDD++ HP+ +A++++AA LA+++A++      VPV+LY  AHP
Sbjct  126  MGVVDDLSFHPVGQATVEDAASLARQVASDIACIAAVPVFLYAAAHP  172



>ref|NP_001130076.1| uncharacterized protein LOC100191169 [Zea mays]
 gb|ACF78198.1| unknown [Zea mays]
 gb|ACF78879.1| unknown [Zea mays]
 gb|AFW68280.1| glutamate formiminotransferase [Zea mays]
Length=326

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 8/162 (5%)
 Frame = +1

Query  100  ANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRI  279
            AN P  K   +   S  + CKL+ISESRN  A+++++RA+K DP+ V+V+ F D  YNR 
Sbjct  6    ANKPRPK-LSATKHSKFISCKLYISESRNATAVDAVERASKSDPQVVVVSQFGDHHYNRF  64

Query  280  NYTLVSYVIHDATTGSP-------IYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVD  438
             YTLVSY++     GS        ++ P+++ ++A+  AA+  I+LE  SGAHPR+GVVD
Sbjct  65   RYTLVSYIVVVDGGGSSAAGEATVVHSPIRKVLLAMIEAAFSSIDLESQSGAHPRIGVVD  124

Query  439  DITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            D++ HP+ +A++++AA LA+++A++      VPV+LY  AHP
Sbjct  125  DLSFHPVGQATIEDAASLARQVASDIACIAAVPVFLYAAAHP  166



>gb|ACL52709.1| unknown [Zea mays]
Length=326

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 69/162 (43%), Positives = 108/162 (67%), Gaps = 8/162 (5%)
 Frame = +1

Query  100  ANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRI  279
            AN P  K   +   S  + CKL+ISESRN  A+++++RA+K DP+ V+V+ F D  YNR 
Sbjct  6    ANKPRPK-LSATKHSKFISCKLYISESRNATAVDAVERASKSDPQVVVVSQFGDHHYNRF  64

Query  280  NYTLVSYVIHDATTGSP-------IYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVD  438
             YTLVSY++     GS        ++ P+++ ++A+  AA+  I+LE  SGAHPR+GVVD
Sbjct  65   RYTLVSYIVVVDGGGSSAAGEATVVHSPIRKVLLAMIEAAFSSIDLESQSGAHPRIGVVD  124

Query  439  DITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAHP  564
            D++ HP+ +A++++AA LA+++A++      VPV+LY  AHP
Sbjct  125  DLSFHPVGQATIEDAASLARQVASDIACIAAVPVFLYAAAHP  166



>emb|CDP14715.1| unnamed protein product [Coffea canephora]
Length=299

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 91/139 (65%), Gaps = 5/139 (4%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            +L CCK+++SESRN+ ALE+I+RAAK  PE  I+N FED  YNR+ YTLVS +       
Sbjct  5    MLSCCKVYVSESRNKAALEAIERAAKLFPEAPIINKFEDEIYNRVGYTLVSKL-----GS  59

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
             P   PL+  V A+  AA+  I+L  HSG+HPRLGVVD I  HPL   SL++ A  A  L
Sbjct  60   KPSSDPLKGAVFAMVEAAFQSIDLGAHSGSHPRLGVVDHICFHPLESTSLEQVAGTANAL  119

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+  +VP +LY  AH
Sbjct  120  AADVGSNLKVPTFLYGAAH  138



>gb|KGN46693.1| hypothetical protein Csa_6G124080 [Cucumis sativus]
Length=299

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/138 (51%), Positives = 90/138 (65%), Gaps = 3/138 (2%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L CCK++ISESRN+ ALESI+RA K  P+  I+N F D  YNR+ YTLVS +    +  S
Sbjct  6    LACCKVYISESRNKAALESIERATKLFPDAPIINKFTDEVYNRVGYTLVSKLPSHLSGKS  65

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
               C L   V+ +  AA+  I+   H G+HPRLGVVD I  HPLA A+L++AA +AK LA
Sbjct  66   ---CSLISAVLNMVKAAFSAIDFNSHCGSHPRLGVVDHICFHPLASATLEDAALIAKYLA  122

Query  508  AEFGNRFQVPVYLYNDAH  561
            A+ G   QVP +LY  AH
Sbjct  123  ADVGYSLQVPTFLYGAAH  140



>gb|EYU26109.1| hypothetical protein MIMGU_mgv1a010739mg [Erythranthe guttata]
Length=303

 Score =   138 bits (347),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 72/139 (52%), Positives = 94/139 (68%), Gaps = 1/139 (1%)
 Frame = +1

Query  145  VLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            V+ CCK++ISESRN+ ALE+I+RAAK  PE  I+N FED  YNR+ YTLVS +  + ++ 
Sbjct  2    VVGCCKVYISESRNKAALEAIERAAKLFPEAPIINKFEDPTYNRVGYTLVSKLGPNPSS-  60

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            S   C L+  V+ +  AA+  I+LE H G HPRLGVVD I  HPL+ AS+D  A  AK L
Sbjct  61   SSSPCTLKGAVLEMVKAAFAAIDLEKHRGTHPRLGVVDHICFHPLSGASVDHVAGTAKSL  120

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+  QV  +LY  AH
Sbjct  121  AADVGSSLQVATFLYGAAH  139



>emb|CDX81982.1| BnaC08g36190D [Brassica napus]
Length=426

 Score =   140 bits (352),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 81/188 (43%), Positives = 114/188 (61%), Gaps = 7/188 (4%)
 Frame = +1

Query  7    SLSDSSPLLNQEVKEKKELRIEIKPARGKMAAN--NPNSKEKKSVMQSVLLCCKLHISES  180
            +L D  PLL+ E + K E++  ++     + A+   P  + ++   + +L CCK++ISE+
Sbjct  84   ALLDKFPLLDPEDESKDEIKDSLRVKFNIICASLGVPKKQLEEMWRREMLGCCKVYISEA  143

Query  181  RNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTV  357
            RN+ ALE+I+ AAKH  P   IVN FED  Y R+ YTLVS  + DA + S    PL+  V
Sbjct  144  RNKTALEAIEIAAKHYFPPAAIVNKFEDAAYGRVGYTLVS-ALADAGSSSS---PLKSAV  199

Query  358  VAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVP  537
             A+   A D INLE H G+HPRLGVVD I  HPL   S+D+ + +A  LA + G+  +VP
Sbjct  200  FAMVKTALDAINLESHCGSHPRLGVVDHICFHPLYETSIDQVSSVATSLARDIGSILRVP  259

Query  538  VYLYNDAH  561
             YLY  AH
Sbjct  260  TYLYGAAH  267



>ref|XP_006357513.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Solanum 
tuberosum]
Length=303

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/143 (50%), Positives = 93/143 (65%), Gaps = 1/143 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALESI++AAK  PE+ IVN FED  YNR+ YTLVS  I  
Sbjct  1    MLKLMLACCKVYISESRNRGALESIEKAAKLFPESPIVNKFEDEIYNRVGYTLVSK-ISP  59

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             ++      PL+    A+  AA++ I+L+ H G HPRLGVVD I  HPL   SLD  A  
Sbjct  60   NSSSGSCSLPLKNASFAMVKAAFETIDLQEHCGTHPRLGVVDHICFHPLGTTSLDMVADT  119

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA E G+  +VP +LY  A 
Sbjct  120  AKSLAFEVGSNLKVPTFLYGAAQ  142



>ref|XP_004139960.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Cucumis 
sativus]
 ref|XP_004154536.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Cucumis 
sativus]
Length=427

 Score =   139 bits (351),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 77/177 (44%), Positives = 107/177 (60%), Gaps = 5/177 (3%)
 Frame = +1

Query  34   NQEVKEKKE-LRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQ  210
            N++V+E  E LR++ +     +         K+ + +  L CCK++ISESRN+ ALESI+
Sbjct  96   NEQVQELMEGLRLKFRAVSATLGVK-LEYHVKRKMSKLFLACCKVYISESRNKAALESIE  154

Query  211  RAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGI  390
            RA K  P+  I+N F D  YNR+ YTLVS +    +  S   C L   V+ +  AA+  I
Sbjct  155  RATKLFPDAPIINKFTDEVYNRVGYTLVSKLPSHLSGKS---CSLISAVLNMVKAAFSAI  211

Query  391  NLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            +   H G+HPRLGVVD I  HPLA A+L++AA +AK LAA+ G   QVP +LY  AH
Sbjct  212  DFNSHCGSHPRLGVVDHICFHPLASATLEDAALIAKYLAADVGYSLQVPTFLYGAAH  268



>gb|EPS60854.1| hypothetical protein M569_13945, partial [Genlisea aurea]
Length=293

 Score =   136 bits (343),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 95/143 (66%), Gaps = 5/143 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ ++ CCK++ISESRN  ALE I+  AK  PE  IVN FED  YNR+ YTLVS    +
Sbjct  1    MLKRMVACCKVYISESRNAAALEIIESGAKLHPEVAIVNKFEDAIYNRVGYTLVS---GE  57

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             TT  P +  L+ +V  +  AA+  I+LE H G+HPRLGVVD I  HPLA  SLD+ + +
Sbjct  58   GTT--PRFSSLRNSVFEMVKAAFAAIDLEKHCGSHPRLGVVDHICFHPLAGISLDQVSEI  115

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            A+ LAA+ G++ QV  +LY  AH
Sbjct  116  ARVLAADLGSKLQVATFLYGAAH  138



>gb|KHN04280.1| Formimidoyltransferase-cyclodeaminase [Glycine soja]
Length=353

 Score =   137 bits (344),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 71/134 (53%), Positives = 88/134 (66%), Gaps = 6/134 (4%)
 Frame = +1

Query  160  KLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYC  339
            +++ISESRNR ALESI+RA+K  P   I+N FED  YNR+ YTLVS + H         C
Sbjct  65   EVYISESRNRTALESIERASKLFPLAPIINKFEDVAYNRVGYTLVSELGHSGP------C  118

Query  340  PLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFG  519
             L   V+A+  AA+D I+ E+H+G HPRLGVVD I  HPL  ASLD AA  A+ LA + G
Sbjct  119  HLSNAVLAMVKAAFDSIDFEVHTGTHPRLGVVDHICFHPLLDASLDHAANAARCLATDMG  178

Query  520  NRFQVPVYLYNDAH  561
            +  QVP YLY  AH
Sbjct  179  STLQVPTYLYGAAH  192



>ref|XP_006471003.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Citrus 
sinensis]
Length=322

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/149 (46%), Positives = 100/149 (67%), Gaps = 3/149 (2%)
 Frame = +1

Query  94   MAANNPNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYN  273
            +  N   + +++ + + +L CCK++ISESRN+ ALESI++AAK   E  IVN FED  YN
Sbjct  10   LLCNWWQAAKRRKMSKLMLACCKVYISESRNKAALESIEQAAKLFSEAAIVNKFEDVTYN  69

Query  274  RINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVH  453
            R+ YT+VS +    ++ S    PL+ TV A+  AA++ I+L++HSG+HPRLGVVD I  H
Sbjct  70   RVGYTVVSKLAPKPSSNSH---PLKSTVFAMVKAAFENIDLDMHSGSHPRLGVVDHICFH  126

Query  454  PLARASLDEAAWLAKRLAAEFGNRFQVPV  540
            PLA A L + A +AK LA + G+  QV +
Sbjct  127  PLASAPLGQVAKIAKSLAGDIGSDLQVSL  155



>emb|CCH47206.1| similar to formimidoyltransferase-cyclodeaminase-like [Lupinus 
angustifolius]
Length=384

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/149 (50%), Positives = 97/149 (65%), Gaps = 7/149 (5%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++S+L CCKL+ISESRN+ ALESI+RA+K  P   IVN FED  YNR+ YTLVS +  +
Sbjct  1    MLKSILGCCKLYISESRNKSALESIERASKLFPNAPIVNKFEDVVYNRVGYTLVSELHPN  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
                S   C L   V+A+  AA++ I+ ELHSG HPRLGVVD I  HPLA ASLD AA  
Sbjct  61   PALPSSEPCHLISAVLAMVKAAFETIDFELHSGTHPRLGVVDHICFHPLADASLDHAAET  120

Query  493  AKRLAAEFGNRFQVPV-------YLYNDA  558
            A+ LA + G+  +  V       +L+N A
Sbjct  121  ARCLATDMGSSLKGKVLSRCLLFFLWNYA  149



>ref|XP_004243328.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Solanum 
lycopersicum]
Length=303

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 70/143 (49%), Positives = 92/143 (64%), Gaps = 1/143 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISESRNR ALESI++AAK  PE+ I+N FED  YNR+ YTLVS  I  
Sbjct  1    MLKLMLACCKVYISESRNRGALESIEKAAKLFPESPIINKFEDEIYNRVGYTLVSK-ISP  59

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
             ++       L+    A+  AA++ I+L+ H G HPRLGVVD I  HPL   SLD  A  
Sbjct  60   NSSSGSCSLTLKNASFAMVKAAFETIDLQEHCGTHPRLGVVDHICFHPLGTTSLDMVADT  119

Query  493  AKRLAAEFGNRFQVPVYLYNDAH  561
            AK LA E G+  +VP +LY  A 
Sbjct  120  AKTLAFEVGSNLKVPTFLYGAAQ  142



>ref|XP_006299212.1| hypothetical protein CARUB_v10015359mg [Capsella rubella]
 gb|EOA32110.1| hypothetical protein CARUB_v10015359mg [Capsella rubella]
Length=435

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 75/179 (42%), Positives = 112/179 (63%), Gaps = 6/179 (3%)
 Frame = +1

Query  25   PLLNQEVKEKKELRIEIKPARGKMAAN-NPNSKEKKSVMQSVLLCCKLHISESRNREALE  201
            PLL+ E + K  ++ +++     + A+     K+ + +++ +L CCK++ISE+RN+ ALE
Sbjct  97   PLLDPEDEAKDGIKDDLRVKFNIICASLGIPKKQLEEMLREMLGCCKVYISEARNKTALE  156

Query  202  SIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAY  381
            +I+RA K  P   IVN FED  Y R+ YT+VS +    ++      PL+  V A+   A 
Sbjct  157  AIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLASSGSS-----SPLKNAVFAMVKTAL  211

Query  382  DGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYNDA  558
            D INLELHSG+HPRLGVVD I  HPL++ SLD+ + +A  LA + G+  +VP YLY  A
Sbjct  212  DTINLELHSGSHPRLGVVDHICFHPLSQTSLDQVSSVANSLAMDIGSILRVPTYLYGAA  270



>gb|KDO43789.1| hypothetical protein CISIN_1g039996mg [Citrus sinensis]
Length=241

 Score =   129 bits (325),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/133 (49%), Positives = 91/133 (68%), Gaps = 3/133 (2%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISES+N+ ALESI++AA+     +IVN FED  YNR+ YT+VS +   
Sbjct  1    MLKLMLTCCKVYISESQNKAALESIEQAARLFSAAIIVNKFEDVTYNRVGYTVVSKL---  57

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            A T S   CPL+ TV A+  AA++ I   +HSG+HPRLGVVD I  HPLA A LD+ A +
Sbjct  58   APTLSSDSCPLKSTVFAMIKAAFENIEPGMHSGSHPRLGVVDHICFHPLASAPLDQVAGI  117

Query  493  AKRLAAEFGNRFQ  531
            AK +  + G+  Q
Sbjct  118  AKSVVGDIGSGLQ  130



>gb|AFW86110.1| formiminotransferase-like protein [Zea mays]
Length=301

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +   A   
Sbjct  8    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPLAGGAA--  65

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            SP   PL+     + AAA + ++L+ H+GAHPRLGVVD I  HPLA A L++   LA+ +
Sbjct  66   SP---PLRCAAFRVVAAAIEAVDLDAHAGAHPRLGVVDHIAFHPLASARLEDVTALARAV  122

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+R QVP YLY  AH
Sbjct  123  AADIGDRLQVPTYLYGAAH  141



>ref|NP_001148236.1| formiminotransferase-like [Zea mays]
 gb|ACG30254.1| formiminotransferase-like [Zea mays]
Length=301

 Score =   130 bits (328),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/139 (50%), Positives = 90/139 (65%), Gaps = 6/139 (4%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +   A   
Sbjct  8    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPLAGGAA--  65

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            SP   PL+     + AAA + ++L+ H+GAHPRLGVVD I  HPLA A L++   LA+ +
Sbjct  66   SP---PLRCAAFRVVAAAIEAVDLDAHAGAHPRLGVVDHIAFHPLASARLEDVTALARAV  122

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+R QVP YLY  AH
Sbjct  123  AADIGDRLQVPTYLYGAAH  141



>ref|XP_010474973.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Camelina sativa]
Length=435

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 110/182 (60%), Gaps = 10/182 (5%)
 Frame = +1

Query  25   PLLN--QEVKE--KKELRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISESRNRE  192
            PLL+   E K+  K  LR++       +  +    +  + +++ +L CCK++ISE+RN+ 
Sbjct  95   PLLDPEDEAKDRIKDHLRVKFNIICASLGVSKKQLEWSEEMLREMLGCCKVYISEARNKT  154

Query  193  ALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAA  372
            ALE+I+RA K  P   IVN FED  Y R+ YT+VS +   +++       L+  V A+  
Sbjct  155  ALEAIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLATGSSS------SLKNAVFAMVK  208

Query  373  AAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYN  552
             A D INLELHSG+HPRLGVVD I  HPL++ S+++ + +A  LA + G+  +VP YLY 
Sbjct  209  TALDTINLELHSGSHPRLGVVDHICFHPLSQTSIEQVSSVANSLAMDIGSTLRVPTYLYG  268

Query  553  DA  558
             A
Sbjct  269  AA  270



>ref|XP_010467763.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Camelina 
sativa]
Length=435

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/182 (40%), Positives = 110/182 (60%), Gaps = 10/182 (5%)
 Frame = +1

Query  25   PLLN--QEVKE--KKELRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISESRNRE  192
            PLL+   E K+  K  LR++       +  +    +  + +++ +L CCK++ISE+RN+ 
Sbjct  95   PLLDPEDEAKDRIKDHLRVKFNIICASLGVSKKQLEWSEEMLREMLGCCKVYISEARNKT  154

Query  193  ALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAA  372
            ALE+I+RA K  P   IVN FED  Y R+ YT+VS +   +++       L+  V A+  
Sbjct  155  ALEAIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLATGSSS------SLKNAVFAMVK  208

Query  373  AAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLYN  552
             A D INLELHSG+HPRLGVVD I  HPL++ S+++ + +A  LA + G+  +VP YLY 
Sbjct  209  TALDTINLELHSGSHPRLGVVDHICFHPLSQTSIEQVSSVANSLAMDIGSTLRVPTYLYG  268

Query  553  DA  558
             A
Sbjct  269  AA  270



>ref|XP_004964370.1| PREDICTED: uncharacterized protein LOC101767576 [Setaria italica]
Length=344

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 67/145 (46%), Positives = 91/145 (63%), Gaps = 4/145 (3%)
 Frame = +1

Query  130  SVMQSVLLCCKLHISESRNREALESIQRAAKHDPET-VIVNIFEDREYNRINYTLVSYVI  306
            ++++  L CCKL+ISE+RN  AL +I+RAA       V+VN F D  YNR+ YTLV+ + 
Sbjct  39   TMLRPALACCKLYISEARNAPALRAIERAAAAQSPAAVLVNAFADDAYNRVGYTLVAPLT  98

Query  307  HDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
                 G P   PL +    + AAA + ++   H+GAHPRLGVVD I  HPLA A LD+ A
Sbjct  99   ---GGGDPAPPPLHRAAFGVVAAALEAVDFGAHAGAHPRLGVVDHIAFHPLAGARLDDVA  155

Query  487  WLAKRLAAEFGNRFQVPVYLYNDAH  561
             L + +AA+ G++ QVP YLY  AH
Sbjct  156  ALTRAVAADIGDKLQVPTYLYGAAH  180



>ref|XP_010474972.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Camelina sativa]
Length=301

 Score =   129 bits (323),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/142 (46%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISE+RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS +   
Sbjct  1    MLREMLGCCKVYISEARNKTALEAIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLATG  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            +++       L+  V A+   A D INLELHSG+HPRLGVVD I  HPL++ S+++ + +
Sbjct  61   SSS------SLKNAVFAMVKTALDTINLELHSGSHPRLGVVDHICFHPLSQTSIEQVSSV  114

Query  493  AKRLAAEFGNRFQVPVYLYNDA  558
            A  LA + G+  +VP YLY  A
Sbjct  115  ANSLAMDIGSTLRVPTYLYGAA  136



>ref|NP_973497.1| folic acid binding / transferase [Arabidopsis thaliana]
 gb|AEC07082.1| folic acid binding / transferase [Arabidopsis thaliana]
Length=431

 Score =   130 bits (328),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 74/187 (40%), Positives = 113/187 (60%), Gaps = 10/187 (5%)
 Frame = +1

Query  10   LSDSSPLLN--QEVKE--KKELRIEIKPARGKMAANNPNSKEKKSVMQSVLLCCKLHISE  177
            L D  PLL+   E K+  K +LR++       +  +    +  + +++ +L CCK++ISE
Sbjct  90   LLDKIPLLDPEDEAKDGIKDDLRVKFSIICASLGFSKKQFEWSEEMLREMLGCCKVYISE  149

Query  178  SRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTV  357
            +RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS + + +++       L+  V
Sbjct  150  ARNKTALEAIERALKPFPPAAIVNKFEDAAYGRVGYTVVSSLANGSSS------SLKNAV  203

Query  358  VAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVP  537
             A+   A D INLELH G+HPRLGVVD I  HPL++ S+++ + +A  LA + G+  +VP
Sbjct  204  FAMVKTALDTINLELHCGSHPRLGVVDHICFHPLSQTSIEQVSSVANSLAMDIGSILRVP  263

Query  538  VYLYNDA  558
             YLY  A
Sbjct  264  TYLYGAA  270



>ref|XP_008679597.1| PREDICTED: uncharacterized protein LOC103654540 [Zea mays]
Length=300

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/139 (48%), Positives = 88/139 (63%), Gaps = 6/139 (4%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +      G
Sbjct  7    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPL-----AG  61

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
                 PL+     + AAA + ++L+ H+GAHPRLGVVD +  HPLA A L++   LA+ +
Sbjct  62   GGASPPLRCASFRVVAAAIEAVDLDAHAGAHPRLGVVDHVAFHPLASAHLEDVTALARAV  121

Query  505  AAEFGNRFQVPVYLYNDAH  561
            AA+ G+R QVP YLY  AH
Sbjct  122  AADIGDRLQVPTYLYGAAH  140



>ref|XP_007043500.1| Transferases,folic acid binding isoform 1 [Theobroma cacao]
 gb|EOX99331.1| Transferases,folic acid binding isoform 1 [Theobroma cacao]
Length=300

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAA-KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            ++  +L C K++ISESRNR ALE I+RAA K  PE  IVN F D  YNR+ YT+VS +  
Sbjct  1    MLNKMLACGKVYISESRNRAALELIERAAAKLFPEAAIVNKFVDVTYNRVGYTVVSRLTS  60

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
            + +  S    PL+  V AI  AA + I+ ELHSG HPRLGVVD I  HPL   +LD+AA 
Sbjct  61   EPSQDS---FPLKGAVFAIVKAALETIDFELHSGTHPRLGVVDHICFHPLGHTTLDQAAA  117

Query  490  LAKRLAAEFGNRFQVPVYLYNDAH  561
            +AK LAA+ G++ QVP++LY  A+
Sbjct  118  IAKSLAADIGSKLQVPIFLYGAAN  141



>ref|XP_007043501.1| Transferases,folic acid binding isoform 2 [Theobroma cacao]
 gb|EOX99332.1| Transferases,folic acid binding isoform 2 [Theobroma cacao]
Length=303

 Score =   127 bits (319),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 97/144 (67%), Gaps = 4/144 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAA-KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            ++  +L C K++ISESRNR ALE I+RAA K  PE  IVN F D  YNR+ YT+VS +  
Sbjct  1    MLNKMLACGKVYISESRNRAALELIERAAAKLFPEAAIVNKFVDVTYNRVGYTVVSRLTS  60

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
            + +  S    PL+  V AI  AA + I+ ELHSG HPRLGVVD I  HPL   +LD+AA 
Sbjct  61   EPSQDS---FPLKGAVFAIVKAALETIDFELHSGTHPRLGVVDHICFHPLGHTTLDQAAA  117

Query  490  LAKRLAAEFGNRFQVPVYLYNDAH  561
            +AK LAA+ G++ QVP++LY  A+
Sbjct  118  IAKSLAADIGSKLQVPIFLYGAAN  141



>ref|XP_010488986.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Camelina sativa]
Length=301

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 93/142 (65%), Gaps = 6/142 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISE+RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS +   
Sbjct  1    MLREMLGCCKVYISEARNKTALEAIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLATG  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            +++       L+    A+   A D INLELHSG+HPRLGVVD I  HPL++ S+++ + +
Sbjct  61   SSS------SLKSAAFAMVKTALDTINLELHSGSHPRLGVVDHICFHPLSQTSIEQVSSV  114

Query  493  AKRLAAEFGNRFQVPVYLYNDA  558
            A  LA + G+  +VP YLY  A
Sbjct  115  ANSLAMDIGSTLRVPTYLYGAA  136



>ref|XP_002886308.1| folic acid binding protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH62567.1| folic acid binding protein [Arabidopsis lyrata subsp. lyrata]
Length=431

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 73/187 (39%), Positives = 115/187 (61%), Gaps = 10/187 (5%)
 Frame = +1

Query  10   LSDSSPLLNQEVKEKKELRIEIKPARGKMAANNPNSKEK----KSVMQSVLLCCKLHISE  177
            L D  PLL+ E + K  ++ +++     + A+   SK++    + +++ +L CCK++ISE
Sbjct  90   LLDKFPLLDPEGEAKDGIKDDLRLKFSIICASLGISKKQLEWSEEMLREMLGCCKVYISE  149

Query  178  SRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTV  357
            +RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS + + +++       L+  V
Sbjct  150  ARNKTALEAIERAVKAFPPVAIVNKFEDAAYGRVGYTVVSSLANGSSS------SLKNAV  203

Query  358  VAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVP  537
             A+   A + INLELH G HPRLGVVD I  HPL++ SL++ + +A  +A + G+  +VP
Sbjct  204  FAMVKTALNTINLELHCGTHPRLGVVDHICFHPLSQTSLEQVSSVANSVAMDIGSILRVP  263

Query  538  VYLYNDA  558
             YLY  A
Sbjct  264  TYLYGAA  270



>ref|XP_010488987.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Camelina sativa]
Length=436

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 72/183 (39%), Positives = 112/183 (61%), Gaps = 11/183 (6%)
 Frame = +1

Query  25   PLLNQEVKEKKELRIEIKPARGKMAANNPNSKEK-----KSVMQSVLLCCKLHISESRNR  189
            PLL+ E + K  ++  ++     + A+   SK++     + +++ +L CCK++ISE+RN+
Sbjct  95   PLLDPEDEAKDRIKDHLRVKFNIICASLGVSKKQLEGWSEEMLREMLGCCKVYISEARNK  154

Query  190  EALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIA  369
             ALE+I+RA K  P   IVN FED  Y R+ YT+VS +   +++       L+    A+ 
Sbjct  155  TALEAIERAVKPFPPAAIVNKFEDAAYGRVGYTVVSSLATGSSS------SLKSAAFAMV  208

Query  370  AAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVYLY  549
              A D INLELHSG+HPRLGVVD I  HPL++ S+++ + +A  LA + G+  +VP YLY
Sbjct  209  KTALDTINLELHSGSHPRLGVVDHICFHPLSQTSIEQVSSVANSLAMDIGSTLRVPTYLY  268

Query  550  NDA  558
              A
Sbjct  269  GAA  271



>ref|XP_008658585.1| PREDICTED: formiminotransferase-like isoform X3 [Zea mays]
Length=302

 Score =   126 bits (316),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 70/140 (50%), Positives = 90/140 (64%), Gaps = 7/140 (5%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +   A   
Sbjct  8    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPLAGGAA--  65

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            SP   PL+     + AAA + ++L+ H+GAHPRLGVVD I  HPLA A L++   LA+ +
Sbjct  66   SP---PLRCAAFRVVAAAIEAVDLDAHAGAHPRLGVVDHIAFHPLASARLEDVTALARAV  122

Query  505  AAEFGNRFQ-VPVYLYNDAH  561
            AA+ G+R Q VP YLY  AH
Sbjct  123  AADIGDRLQAVPTYLYGAAH  142



>ref|NP_565488.1| folic acid binding / transferase [Arabidopsis thaliana]
 gb|AAK25965.1|AF360255_1 unknown protein [Arabidopsis thaliana]
 gb|AAK64127.1| unknown protein [Arabidopsis thaliana]
 gb|AAD20912.2| expressed protein [Arabidopsis thaliana]
 gb|AEC07083.1| folic acid binding / transferase [Arabidopsis thaliana]
Length=297

 Score =   125 bits (314),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 64/142 (45%), Positives = 94/142 (66%), Gaps = 6/142 (4%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD  312
            +++ +L CCK++ISE+RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS + + 
Sbjct  1    MLREMLGCCKVYISEARNKTALEAIERALKPFPPAAIVNKFEDAAYGRVGYTVVSSLANG  60

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            +++       L+  V A+   A D INLELH G+HPRLGVVD I  HPL++ S+++ + +
Sbjct  61   SSS------SLKNAVFAMVKTALDTINLELHCGSHPRLGVVDHICFHPLSQTSIEQVSSV  114

Query  493  AKRLAAEFGNRFQVPVYLYNDA  558
            A  LA + G+  +VP YLY  A
Sbjct  115  ANSLAMDIGSILRVPTYLYGAA  136



>ref|NP_001189564.1| folic acid binding / transferase [Arabidopsis thaliana]
 gb|AEC07084.1| folic acid binding / transferase [Arabidopsis thaliana]
Length=341

 Score =   125 bits (313),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/144 (44%), Positives = 95/144 (66%), Gaps = 6/144 (4%)
 Frame = +1

Query  127  KSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVI  306
            + +++ +L CCK++ISE+RN+ ALE+I+RA K  P   IVN FED  Y R+ YT+VS + 
Sbjct  43   EEMLREMLGCCKVYISEARNKTALEAIERALKPFPPAAIVNKFEDAAYGRVGYTVVSSLA  102

Query  307  HDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
            + +++       L+  V A+   A D INLELH G+HPRLGVVD I  HPL++ S+++ +
Sbjct  103  NGSSS------SLKNAVFAMVKTALDTINLELHCGSHPRLGVVDHICFHPLSQTSIEQVS  156

Query  487  WLAKRLAAEFGNRFQVPVYLYNDA  558
             +A  LA + G+  +VP YLY  A
Sbjct  157  SVANSLAMDIGSILRVPTYLYGAA  180



>gb|AFW65332.1| hypothetical protein ZEAMMB73_172834 [Zea mays]
Length=301

 Score =   124 bits (310),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/140 (48%), Positives = 88/140 (63%), Gaps = 7/140 (5%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +      G
Sbjct  7    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPL-----AG  61

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
                 PL+     + AAA + ++L+ H+GAHPRLGVVD +  HPLA A L++   LA+ +
Sbjct  62   GGASPPLRCASFRVVAAAIEAVDLDAHAGAHPRLGVVDHVAFHPLASAHLEDVTALARAV  121

Query  505  AAEFGNRFQ-VPVYLYNDAH  561
            AA+ G+R Q VP YLY  AH
Sbjct  122  AADIGDRLQAVPTYLYGAAH  141



>ref|XP_008658584.1| PREDICTED: formiminotransferase-like isoform X2 [Zea mays]
Length=316

 Score =   120 bits (302),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 90/154 (58%), Gaps = 21/154 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +   A   
Sbjct  8    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPLAGGAA--  65

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            SP   PL+     + AAA + ++L+ H+GAHPRLGVVD I  HPLA A L++   LA+ +
Sbjct  66   SP---PLRCAAFRVVAAAIEAVDLDAHAGAHPRLGVVDHIAFHPLASARLEDVTALARAV  122

Query  505  AAEFGNRFQ---------------VPVYLYNDAH  561
            AA+ G+R Q               VP YLY  AH
Sbjct  123  AADIGDRLQGPLPFIPPRREFTGTVPTYLYGAAH  156



>ref|XP_008658583.1| PREDICTED: formiminotransferase-like isoform X1 [Zea mays]
Length=317

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 70/155 (45%), Positives = 90/155 (58%), Gaps = 22/155 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKH-DPETVIVNIFEDREYNRINYTLVSYVIHDATTG  324
            L CCKL+ISE+RN  AL +I+ AA    P  V+VN F D  YNR+ YTLVS +   A   
Sbjct  8    LACCKLYISEARNSGALRAIEHAAAALRPLAVLVNTFADDAYNRVGYTLVSPLAGGAA--  65

Query  325  SPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRL  504
            SP   PL+     + AAA + ++L+ H+GAHPRLGVVD I  HPLA A L++   LA+ +
Sbjct  66   SP---PLRCAAFRVVAAAIEAVDLDAHAGAHPRLGVVDHIAFHPLASARLEDVTALARAV  122

Query  505  AAEFGNRFQ----------------VPVYLYNDAH  561
            AA+ G+R Q                VP YLY  AH
Sbjct  123  AADIGDRLQGPLPFIPPRREFTGTAVPTYLYGAAH  157



>dbj|BAK06963.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=309

 Score =   120 bits (301),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 62/144 (43%), Positives = 90/144 (63%), Gaps = 1/144 (1%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAK-HDPETVIVNIFEDREYNRINYTLVSYVIH  309
            +++ +L CCKL++SE R+  AL ++++AA+ H P   +VN F D  YNR+ YTLVS +  
Sbjct  1    MLRPMLACCKLYVSEGRSAAALRAVEQAARRHHPAVALVNTFVDDAYNRVGYTLVSRLPD  60

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                 +P   PL + V  +  +A   I+L  H+GAHPRLG VD +  HPLA A+L + + 
Sbjct  61   PVAPAAPATWPLHRAVFGMVESALGAIDLASHAGAHPRLGAVDHVCFHPLAGAALGDVSS  120

Query  490  LAKRLAAEFGNRFQVPVYLYNDAH  561
            LA  +AA+ G+  QVP YLY  AH
Sbjct  121  LAAAVAADIGDGLQVPTYLYGAAH  144



>ref|XP_001780549.1| predicted protein [Physcomitrella patens]
 gb|EDQ54643.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   120 bits (300),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 2/138 (1%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L CCK++IS++RN  AL+ I+   +  PE  ++++FED EYNR+ YTL   V    +  +
Sbjct  11   LACCKIYISDTRNAAALQEIESTFRAHPEAPLLHVFEDHEYNRVGYTLAGSVCSSESRNA  70

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
                PLQ  V  +   A   I+L  HSG+HPRLGVVD I  HPL  A++ +   +A+ +A
Sbjct  71   --RTPLQSAVTDVVRTALRTIDLRQHSGSHPRLGVVDHICTHPLGTATMTDTTAIAEGIA  128

Query  508  AEFGNRFQVPVYLYNDAH  561
            +E G   +VP +LY  AH
Sbjct  129  SEIGQELKVPAFLYGAAH  146



>gb|ADE76078.1| unknown [Picea sitchensis]
Length=322

 Score =   118 bits (295),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 70/142 (49%), Positives = 93/142 (65%), Gaps = 3/142 (2%)
 Frame = +1

Query  139  QSVLLCCKLHISESRNREALESIQRAAKHDPETV-IVNIFEDREYNRINYTLVSYVIHDA  315
            Q+ + CCKL++SESRN +ALE+I++AA+  P    ++N FED++YNR+ YTLV      +
Sbjct  3    QAAVACCKLYVSESRNGKALEAIEKAARAYPHAAALLNAFEDKDYNRVGYTLV--FPFSS  60

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
            +      CP Q TV+ +  AA   INLE HSG HPRLGVVD I  HPL  ASL + A LA
Sbjct  61   SQQQQSSCPSQNTVLRMVRAALQAINLEGHSGTHPRLGVVDHICYHPLGDASLHQVASLA  120

Query  496  KRLAAEFGNRFQVPVYLYNDAH  561
            + LAA+ G   +VP +LY  AH
Sbjct  121  RSLAADIGLTLKVPTFLYGAAH  142



>ref|XP_003576127.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Brachypodium 
distachyon]
 ref|XP_010237237.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Brachypodium 
distachyon]
Length=300

 Score =   116 bits (291),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 68/146 (47%), Positives = 94/146 (64%), Gaps = 13/146 (9%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAK-HDPETVIVNIFEDREYNRINYTLVSYVIH  309
            +++ +L CCKL++SESR+  AL ++++AA+ H P  V+VN F D  YNR+ YTLV+    
Sbjct  1    MLRPMLACCKLYVSESRSAAALRAVEQAARRHHPAVVLVNRFADDAYNRVGYTLVA----  56

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPL--ARASLDEA  483
            DA++      PL++ VV +  AA D I+L  H+GAHPRLG VD +  HPL  A +SL   
Sbjct  57   DASS------PLRRAVVGMVGAALDAIDLRSHAGAHPRLGAVDHVCFHPLDAAASSLRLV  110

Query  484  AWLAKRLAAEFGNRFQVPVYLYNDAH  561
            A LA   AA+ G+  QVP YLY  AH
Sbjct  111  ADLAAAAAADIGDNLQVPTYLYGAAH  136



>ref|XP_002437725.1| hypothetical protein SORBIDRAFT_10g001400 [Sorghum bicolor]
 gb|EER89092.1| hypothetical protein SORBIDRAFT_10g001400 [Sorghum bicolor]
Length=339

 Score =   108 bits (269),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 87/145 (60%), Gaps = 5/145 (3%)
 Frame = +1

Query  133  VMQSVLLCCKLHISESRNREALESIQRAAKHDPETVI-VNIFEDREYNRINYTLVSYVIH  309
            +++  L CCKL+ISE+RN  AL +I+ AA         VN F D  YNR+ YTLVS +  
Sbjct  32   MVRPALACCKLYISEARNAGALRAIEHAAAALRPAAALVNAFADDAYNRVGYTLVSPLAG  91

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
            D T  +P   PL +    + AAA + ++L  H+GAHPRLGVVD +  HPLA A L++ A 
Sbjct  92   DGTGEAP---PLHRAAFRVVAAALEAVDLGAHAGAHPRLGVVDHVAFHPLAGARLEDVAA  148

Query  490  LAKRLAAEFGNRFQ-VPVYLYNDAH  561
            L + +AA+ G   Q V  YLY  AH
Sbjct  149  LTRAVAADIGENLQAVSTYLYGAAH  173



>ref|XP_002988838.1| hypothetical protein SELMODRAFT_128752 [Selaginella moellendorffii]
 gb|EFJ10100.1| hypothetical protein SELMODRAFT_128752 [Selaginella moellendorffii]
Length=294

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 84/138 (61%), Gaps = 6/138 (4%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            + CCK+++S S NR+A+E+I++A +  P+  +++ F D  Y+R+ YTL       A+  +
Sbjct  1    MACCKMYVSTSSNRQAMENIEQAMRGHPQVPLLHTFRDEHYDRVGYTLAGKCGSTASREN  60

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASLDEAAWLAKRL  504
                     +V +  AA   I+L+  SG+HPRLGVVD++  HPL + AS+D+AA LA+  
Sbjct  61   -----FADAIVDMIRAAILNIDLQKQSGSHPRLGVVDNLCFHPLGKEASMDQAAELARSC  115

Query  505  AAEFGNRFQVPVYLYNDA  558
            A   G + QVP +LY  A
Sbjct  116  ARSIGAKLQVPTFLYGAA  133



>ref|XP_002964559.1| hypothetical protein SELMODRAFT_438865 [Selaginella moellendorffii]
 gb|EFJ34892.1| hypothetical protein SELMODRAFT_438865 [Selaginella moellendorffii]
Length=294

 Score =   107 bits (267),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/138 (38%), Positives = 84/138 (61%), Gaps = 6/138 (4%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            + CCK+++S S NR+A+E+I++A +  P+  +++ F D  Y+R+ YTL       A+  +
Sbjct  1    MACCKMYVSTSSNRQAMENIEQAMRGHPQVPLLHTFRDEHYDRVGYTLAGKCGSTASREN  60

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASLDEAAWLAKRL  504
                     +V +  AA   I+L+  SG+HPRLGVVD++  HPL + AS+D+AA LA+  
Sbjct  61   -----FADAIVDMIRAAILNIDLQKQSGSHPRLGVVDNLCFHPLGKEASMDQAAELARSC  115

Query  505  AAEFGNRFQVPVYLYNDA  558
            A   G + QVP +LY  A
Sbjct  116  ARSIGAKLQVPTFLYGAA  133



>dbj|BAA83349.1| formiminotransferase-cyclodeaminase-like [Oryza sativa Japonica 
Group]
 dbj|BAD67931.1| formiminotransferase-cyclodeaminase-like [Oryza sativa Japonica 
Group]
 gb|EAY99492.1| hypothetical protein OsI_21462 [Oryza sativa Indica Group]
 gb|EAZ35682.1| hypothetical protein OsJ_19970 [Oryza sativa Japonica Group]
Length=303

 Score =   103 bits (258),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 63/141 (45%), Positives = 81/141 (57%), Gaps = 6/141 (4%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESI-QRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDAT  318
            ++L CCKL+ISESRN  AL +I Q A       V+VN F D  YNR+ YTLV+ +     
Sbjct  6    TLLACCKLYISESRNDAALRAIEQAARGGGGGAVVVNRFTDDAYNRVGYTLVAPLTPSPA  65

Query  319  TGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAK  498
                    L+  V+ +  AA + I+   H+G HPRLG VD I  HPLA ASL   A LA 
Sbjct  66   PPP-----LRHAVLGMVRAALEAIDFGAHAGTHPRLGAVDHICFHPLAHASLRHVADLAG  120

Query  499  RLAAEFGNRFQVPVYLYNDAH  561
             +AA+ G+  QVP +LY  AH
Sbjct  121  AVAADIGDELQVPTFLYGAAH  141



>ref|XP_006447366.1| hypothetical protein CICLE_v10015950mg [Citrus clementina]
 gb|ESR60606.1| hypothetical protein CICLE_v10015950mg [Citrus clementina]
 gb|KDO43791.1| hypothetical protein CISIN_1g020781mg [Citrus sinensis]
Length=230

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 58/68 (85%), Gaps = 0/68 (0%)
 Frame = +1

Query  364  IAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNRFQVPVY  543
            +A AAY  INLE HSGAHPRLGVVDDI  HPLARASLDEAAWLAK +AA+ G+RFQVPV+
Sbjct  1    MADAAYGAINLETHSGAHPRLGVVDDIVFHPLARASLDEAAWLAKAVAADIGSRFQVPVF  60

Query  544  LYNDAHPT  567
            LY  AHPT
Sbjct  61   LYAAAHPT  68



>ref|XP_002501051.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO62309.1| predicted protein [Micromonas sp. RCC299]
Length=330

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 52/138 (38%), Positives = 76/138 (55%), Gaps = 3/138 (2%)
 Frame = +1

Query  163  LHISESRNREALESIQRAAKHDPE---TVIVNIFEDREYNRINYTLVSYVIHDATTGSPI  333
            +++SE ++ +A+  +Q  A+   +   T ++N+F D EYNR  +TL   V   A   +P 
Sbjct  21   VYVSEGKDADAVNVLQTVAEKACQQHGTRVLNVFRDDEYNRTGFTLGVGVASVAGHATPS  80

Query  334  YCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAE  513
              PL+Q+ +A+   A   I+L  HS  HPR G VD I+ H +  A  D AA LAK L   
Sbjct  81   VEPLKQSALALTEQALKTIDLRNHSATHPRCGAVDHISCHAVGDAPDDLAAQLAKCLGEG  140

Query  514  FGNRFQVPVYLYNDAHPT  567
             G+R +VPV LY  A  T
Sbjct  141  IGDRLKVPVLLYGLASST  158



>ref|XP_001696535.1| hypothetical protein CHLREDRAFT_112842 [Chlamydomonas reinhardtii]
 gb|EDP08512.1| predicted protein, partial [Chlamydomonas reinhardtii]
Length=269

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 78/143 (55%), Gaps = 18/143 (13%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C ++ISE R++  +  ++ AA+  P   +VN+F+D  Y+R  +TLVS        G P  
Sbjct  1    CNVYISEGRDKALIGKLEAAAQATPGVALVNVFQDEPYHRTGFTLVS--------GQPDR  52

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHP---LARASLDEAAWLAKRLA  507
              L + VV ++ AA   ++L  H  +HPRLGVVD I +HP   LA A+   +  +A  +A
Sbjct  53   --LTEAVVRLSRAALQLLDLRRHDASHPRLGVVDHIALHPLGGLAPAAATHSRGVATTVA  110

Query  508  AEFGNRFQV---PVYLYNDAHPT  567
               G   +V   PVY Y  AHP+
Sbjct  111  G--GQEEEVPALPVYFYGHAHPS  131



>ref|WP_023175819.1| glutamate formiminotransferase [Gloeobacter kilaueensis]
 gb|AGY60467.1| glutamate formiminotransferase [Gloeobacter kilaueensis JS1]
Length=300

 Score = 80.5 bits (197),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 48/139 (35%), Positives = 74/139 (53%), Gaps = 11/139 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S L+ C  +ISE R  E +E   R     P  V+++   D ++NR  +TLV      +  
Sbjct  2    SQLIECVPNISEGRRAEVIEQFSRELSQVPGVVLLDSSSDLDHNRSVFTLVG-----SAE  56

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G      LQQ VV + + A + I+L  H G+HPR+G VD +   P+ +A++ +   LA+ 
Sbjct  57   G------LQQAVVRLYSLALEHIDLRRHQGSHPRMGAVDVVPFIPIRQATMADCVALARS  110

Query  502  LAAEFGNRFQVPVYLYNDA  558
             A E   +F VPV+LY +A
Sbjct  111  TAEEIARQFDVPVFLYAEA  129



>dbj|BAL54907.1| glutamate formiminotransferase [uncultured Acetothermia bacterium]
 dbj|BAL60043.1| glutamate formiminotransferase [Candidatus Acetothermus autotrophicum]
Length=304

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 46/134 (34%), Positives = 76/134 (57%), Gaps = 11/134 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  +ISE R+   +++I  A +  P T+++++  D ++NR   T++++V      G P  
Sbjct  7    CVPNISEGRDHAKIDAIVAAVRATPGTLVLDVDPDADHNR---TVITFV------GEP--  55

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
              ++  ++ + A A + I+L  H G HPR+G VD I   PL   +  E   LA+R+ A  
Sbjct  56   AAVETAILNLVAKAVELIDLTKHKGEHPRMGAVDVIPFVPLRGVTKQECIELARRVGAAI  115

Query  517  GNRFQVPVYLYNDA  558
             +RF+VPVYLY DA
Sbjct  116  WDRFKVPVYLYEDA  129



>ref|XP_009102103.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Brassica 
rapa]
Length=282

 Score = 79.7 bits (195),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/98 (45%), Positives = 60/98 (61%), Gaps = 3/98 (3%)
 Frame = +1

Query  271  NRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITV  450
            NR+   L S + H+   GS    PL+  V A+   A   INLELHSG+HPRLGVVD I  
Sbjct  10   NRLVTLLSSTLAHE--EGSSSSSPLKNAVFAMVKTALHTINLELHSGSHPRLGVVDHICF  67

Query  451  HPLAR-ASLDEAAWLAKRLAAEFGNRFQVPVYLYNDAH  561
            HPL++ +S+D+ + +A  LA + G+  +VP YLY  A 
Sbjct  68   HPLSQTSSIDQVSAVATSLAMDIGSILRVPTYLYGAAQ  105



>ref|WP_040330217.1| glutamate formiminotransferase [Candidatus Clostridium anorexicamassiliense]
Length=298

 Score = 79.7 bits (195),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 72/137 (53%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR   TLV         G 
Sbjct  4    IIECIPNFSEGRDKEKIEKIMDTVRGKDGVKLLDYSSDADHNRSVVTLV---------GD  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   +++ ++ +A   Y+ I++  H GAHPR+G +D +   P++  ++DE   +A R+ 
Sbjct  55   PV--KVEEVIINMAEKVYELIDMSKHEGAHPRMGALDVVPFVPISEITMDECVEIANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G RF +PVYLY  A
Sbjct  113  KTIGERFNIPVYLYEKA  129



>ref|WP_021656861.1| glutamate formimidoyltransferase [Clostridiales bacterium oral 
taxon 876]
 gb|ERI90747.1| glutamate formimidoyltransferase [Clostridiales bacterium oral 
taxon 876 str. F0540]
Length=298

 Score = 79.3 bits (194),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 74/137 (54%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE RN+E +E I    +      +++   D ++NR   T+V+++      G+
Sbjct  4    IIECIPNFSEGRNKEVIEKILDKLRGKEGVKLLDYSSDADHNR---TVVTFI------GN  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P     ++ ++  A A Y+ I++  H G HPR+G +D +   P++  +++E   LA R+ 
Sbjct  55   P--EGAEKAIIDFAEAVYENIDMTKHEGGHPRMGALDVVPFVPVSGVTMEECIELANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G RF VPVYLY DA
Sbjct  113  KTIGERFNVPVYLYEDA  129



>ref|XP_003057262.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58907.1| predicted protein [Micromonas pusilla CCMP1545]
Length=337

 Score = 78.6 bits (192),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 51/144 (35%), Positives = 74/144 (51%), Gaps = 9/144 (6%)
 Frame = +1

Query  151  LCCKLHISESRNREALESIQRAAKHDPE---TVIVNIFEDREYNRINYTLVSYVIHDATT  321
            L   +++SE +N   + +++R A+   E     +VN+F D EYNR  +TL    I  A +
Sbjct  15   LVAVVYVSEGKNEGVVANLERTAEETCEKHGAKVVNVFRDVEYNRTGFTL-GMGIASAAS  73

Query  322  GSPIYC-----PLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
              P        PL+Q+ +A+   A   I+L  H+  HPR GVVD I+ H +  A    AA
Sbjct  74   LEPAALSGAVEPLRQSALALTEKALSLIDLRTHTATHPRCGVVDHISCHAIGDADDAAAA  133

Query  487  WLAKRLAAEFGNRFQVPVYLYNDA  558
             LAK L    G   +VPV LY +A
Sbjct  134  CLAKTLGERIGVESRVPVLLYGNA  157



>ref|WP_022849287.1| glutamate formiminotransferase [Chloroflexi bacterium oral taxon 
439]
Length=300

 Score = 77.4 bits (189),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 72/141 (51%), Gaps = 11/141 (8%)
 Frame = +1

Query  127  KSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVI  306
            K   Q  L+    + S+ RN E +E+++ A +  P   +VN+ +D ++NR  +TL+    
Sbjct  2    KKNCQPTLIEAVPNFSDGRNPETIEALRDAVRLTPSVRLVNVHQDADHNRSVFTLIG---  58

Query  307  HDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
                 G P    L++  + +   A + I+LE   G HPR+G  D +   PL  AS+D+  
Sbjct  59   ----EGEP----LRECALNLVGVAAERIDLETQRGVHPRIGATDVVPFVPLRNASMDDCV  110

Query  487  WLAKRLAAEFGNRFQVPVYLY  549
             LA+  A +   R+ +P YLY
Sbjct  111  RLAREAARQISERYPIPTYLY  131



>emb|CDY31933.1| BnaA07g00620D [Brassica napus]
Length=290

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/81 (48%), Positives = 52/81 (64%), Gaps = 1/81 (1%)
 Frame = +1

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLAR-ASLDEAAWLAK  498
            GS    PL+  V A+   A   INLELHSG+HPRLGVVD I  HPL++ +S+D+ + +A 
Sbjct  58   GSSSSSPLKNAVFAMVKTALHTINLELHSGSHPRLGVVDHICFHPLSQTSSIDQVSAVAT  117

Query  499  RLAAEFGNRFQVPVYLYNDAH  561
             LA + G+  +VP YLY  A 
Sbjct  118  SLAMDIGSILRVPTYLYGAAQ  138



>ref|WP_010293009.1| glutamate formiminotransferase [Clostridium senegalense]
Length=298

 Score = 77.0 bits (188),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/137 (28%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+RE +E I    +      +++   D ++NR   TLV         G 
Sbjct  4    IIECIPNFSEGRDREKIEKIMDTVRGKEGVKLLDYSSDTDHNRSVVTLV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ ++ +A   Y+ I++  H G HPR+G +D +   P++  +++E   +A R+ 
Sbjct  55   P--SKVEEVIINMAEKVYELIDMSTHEGGHPRMGALDVVPFVPISEVTMEECVEIANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G +F +PVYLY  A
Sbjct  113  KTIGEKFNIPVYLYEKA  129



>ref|WP_005365812.1| glutamate formiminotransferase [[Eubacterium] yurii]
 gb|EFM39365.1| glutamate formimidoyltransferase [ [[Eubacterium] yurii subsp. 
margaretiae ATCC 43715]
 gb|EJP22440.1| glutamate formimidoyltransferase [Peptostreptococcaceae bacterium 
AS15]
Length=297

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 74/137 (54%), Gaps = 12/137 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R++  +E I   AK   E  +++   D ++NR   T++         G 
Sbjct  4    LVECVPNFSEGRDKALVEKIVNEAKKIKEVKLLDYSSDEDHNRSVVTMI---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ V+ +A  A + I++  HSGAHPR+G VD +   P++  ++DE   LAK + 
Sbjct  55   P--SKIKEAVLNMAKVAVELIDMTKHSGAHPRMGAVDVVPFTPVSEITMDECVQLAKEVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
             E  ++  VPVYLY DA
Sbjct  113  EEI-SKLGVPVYLYEDA  128



>ref|WP_035307133.1| glutamate formiminotransferase [Clostridium sp. HMP27]
 gb|KGK88913.1| glutamate formiminotransferase [Clostridium sp. HMP27]
Length=297

 Score = 76.6 bits (187),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 74/137 (54%), Gaps = 12/137 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R++E +E I   A+   E  +++   D ++NR   TL+         GS
Sbjct  4    LVECVPNFSEGRDKELVEKIVDEARKVKEVKLLDYSSDEDHNRTVVTLI---------GS  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ VV +A  A   I++  H GAHPR+G VD +   P+A  +++E   +AK + 
Sbjct  55   P--EKIKEAVVNMAKVATGLIDMTTHHGAHPRMGAVDVVPFTPVADITMEECIEIAKEVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
             E G+   VPVYLY DA
Sbjct  113  KEIGS-LGVPVYLYEDA  128



>ref|WP_005661063.1| glutamate formiminotransferase [Dethiosulfovibrio peptidovorans]
 gb|EFC91586.1| glutamate formiminotransferase [Dethiosulfovibrio peptidovorans 
DSM 11002]
Length=305

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/141 (32%), Positives = 67/141 (48%), Gaps = 11/141 (8%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M   L+ C  + SE R ++ +ESI +  K      + +   D ++NR+  +L        
Sbjct  1    MAKQLIECVPNFSEGRRQDVIESIVKPFKEQKGCYLFDYRADEDHNRLVVSL--------  52

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G P    +   V+A +  A D I+L  H GAHPR+G +D I   P++  S+DE   LA
Sbjct  53   -AGEP--QAISDAVMAASKVAVDNIDLNTHKGAHPRMGAIDVIPFTPISDISMDECVELA  109

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
            +     F     VPVY Y DA
Sbjct  110  RSFGKRFYEELNVPVYYYEDA  130



>ref|WP_023935986.1| MULTISPECIES: glutamate formiminotransferase [Porphyromonas]
 dbj|GAD04486.1| glutamate formiminotransferase [Porphyromonas crevioricanis JCM 
15906]
 dbj|GAD07881.1| glutamate formiminotransferase [Porphyromonas cansulci JCM 13913]
 gb|KGN89709.1| glutamate formiminotransferase [Porphyromonas crevioricanis]
 gb|KGN93753.1| glutamate formiminotransferase [Porphyromonas crevioricanis]
Length=301

 Score = 75.9 bits (185),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 72/139 (52%), Gaps = 15/139 (11%)
 Frame = +1

Query  139  QSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHD--  312
            QS ++ C  + SE RN+E +E I    +      ++N   D ++NR    LV  VI D  
Sbjct  4    QSKIVQCVPNFSEGRNKENIEKIVNPFRTRQGVKLLNYSNDEDHNR----LVVTVIGDPE  59

Query  313  ATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWL  492
            A T S +Y  ++Q V  I        +L  H G HPR+G VD +   P+    +DEA  L
Sbjct  60   AVTES-LYEAIEQAVQLI--------DLNKHQGQHPRMGAVDVVPFIPIRNMDMDEAIAL  110

Query  493  AKRLAAEFGNRFQVPVYLY  549
            +K + AE G RF +PV+LY
Sbjct  111  SKEVGAEIGKRFGIPVFLY  129



>ref|WP_039631226.1| glutamate formiminotransferase [Clostridium argentinense]
 gb|KIE47513.1| glutamate formiminotransferase [Clostridium argentinense CDC 
2741]
Length=298

 Score = 75.5 bits (184),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 69/137 (50%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR   TLV         G 
Sbjct  4    IIECIPNFSEGRDKEKIEKIIDTVRGVEGVKLLDYSSDADHNRTVVTLV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    ++  ++ +A   Y  I++ +H G HPR+G +D +   P++  S+DE   +A R+ 
Sbjct  55   P--AAVENAIINMAEKVYGLIDMSIHHGGHPRMGALDVVPFVPISDVSMDECVEIANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G RF +PVYLY  A
Sbjct  113  KVIGERFSIPVYLYEKA  129



>ref|XP_006656574.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Oryza 
brachyantha]
Length=239

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +1

Query  340  PLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFG  519
            PL+  V  +  AA + I+   H+G HPRLG VD I  HPLA+ASL   A LA  +A++ G
Sbjct  4    PLRHAVFGMVRAALEAIDFGAHAGTHPRLGAVDHICFHPLAQASLRHVADLAGDVASDIG  63

Query  520  NRFQVPVYLYNDAH  561
            ++ QVP +LY  AH
Sbjct  64   DKLQVPTFLYGAAH  77



>ref|WP_005660978.1| glutamate formiminotransferase [Dethiosulfovibrio peptidovorans]
 gb|EFC91525.1| glutamate formiminotransferase [Dethiosulfovibrio peptidovorans 
DSM 11002]
Length=307

 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (54%), Gaps = 11/127 (9%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + SE R  E +E+I    K+     +++ F D ++NR   T++  +      G P   PL
Sbjct  13   NFSEGRRTEVIEAIVGEIKNVKGVKLIDFFPDADFNR---TVIECI------GEP--EPL  61

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
             + ++ +A  AY+ I++E   G+HPR+G  D I V PL   +L+E A  A+++      R
Sbjct  62   MEALLNMAEKAYELIDMEKQKGSHPRIGAQDTIPVFPLMNVTLEECAEFAEKVGTALFER  121

Query  526  FQVPVYL  546
            FQVPVY 
Sbjct  122  FQVPVYF  128



>ref|WP_023152921.1| glutamate formimidoyltransferase [Eubacterium brachy]
 gb|ESE30473.1| glutamate formimidoyltransferase [Eubacterium brachy ATCC 33089]
Length=304

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 72/134 (54%), Gaps = 11/134 (8%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            +ISE RNRE +ESI    ++    +++N   D+++NR   +++SY+      GSP    +
Sbjct  16   NISEGRNREIVESIVDEVRNTEGCILMNYSSDKDHNR---SVISYI------GSP--KAV  64

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++    +   A   I+L  H G HPR+G VD + + P+   S++E   ++KR+  +    
Sbjct  65   EEASFRLMKKALKLIDLRKHKGEHPRMGAVDVMPIVPIKNISMEECIEISKRIGEKVARE  124

Query  526  FQVPVYLYNDAHPT  567
              VPVYLY  +  T
Sbjct  125  LAVPVYLYEKSSKT  138



>ref|WP_032118636.1| glutamate formiminotransferase [Clostridium sp. CL-2]
Length=296

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/139 (29%), Positives = 79/139 (57%), Gaps = 15/139 (11%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++  ++ I    +      +++   D+++NR   T+V++V      G+
Sbjct  4    IIECIPNFSEGRDKVTIDKIIDTLRGREGIKLLDYSSDKDHNR---TVVTFV------GA  54

Query  328  P--IYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            P  +Y    + ++A+A   Y+ I++  H+G HPR+G +D + + P++  ++DE   LAKR
Sbjct  55   PEMVY----EGILAMADKVYEYIDMRKHNGEHPRMGALDVVPIVPVSDVTMDECIELAKR  110

Query  502  LAAEFGNRFQVPVYLYNDA  558
            +  E   ++ VPVYLY DA
Sbjct  111  VGKEIAKKYNVPVYLYEDA  129



>ref|XP_005648505.1| Formiminotransferase [Coccomyxa subellipsoidea C-169]
 gb|EIE23961.1| Formiminotransferase [Coccomyxa subellipsoidea C-169]
Length=301

 Score = 75.1 bits (183),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 49/137 (36%), Positives = 72/137 (53%), Gaps = 13/137 (9%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAA-KHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPI  333
            C ++ISE      ++ ++  A K    + +V+ F D+ YNR  +TLVS   H+       
Sbjct  8    CNVYISEGLRSTLVQQLKVCADKCISGSALVHTFVDKPYNRTGFTLVSPAPHE-------  60

Query  334  YCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR-LAA  510
               L  +VV +A AA + I+L  H+ +HPRLGVVD I+ HPL R +   AA    R +  
Sbjct  61   ---LAGSVVRLARAALETIDLRSHAASHPRLGVVDHISCHPLGRDAALTAAAETARSIGT  117

Query  511  EFG-NRFQVPVYLYNDA  558
            + G     VPV+LY  A
Sbjct  118  QLGEGELAVPVFLYGSA  134



>ref|WP_008604760.1| glutamate formiminotransferase [Thermoplasmatales archaeon SCGC 
AB-540-F20]
 gb|EMR74963.1| glutamate formiminotransferase [Thermoplasmatales archaeon SCGC 
AB-540-F20]
Length=302

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE RN++ +E I  A K   +  +++   D ++NR + T+V         GSP  
Sbjct  7    CVPNFSEGRNKKTIEVIYNAIKKHKDVELLDFTPDADHNRTDVTIV---------GSP--  55

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
              ++ TV+ IA    + I++  H G HPR+G +D +   P++  +++E   LA   A EF
Sbjct  56   EKIKATVMDIALKCVELIDMSKHKGEHPRMGAIDVVPFIPISDVTMEECVELANDFAKEF  115

Query  517  GNRFQVPVYLYNDA  558
              +  VP +LY +A
Sbjct  116  SKKTNVPCFLYEEA  129



>ref|XP_003081146.1| unnamed protein product [Ostreococcus tauri]
Length=317

 Score = 74.7 bits (182),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 71/139 (51%), Gaps = 15/139 (11%)
 Frame = +1

Query  151  LCCKLHISESRNREALESIQRAAKHDP---ETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            L   +++SE R    L++I+R A+         +VN+F DREYNR  +TL     H  T 
Sbjct  10   LAAVVYVSEGRRTVVLDAIERVARDASLKNRVALVNVFVDREYNRTGFTLAG--AH--TD  65

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G      +  T + IA  + + I+   H   HPRLGVVD ++ H L R   D  A LA+ 
Sbjct  66   G------IANTALDIAKKSLELIDFSTHDATHPRLGVVDHVSCHEL-RGERDAGAALARN  118

Query  502  LAAEFGNRFQVPVYLYNDA  558
            +    G++  VPV LY DA
Sbjct  119  IGRGLGDQ-GVPVKLYGDA  136



>ref|XP_005340925.1| PREDICTED: uncharacterized protein LOC101977523 [Ictidomys tridecemlineatus]
Length=594

 Score = 76.6 bits (187),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 53/159 (33%), Positives = 83/159 (52%), Gaps = 24/159 (15%)
 Frame = +1

Query  115  SKEK---KSVMQSVLLCCKLHISESRNREALESIQRAA-----KHDPETVIVNIFEDREY  270
            +KEK    S + S L  C L+ISE+R +  +E+I +AA     +  PE  ++NIF D++Y
Sbjct  263  AKEKIMSSSRLGSRLAVCLLNISEARRKYIVENIAKAALEKNGRKHPEVSVLNIFSDQDY  322

Query  271  NRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITV  450
            NR   T+ + V             L   V+A    A+  I++E+  G HP LG VD I +
Sbjct  323  NRSVITIAASVDK-----------LGSCVLAACLEAFRAIDMEVQEGVHPCLGAVDLIPI  371

Query  451  HPLARASLDEAAWLAKRLAAEFGNRFQVP---VYLYNDA  558
            +PL+   +DE   +A+ LA +      VP   V+L+ +A
Sbjct  372  YPLSDVGVDECGAVARSLAKDL--VLHVPGCSVFLFGEA  408



>ref|XP_008533257.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Equus 
przewalskii]
Length=328

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 76/146 (52%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      +  PE  ++NIF DR+YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKNIVENIAKAALLEKNGQTHPEVSVLNIFSDRDYNRSVITIAASVDD  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  IN+EL  G HP LG VD I ++ L+  S++E   
Sbjct  70   -----------LGNSVLAACLEAFQSINMELQEGVHPCLGAVDLIPIYALSGVSVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA        VP   ++L+ +A
Sbjct  119  VARSLAESL--LLHVPGCSLFLFGEA  142



>ref|XP_006082790.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Myotis 
lucifugus]
Length=385

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  PE  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKHVVENIAKAALLGENGKKRPEVSVLNIFSDQDYNRSVITIAASVDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E   G HP LG VD I ++PLA   ++E   
Sbjct  70   -----------LNHAVLAACVEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA       +VP   V+L+ +A
Sbjct  119  MARSLAETL--VLRVPGSSVFLFGEA  142



>gb|EPQ12294.1| Formimidoyltransferase-cyclodeaminase [Myotis brandtii]
Length=407

 Score = 75.5 bits (184),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 49/146 (34%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  PE  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKHVVENIAKAALLGENGKKRPEVSVLNIFSDQDYNRSVITIAASVDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E   G HP LG VD I ++PLA   ++E   
Sbjct  70   -----------LNHAVLAACMEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA       +VP   V+L+ +A
Sbjct  119  MARSLAETL--ILRVPGSSVFLFGEA  142



>emb|CEF99013.1| Formiminotransferas, N-and C-terminal subdomains [Ostreococcus 
tauri]
Length=336

 Score = 74.7 bits (182),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 50/139 (36%), Positives = 71/139 (51%), Gaps = 15/139 (11%)
 Frame = +1

Query  151  LCCKLHISESRNREALESIQRAAKHDP---ETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            L   +++SE R    L++I+R A+         +VN+F DREYNR  +TL     H  T 
Sbjct  30   LAAVVYVSEGRRTVVLDAIERVARDASLKNRVALVNVFVDREYNRTGFTLAG--AH--TD  85

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G      +  T + IA  + + I+   H   HPRLGVVD ++ H L R   D  A LA+ 
Sbjct  86   G------IANTALDIAKKSLELIDFSTHDATHPRLGVVDHVSCHEL-RGERDAGAALARN  138

Query  502  LAAEFGNRFQVPVYLYNDA  558
            +    G++  VPV LY DA
Sbjct  139  IGRGLGDQ-GVPVKLYGDA  156



>ref|WP_014224205.1| glutamate formiminotransferase [Tannerella forsythia]
 gb|AEW20298.1| glutamate formimidoyltransferase [Tannerella forsythia ATCC 43037]
Length=298

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR+  T+V         G 
Sbjct  4    IIECVPNFSEGRDKEKIEKIVECFRGKDNVKLLDYSNDEDHNRLVVTVV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  HSG HPR+G VD +   P+   ++DEA  L+K +A
Sbjct  55   P--APLRDAVIEAIGVAVKLIDLNKHSGQHPRMGAVDVVPFIPIKNTTMDEAIALSKEVA  112

Query  508  AEFGNRFQVPVYLY  549
             +   R+ +PV+LY
Sbjct  113  EQVAQRYALPVFLY  126



>ref|XP_007494643.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X1 [Monodelphis domestica]
 ref|XP_007494644.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like isoform 
X2 [Monodelphis domestica]
Length=272

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E I +AA      K   E  ++NIF D +YNR   T+ + +  
Sbjct  10   LAVCLLNISEARRKNLVEKIAKAALFEENGKEYSEVTVLNIFSDHDYNRSVITIAATIEK  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E+  G HP LG VD I ++PL+   ++E   
Sbjct  70   -----------LGSAVLATCVEAFQVIDMEVQEGIHPCLGAVDLIPIYPLSEVGVEECGM  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +     QVP   V+L+ +A
Sbjct  119  VARSLAEKL--TIQVPGCSVFLFGEA  142



>ref|WP_037993237.1| glutamate formiminotransferase, partial [Tannerella sp. oral 
taxon BU063]
 gb|ETK13483.1| glutamate formiminotransferase, partial [Tannerella sp. oral 
taxon BU063 isolate Cell 8/11]
Length=199

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR+  T+V         G 
Sbjct  4    IMECVPNFSEGRDKEKIEKIVDCFRGKDNVKLLDYSNDEDHNRLVVTVV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  HSG HPR+G VD +   P+   + +EA  L+K +A
Sbjct  55   P--KPLRDAVLEAIGKAVQLIDLNKHSGQHPRMGAVDVVPFIPIKNTTTEEAVALSKEVA  112

Query  508  AEFGNRFQVPVYLY  549
            A+   R+ VPV+LY
Sbjct  113  AQVAERYGVPVFLY  126



>ref|XP_010800514.1| PREDICTED: formiminotransferase N-terminal subdomain-containing 
protein isoform X4 [Bos taurus]
Length=201

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = +1

Query  121  EKKSVMQSV-----LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDRE  267
            +KK  M S      L  C L+ISE+R +  +E+I +AA      +  PE  ++N+F D E
Sbjct  2    KKKITMSSCRVGLHLAACLLNISEARKKSIVENIAKAALLERNGQRHPEVSVLNVFSDPE  61

Query  268  YNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDIT  447
            YNR   T+ + +             L  +V+A    A+  I++E+  G HP LG VD I 
Sbjct  62   YNRSVITIAASIDE-----------LGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIP  110

Query  448  VHPLARASLDEAAWLAKRLAAEFGNRFQVP---VYLYNDA  558
            ++PL+   ++E   +A+ LA        VP   V+L+ +A
Sbjct  111  IYPLSGVGVEECGAVARSLAENL--VLSVPGCSVFLFGEA  148



>ref|WP_044826137.1| glutamate formiminotransferase [Clostridium aceticum]
 gb|KJF25847.1| glutamate formiminotransferase [Clostridium aceticum]
Length=299

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 73/140 (52%), Gaps = 12/140 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN   +E I    +      I++   D+++NR   T++         GS
Sbjct  4    LIECVPNFSEGRNTGIVEEIIDEVRKIEGITILDYSSDKDHNRTVLTMI---------GS  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++  +  A  A + I++  H GAHPR+G  D I   P+A  +++E   +AK + 
Sbjct  55   P--ERIKEAAINSARKAAELIDMSKHEGAHPRMGATDVIPFTPVAHVTIEECIEVAKEVG  112

Query  508  AEFGNRFQVPVYLYNDAHPT  567
            AE GN +++PVYLY DA  T
Sbjct  113  AEIGN-WEIPVYLYEDAATT  131



>ref|WP_038049446.1| formimidoyltransferase-cyclodeaminase [Thermoanaerobaculum aquaticum]
 gb|KDA53602.1| formimidoyltransferase-cyclodeaminase [Thermoanaerobaculum aquaticum]
Length=564

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/137 (33%), Positives = 71/137 (52%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  +ISE +  E  E + +A    P   ++N+    E NR   T++++V      G 
Sbjct  3    LVECVPNISEGKRPEVYEKVAQAVTKVPGVTLLNVDPGAETNR---TVITFV------GE  53

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    + +    +AA A++ I++  H GAHPR+G VD +   P++  ++D+   LAKRL 
Sbjct  54   PEA--VLEAAYQLAATAFELIDMRQHQGAHPRIGAVDVVPFVPISGVTMDDCVALAKRLG  111

Query  508  AEFGNRFQVPVYLYNDA  558
                  F VPVYLY  A
Sbjct  112  ERLATDFAVPVYLYEFA  128



>ref|WP_018027672.1| MULTISPECIES: hypothetical protein [Porphyromonas]
 emb|CCY12346.1| formiminotransferase-cyclodeaminase [Porphyromonas sp. CAG:1061]
Length=324

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 12/141 (9%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M+ ++ C   + SE RN+E +E+I    ++    V+++   D ++NR+  TLV       
Sbjct  1    MKKIMECVP-NFSEGRNKEVMEAILAPLRNKENVVLLDYSNDEDHNRMVVTLV-------  52

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G P   PL++ V+     A   I+L  H G HPR+G VD I   P+   + +EA  L+
Sbjct  53   --GEP--QPLKEAVLEAVRVAVSKIDLTKHQGQHPRMGAVDVIPFIPIKDVTKEEAIELS  108

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
              +    G    VPV+LY D+
Sbjct  109  NEVGRIIGEEIGVPVFLYEDS  129



>gb|EHR76717.1| glutamate formiminotransferase / formiminotetrahydrofolate cyclodeaminase 
[uncultured marine group II euryarchaeote]
Length=363

 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/134 (34%), Positives = 66/134 (49%), Gaps = 11/134 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  +ISE R+ E ++ I  AA +     ++ +  D +YNR   T+          GSP  
Sbjct  22   CVPNISEGRDEEKIQRIVHAASNIVGCAVLGVEPDSDYNRTVITI---------AGSP--  70

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
             P+ +   A+  AA + I++  HSG HPRLG VD     PL   S++E   +A+ LA + 
Sbjct  71   GPVSEAAFALVCAAIEEIDMREHSGEHPRLGAVDVCPFIPLQGVSMEECVQMARDLAEKV  130

Query  517  GNRFQVPVYLYNDA  558
                 VP YLY  A
Sbjct  131  ATECSVPTYLYGHA  144



>ref|NP_001089428.1| uncharacterized protein LOC734478 [Xenopus laevis]
 gb|AAH94471.1| MGC115273 protein [Xenopus laevis]
Length=332

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 74/144 (51%), Gaps = 18/144 (13%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHD------PETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L++SE+R ++ +E I RAA +D      P T ++NIF D +YNR        VI 
Sbjct  10   LAACLLNVSEARKKDVVEKIARAALYDKNGKVHPNTTVLNIFSDYDYNR-------SVIT  62

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
             A T   I     ++VV+     +  I+L  H G HP LG +D + ++PL+  +LD+   
Sbjct  63   IAATAEQI----GESVVSACIEGFASIDLSEHHGIHPCLGAIDLVPIYPLSGVTLDKCGE  118

Query  490  LAKRLAAEFGNRF-QVPVYLYNDA  558
            +A+ +A        +  ++L+  A
Sbjct  119  VARDIAEGMATAIPECSIFLFGHA  142



>ref|WP_036791238.1| glutamate formiminotransferase [Porphyromonas canoris]
 gb|KGN91773.1| glutamate formiminotransferase [Porphyromonas canoris]
Length=301

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKEIIEKIVQPFRATDGVRLLDYSSDEDHNRTVVTVV---------GD  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++D+A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQQHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVDDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  +R+ +PV+LY
Sbjct  116  AEIASRYNIPVFLY  129



>ref|WP_036867614.1| glutamate formiminotransferase [Porphyromonas canoris]
 gb|KGL52789.1| glutamate formiminotransferase [Porphyromonas canoris]
Length=301

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKEIIEKIVQPFRATDGVRLLDYSSDEDHNRTVVTVV---------GD  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++D+A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQQHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVDDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  +R+ +PV+LY
Sbjct  116  AEIASRYNIPVFLY  129



>ref|WP_008779292.1| glutamate formiminotransferase [Bacteroides sp. 3_1_19]
 gb|EFI10622.1| glutamate formimidoyltransferase [Bacteroides sp. 3_1_19]
Length=301

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 71/134 (53%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+ R +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRRCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGARYAVPVFLY  129



>ref|WP_036848090.1| glutamate formiminotransferase [Porphyromonas sp. COT-108 OH1349]
 gb|KGN67770.1| glutamate formiminotransferase [Porphyromonas sp. COT-108 OH1349]
Length=301

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKEIIEKIVQPFRATDGVRLLDYSSDEDHNRTVVTVV---------GD  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++D+A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQQHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVDDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  +R+ +PV+LY
Sbjct  116  AEIASRYNIPVFLY  129



>ref|WP_006301066.1| glutamate formiminotransferase [Aminomonas paucivorans]
 gb|EFQ23862.1| glutamate formiminotransferase [Aminomonas paucivorans DSM 12260]
Length=307

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 71/141 (50%), Gaps = 11/141 (8%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M   L+ C  + SE R  E +E+I    K+ P   + +   D ++NR+   +VS V H A
Sbjct  1    MGKPLIECVPNFSEGRRPEVIEAIVAPFKNRPGVYLFDYRADEDHNRL---VVSLVGHPA  57

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
                     +Q++++  A  A D I++  H GAHPR+G VD +   P+A  +++E   LA
Sbjct  58   E--------IQESLLEAAKVARDHIDMNTHQGAHPRIGAVDVVPFTPIANITMEECVELA  109

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
            +     +     +PVY Y DA
Sbjct  110  RSFGKRYVEETGIPVYYYEDA  130



>ref|XP_009236219.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Pongo 
abelii]
 ref|XP_009236220.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Pongo 
abelii]
Length=328

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  P+  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYNRSVITIATSVDK  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL+  +++E   
Sbjct  70   -----------LGSSVLAACLEAFQAIDMEVEEGIHPCLGAVDLIPIYPLSGVTVEECGV  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +      VP   V+L+ +A
Sbjct  119  VARSLAEDL--VLHVPGCSVFLFGEA  142



>ref|WP_036864217.1| glutamate formiminotransferase [Porphyromonas sp. COT-108 OH2963]
 gb|KGN95639.1| glutamate formiminotransferase [Porphyromonas sp. COT-108 OH2963]
Length=301

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKEIIEKIVQPFRATDGVRLLDYSSDEDHNRTVVTVV---------GD  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++D+A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQQHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVDDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  +R+ +PV+LY
Sbjct  116  AEIASRYNIPVFLY  129



>ref|WP_040193308.1| glutamate formiminotransferase [Clostridium sp. CL-6]
Length=298

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E +E++    +      +++   D ++NR   T+V         G 
Sbjct  4    IIECIPNFSEGRDLEKVEAVVNVFRGVQGVKLLDYSSDADHNRTVVTVV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    L+ T++ +A   Y+ I++  HSG HPR+G +D +   P+   +++E   +A R+ 
Sbjct  55   P--EALEATIINMAEKVYENIDMSKHSGGHPRMGALDVVPFVPIDGVTMEECVEMANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G RF +PVYLY  A
Sbjct  113  KTIGERFNIPVYLYEKA  129



>ref|WP_018107384.1| hypothetical protein [Porphyromonas bennonis]
Length=325

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 70/141 (50%), Gaps = 12/141 (9%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M+ ++ C   + SE RN E +E+I    KH     +++   D ++NR+  TLV       
Sbjct  1    MKKIMECVP-NFSEGRNMEVMEAILEPFKHTEGMTLLDWSHDEDHNRMVVTLV-------  52

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G P    L+ +V+     A   I+L  H+G HPR+G VD I   P+   + +EA  L+
Sbjct  53   --GEP--EALKTSVIEAVKIAVKKIDLNHHTGQHPRMGAVDVIPFVPVKGVTQEEAIELS  108

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
            K +    G    +PV+LY D+
Sbjct  109  KEVGKIIGEEIGIPVFLYEDS  129



>ref|XP_005676386.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Capra 
hircus]
Length=328

 Score = 73.2 bits (178),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      +  PE  ++NIF D EYNR   T+ + +  
Sbjct  10   LAACLLNISEARKKYVVENIAKAALLERNGQSHPEVSVLNIFSDPEYNRSVITIAASIDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL+   ++E   
Sbjct  70   -----------LGNSVLAACLEAFQSIDMEIQEGIHPCLGAVDLIPIYPLSGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA        VP   V+L+ +A
Sbjct  119  VARSLAENL--VLSVPGCSVFLFGEA  142



>ref|WP_037984075.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063]
 gb|ETK05132.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063 
isolate Cell 5]
Length=298

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR+  T+V         G 
Sbjct  4    IMECVPNFSEGRDKEKIEKIVDCFRGKDNVKLLDYSNDEDHNRLVVTVV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  HSG HPR+G VD +   P+   + +EA  L+K +A
Sbjct  55   P--NPLRDAVLEAVGKAVQLIDLNKHSGQHPRMGAVDVVPFIPIKNTTTEEAIALSKEVA  112

Query  508  AEFGNRFQVPVYLY  549
            A+   R+ VPV+LY
Sbjct  113  AQVAERYGVPVFLY  126



>ref|XP_010800512.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X2 [Bos 
taurus]
Length=334

 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = +1

Query  121  EKKSVMQSV-----LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDRE  267
            +KK  M S      L  C L+ISE+R +  +E+I +AA      +  PE  ++N+F D E
Sbjct  2    KKKITMSSCRVGLHLAACLLNISEARKKSIVENIAKAALLERNGQRHPEVSVLNVFSDPE  61

Query  268  YNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDIT  447
            YNR   T+ + +             L  +V+A    A+  I++E+  G HP LG VD I 
Sbjct  62   YNRSVITIAASIDE-----------LGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIP  110

Query  448  VHPLARASLDEAAWLAKRLAAEFGNRFQVP---VYLYNDA  558
            ++PL+   ++E   +A+ LA        VP   V+L+ +A
Sbjct  111  IYPLSGVGVEECGAVARSLAENL--VLSVPGCSVFLFGEA  148



>ref|WP_037979443.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063]
 gb|ETK00545.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063 
isolate Cell 2]
 gb|ETK08954.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063 
isolate Cell 1/3]
 gb|ETK10360.1| glutamate formiminotransferase [Tannerella sp. oral taxon BU063 
isolate Cell 6/7/9]
Length=298

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R++E +E I    +      +++   D ++NR+  T+V         G 
Sbjct  4    IMECVPNFSEGRDKEKIEKIVDCFRGKDNVKLLDYSNDEDHNRLVVTVV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  HSG HPR+G VD +   P+   + +EA  L+K +A
Sbjct  55   P--KPLRDAVLEAIGKAVQLIDLNKHSGQHPRMGAVDVVPFIPIKNTTTEEAVALSKEVA  112

Query  508  AEFGNRFQVPVYLY  549
            A+   R+ VPV+LY
Sbjct  113  AQVAERYGVPVFLY  126



>ref|WP_029450965.1| glutamate formiminotransferase [Clostridium algidicarnis]
Length=301

 Score = 72.4 bits (176),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 71/140 (51%), Gaps = 11/140 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R+ + +E I  + +      +++   D ++NR+  T+V         G 
Sbjct  7    LMECVPNFSEGRDIKKIEKILESFRGKQGVKLLDYSRDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            PI   L+  V+     A + I++ +H G HPR+G  D +   P+   +++EA  LAK LA
Sbjct  58   PI--ALKNAVLEAMGTAIEIIDMRVHKGQHPRMGATDVVPFIPIKNVTMEEAVELAKDLA  115

Query  508  AEFGNRFQVPVYLYNDAHPT  567
             E   ++ +P+YLY  A  T
Sbjct  116  KEVSEKYGLPIYLYEKAAST  135



>ref|WP_044231927.1| glutamate formiminotransferase [Porphyromonas sp. COT-290 OH3588]
 gb|KGO01424.1| glutamate formiminotransferase [Porphyromonas sp. COT-290 OH3588]
Length=301

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKETIELIVQPFRAAEGVRLLDYSSDEDHNRTVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++++A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQKHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVEDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  NR+ +PV+LY
Sbjct  116  AEIANRYDIPVFLY  129



>ref|WP_035288350.1| glutamate formiminotransferase [Clostridium sp. KNHs214]
Length=298

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/137 (28%), Positives = 72/137 (53%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I  A +      +++   D  +NR   ++V+++      G+
Sbjct  4    LVECIPNFSEGRNKEVVEKIVDAVRKTEGAKLLDYSSDASHNR---SVVTFI------GT  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    ++  +V +A   Y+ I++  H G HPR+G +D +   P+   +++E   +A R+ 
Sbjct  55   P--EAVENAMVNMAEKVYENIDMRNHKGEHPRMGALDVVPFVPITGVTMEECIEIANRVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G +F +PVYLY  A
Sbjct  113  KTIGEKFNIPVYLYEKA  129



>ref|XP_007126173.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Physeter 
catodon]
Length=328

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 46/145 (32%), Positives = 76/145 (52%), Gaps = 20/145 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA-------KHDPETVIVNIFEDREYNRINYTLVSYVI  306
            L  C L+ISE+R +  +E++ +AA       KH  E  ++NIF D+EYNR   T+ + V 
Sbjct  10   LAVCLLNISEARRKYIVENVAKAALLEKNGQKH-AEVSVLNIFSDQEYNRSVITIAASVA  68

Query  307  HDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAA  486
                        L  +++A    A+  I++E+  G HP LG VD I ++PL+   ++E  
Sbjct  69   E-----------LGNSILAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECG  117

Query  487  WLAKRLAAEFGNRFQ-VPVYLYNDA  558
             +A+ LA     R +   V+L+ +A
Sbjct  118  AVARSLAENLVQRVRGCSVFLFGEA  142



>ref|XP_010800513.1| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X3 [Bos 
taurus]
 tpg|DAA32516.1| TPA: formiminotransferase cyclodeaminase-like [Bos taurus]
Length=328

 Score = 72.0 bits (175),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      +  PE  ++N+F D EYNR   T+ + +  
Sbjct  10   LAACLLNISEARKKSIVENIAKAALLERNGQRHPEVSVLNVFSDPEYNRSVITIAASIDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL+   ++E   
Sbjct  70   -----------LGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA        VP   V+L+ +A
Sbjct  119  VARSLAENL--VLSVPGCSVFLFGEA  142



>ref|WP_043890086.1| glutamate formiminotransferase [Porphyromonas gingivalis]
Length=300

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R+RE +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDREKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>ref|WP_027637874.1| glutamate formiminotransferase [Clostridium cadaveris]
Length=297

 Score = 71.6 bits (174),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 43/137 (31%), Positives = 73/137 (53%), Gaps = 12/137 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I    +      +++   D ++NR   T++         G+
Sbjct  4    LVECVPNFSEGRNKEVVEKIVDEVRKIDGVKLLDYSSDEDHNRSVITMI---------GA  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ V+  +  A   I++  H GAHPR+G VD I   P++  +++E   LAK +A
Sbjct  55   P--EKIKEAVLNASKVAIGLIDMSKHQGAHPRMGAVDVIPFTPVSDITMEECIELAKEVA  112

Query  508  AEFGNRFQVPVYLYNDA  558
             EFG +  +PVYLY +A
Sbjct  113  EEFG-KLDIPVYLYEEA  128



>ref|XP_001089951.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Macaca 
mulatta]
 gb|EHH21563.1| hypothetical protein EGK_04664 [Macaca mulatta]
Length=328

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  P+  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYNRSVITIAASVDK  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD + ++PL+  +++E   
Sbjct  70   -----------LGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGVTVEECGV  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +      VP   V+L+ +A
Sbjct  119  VARSLAEDLVR--HVPGCSVFLFGEA  142



>gb|EHH55057.1| hypothetical protein EGM_04188 [Macaca fascicularis]
Length=328

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  P+  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYNRSVITIAASVDK  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD + ++PL+  +++E   
Sbjct  70   -----------LGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGVTVEECGV  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +      VP   V+L+ +A
Sbjct  119  VARSLAEDLVR--HVPGCSVFLFGEA  142



>ref|XP_004005452.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Ovis aries]
Length=328

 Score = 72.0 bits (175),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 75/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      +  PE  ++NIF D EYNR   T+ + +  
Sbjct  10   LAACLLNISEARKKYVVENIAKAALLERNGQRHPEVSVLNIFSDPEYNRSVITIAASIDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL+   ++E   
Sbjct  70   -----------LGNSVLAACLEAFQSIDMEIQEGIHPCLGAVDLIPIYPLSGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA        VP   V+L+ +A
Sbjct  119  VARSLAENLIR--SVPGCSVFLFGEA  142



>ref|XP_006029822.1| PREDICTED: formiminotransferase N-terminal subdomain-containing 
protein-like [Alligator sinensis]
Length=228

 Score = 70.5 bits (171),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 47/146 (32%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHD------PETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R ++ +E I +AA ++      P+  ++NIF D +YNR   T+      
Sbjct  10   LAACLLNISEARKKDVVEKIAKAAIYNDNGQKHPQATVLNIFSDYDYNRSVITI------  63

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                 +PI   L   VV+    A+  I+L +H G HP LG VD + ++PL    L+E   
Sbjct  64   ----AAPIDM-LGDYVVSACIEAFKSIDLTVHEGIHPCLGAVDLVPIYPLLDVDLEECGT  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ +A        VP   V+L+  A
Sbjct  119  VARSIAESL--TLHVPGCSVFLFGHA  142



>ref|WP_039428991.1| glutamate formiminotransferase [Porphyromonas sp. UQD_349_COT-052_OH4946]
 gb|KGL55363.1| glutamate formiminotransferase [Porphyromonas sp. COT-052 OH4946]
Length=300

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL+  V+     A + I+L  HSG HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLRDAVIEAVGIAVELIDLTKHSGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>ref|WP_013048919.1| glutamate formiminotransferase [Aminobacterium colombiense]
 gb|ADE57656.1| glutamate formiminotransferase [Aminobacterium colombiense DSM 
12261]
Length=306

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 68/127 (54%), Gaps = 11/127 (9%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + S  R++E  E++    ++     ++  F D ++NR   T++  +      G P   PL
Sbjct  12   NFSNGRDKEVYEAVVDQIRNAKGVKLIGYFPDADFNR---TVIECL------GEP--GPL  60

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++ ++ +AA +Y+ I++E   G HPR+G  D I + PL   +L+E   LA+ +  E   R
Sbjct  61   KEALLNMAAKSYELIDMEKQEGKHPRIGAQDTIPIFPLHNITLEECTALAEEIGKEVWER  120

Query  526  FQVPVYL  546
            FQVPVY 
Sbjct  121  FQVPVYF  127



>ref|WP_008772698.1| MULTISPECIES: glutamate formiminotransferase [Bacteroidales]
 gb|EEY83305.1| glutamate formimidoyltransferase [Bacteroides sp. 2_1_33B]
 gb|EKN27926.1| glutamate formiminotransferase [Parabacteroides sp. D25]
 gb|KEJ85260.1| glutamate formiminotransferase [Porphyromonas sp. 31_2]
Length=301

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+   +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRGCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGTRYAVPVFLY  129



>ref|WP_022193267.1| MULTISPECIES: glutamate formiminotransferase [Parabacteroides]
 emb|CDB48917.1| glutamate formiminotransferase [Parabacteroides sp. CAG:2]
 gb|KDS63256.1| glutamate formiminotransferase [Parabacteroides distasonis str. 
3999B T(B) 6]
 gb|KDS71445.1| glutamate formiminotransferase [Parabacteroides distasonis str. 
3999B T(B) 4]
Length=301

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+   +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRGCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGTRYAVPVFLY  129



>ref|WP_032120724.1| glutamate formiminotransferase [Clostridium sp. LF2]
Length=301

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/137 (30%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ + +E I  A +      +++   D ++NR+  T+V         G 
Sbjct  7    IIECVPNFSEGRDLKKIEKIIGAFRGKEGVKLLDYSRDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            PI   L+  V+     A + I++  H G HPR+G  D +   P+   +++EA  LAK+LA
Sbjct  58   PI--ALKDAVLEAMGKAIEVIDMREHKGQHPRMGATDVVPFIPIKNVTMEEAIELAKQLA  115

Query  508  AEFGNRFQVPVYLYNDA  558
             E   +F +P+YLY  A
Sbjct  116  KEVSEKFNLPIYLYEKA  132



>ref|WP_005859153.1| MULTISPECIES: glutamate formiminotransferase [Parabacteroides]
 gb|ABR45343.1| formiminotransferase-cyclodeaminase [Parabacteroides distasonis 
ATCC 8503]
 gb|EEU53292.1| glutamate formimidoyltransferase [Parabacteroides sp. D13]
 gb|EKN21092.1| glutamate formiminotransferase [Parabacteroides distasonis CL03T12C09]
Length=301

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+   +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRGCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGTRYAVPVFLY  129



>ref|WP_039417393.1| glutamate formiminotransferase [Porphyromonas gingivalis]
 gb|AIJ36401.1| glutamate formiminotransferase [Porphyromonas gingivalis]
Length=300

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 43/136 (32%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C    SE R+RE +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPSFSEGRDREKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>ref|XP_005574989.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Macaca 
fascicularis]
Length=517

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  P+  ++NIF D++YNR   T+ + V  
Sbjct  199  LAACLLNISEARRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYNRSVITIAASVDK  258

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD + ++PL+  +++E   
Sbjct  259  -----------LGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGVTVEECGV  307

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +      VP   V+L+ +A
Sbjct  308  VARSLAEDLVR--HVPGCSVFLFGEA  331



>ref|WP_009528290.1| MULTISPECIES: glutamate formiminotransferase [unclassified Peptostreptococcaceae 
(miscellaneous)]
 gb|EJU19940.1| glutamate formimidoyltransferase [Peptostreptococcaceae bacterium 
OBRC8]
 gb|EJZ44289.1| glutamate formiminotransferase [Peptostreptococcaceae bacterium 
CM2]
Length=297

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 12/137 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I    +   E  +++   D ++NR   T++         G 
Sbjct  4    LVECVPNFSEGRNKEVVEKIVDEVRKVKEVTLLDYSSDEDHNRSVVTMI---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ V+  A  A   I++ +H GAHPR G VD +   P++  +++E   LA  + 
Sbjct  55   P--AKVKEAVINAAKVAVSLIDMSVHQGAHPRFGAVDVVPFTPVSDITMEECVELANEVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G    VPVYLY DA
Sbjct  113  KAIG-EMGVPVYLYEDA  128



>ref|WP_009525133.1| MULTISPECIES: glutamate formiminotransferase [unclassified Peptostreptococcaceae 
(miscellaneous)]
 gb|EHL10683.1| glutamate formiminotransferase [Peptostreptococcaceae bacterium 
ACC19a]
 gb|EHL15218.1| glutamate formiminotransferase [Peptostreptococcaceae bacterium 
CM5]
Length=297

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 68/137 (50%), Gaps = 12/137 (9%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I    +   E  +++   D ++NR   T++         G 
Sbjct  4    LVECVPNFSEGRNKEVVEKIVDEVRKVKEVTLLDYSSDEDHNRSVVTMI---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    +++ V+  A  A   I++ +H GAHPR G VD +   P++  +++E   LA  + 
Sbjct  55   P--AKVKEAVINAAKVAVSLIDMSVHQGAHPRFGAVDVVPFTPVSDITMEECVELANEVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G    VPVYLY DA
Sbjct  113  KAIG-EMGVPVYLYEDA  128



>dbj|BAK25597.1| formiminotransferase-cyclodeaminase [Porphyromonas gingivalis 
TDC60]
 gb|ERJ81044.1| glutamate formimidoyltransferase [Porphyromonas gingivalis F0185]
 gb|ERJ88444.1| glutamate formimidoyltransferase [Porphyromonas gingivalis W4087]
Length=294

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 42/131 (32%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE R+RE +E I    +      ++N   D ++NR+  T+V         G P  
Sbjct  3    CVPNFSEGRDREKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------GEP--  51

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
             PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK +    
Sbjct  52   EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKEVGRTI  111

Query  517  GNRFQVPVYLY  549
            G ++ VPV+LY
Sbjct  112  GEKYGVPVFLY  122



>ref|XP_002703730.2| PREDICTED: formimidoyltransferase-cyclodeaminase isoform X1 [Bos 
taurus]
Length=475

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 50/160 (31%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = +1

Query  121  EKKSVMQSV-----LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDRE  267
            +KK  M S      L  C L+ISE+R +  +E+I +AA      +  PE  ++N+F D E
Sbjct  143  QKKITMSSCRVGLHLAACLLNISEARKKSIVENIAKAALLERNGQRHPEVSVLNVFSDPE  202

Query  268  YNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDIT  447
            YNR   T+ + +             L  +V+A    A+  I++E+  G HP LG VD I 
Sbjct  203  YNRSVITIAASIDE-----------LGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIP  251

Query  448  VHPLARASLDEAAWLAKRLAAEFGNRFQVP---VYLYNDA  558
            ++PL+   ++E   +A+ LA        VP   V+L+ +A
Sbjct  252  IYPLSGVGVEECGAVARSLAENL--VLSVPGCSVFLFGEA  289



>ref|XP_003764132.1| PREDICTED: uncharacterized protein LOC100922037 [Sarcophilus 
harrisii]
Length=337

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 49/149 (33%), Positives = 74/149 (50%), Gaps = 23/149 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E I +AA      K   E  ++NIF D +YNR   T+   V +
Sbjct  53   LAACLLNISEARRKNVVEKIAKAALFEENGKEHSEVTVLNIFSDYDYNRSVITIAGPVEN  112

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL    + E   
Sbjct  113  -----------LVNSVIAACVEAFQVIDMEVQEGIHPCLGAVDLIPIYPLFGVGVKECGM  161

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA-HP  564
            +A+ LA +      VP   V+L+ +A HP
Sbjct  162  VARSLAEKLTT--HVPGCSVFLFGEADHP  188



>ref|WP_026292055.1| glutamate formiminotransferase [Porphyromonas gulae]
Length=300

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL+  V+     A + I+L  HSG HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLRDAVIEAVGIAVELIDLTKHSGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ +PV+LY
Sbjct  113  VGRTIGEKYGIPVFLY  128



>ref|WP_039442196.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN80136.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN87322.1| glutamate formiminotransferase [Porphyromonas gulae]
Length=300

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL+  V+     A + I+L  HSG HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLRDAVIEAVGIAVELIDLTKHSGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ +PV+LY
Sbjct  113  VGRTIGEKYGIPVFLY  128



>ref|WP_013278885.1| glutamate formiminotransferase [Acetohalobium arabaticum]
 gb|ADL13440.1| glutamate formiminotransferase [Acetohalobium arabaticum DSM 
5501]
Length=300

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 75/140 (54%), Gaps = 11/140 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            +L C  + SE ++ E +E I +  K      +++   D+++NR+  T++         GS
Sbjct  4    ILECIPNFSEGQDEEKIEKIVQPFKDISGVKLLDYSADKDHNRLVVTMI---------GS  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    L+++V+     A D I++  H+G HPR+G VD +   P+   +++EA  LA  +A
Sbjct  55   P--DALKKSVLEAMEIAVDLIDMNEHAGEHPRMGAVDVVPFTPVRGVTMEEAVELANEVA  112

Query  508  AEFGNRFQVPVYLYNDAHPT  567
             E   + ++P+YLY +A  T
Sbjct  113  QEASEKMELPIYLYEEAATT  132



>ref|WP_039418923.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGL48776.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN69128.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN74656.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN77618.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN88284.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGO03398.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGO05337.1| glutamate formiminotransferase [Porphyromonas gulae]
Length=300

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL+  V+     A + I+L  HSG HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLRDAVIEAVGIAVELIDLTKHSGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ +PV+LY
Sbjct  113  VGRTIGEKYGIPVFLY  128



>ref|XP_006078266.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Bubalus 
bubalis]
Length=443

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 51/160 (32%), Positives = 80/160 (50%), Gaps = 27/160 (17%)
 Frame = +1

Query  121  EKKSVMQSV-----LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDRE  267
            +KK  M S      L  C L+ISE+R +  +E+I +AA      +  PE  ++NIF D E
Sbjct  111  QKKITMSSCRVGLRLAACLLNISEARKKYIVENIVKAALLERNGQRHPEVSVLNIFSDPE  170

Query  268  YNRINYTLVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDIT  447
            YNR   T+ + +             L  +V+A    A+  I++E+  G HP LG VD I 
Sbjct  171  YNRSVITVAASIDE-----------LGNSVLAACLEAFQSIDMEVQEGIHPFLGAVDLIP  219

Query  448  VHPLARASLDEAAWLAKRLAAEFGNRFQVP---VYLYNDA  558
            ++PL+   ++E   +A+ LA        VP   V+L+ +A
Sbjct  220  IYPLSGVGVEECGAVARSLAENL--VLSVPGCSVFLFGEA  257



>ref|XP_005873646.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Myotis 
brandtii]
Length=315

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  PE  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKHVVENIAKAALLGENGKKRPEVSVLNIFSDQDYNRSVITIAASVDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E   G HP LG VD I ++PLA   ++E   
Sbjct  70   -----------LNHAVLAACMEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGA  118

Query  490  LAK  498
            +A+
Sbjct  119  MAR  121



>ref|WP_044188335.1| glutamate formiminotransferase [Porphyromonas sp. COT-290 OH860]
 gb|KGN84589.1| glutamate formiminotransferase [Porphyromonas sp. COT-290 OH860]
Length=301

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE RN+E +E I +  +      +++   D ++NR   T+V         G 
Sbjct  7    LMECVPNFSEGRNKETIELIVQPFRATEGVRLLDYSSDEDHNRTVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A   I+L  H G HPR+G VD +   P+   ++++A  L+K + 
Sbjct  58   P--EPLKAAVLEAIGIAQKHIDLTKHEGQHPRMGAVDVVPFIPIKNVTVEDAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
            AE  +R+ +PV+LY
Sbjct  116  AEIASRYDIPVFLY  129



>ref|XP_010859231.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Bison 
bison bison]
Length=328

 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 74/146 (51%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      +  PE  ++N+F D EYNR   T+   +  
Sbjct  10   LAACLLNISEARKKCIVENIAKAALLERNGQRHPEISVLNVFSDPEYNRSVITIAGSIDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD I ++PL+   ++E   
Sbjct  70   -----------LGNSVLAACLEAFQSIDMEVQEGIHPCLGAVDLIPIYPLSGVGVEECGA  118

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA        VP   V+L+ +A
Sbjct  119  VARSLAENL--VLSVPGCSVFLFGEA  142



>ref|WP_044824145.1| glutamate formiminotransferase [Clostridium aceticum]
 gb|KJF27469.1| glutamate formiminotransferase [Clostridium aceticum]
Length=301

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 69/140 (49%), Gaps = 11/140 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            +L C  + SE ++ + +E I  A +      +++   D ++NR   T+V         G 
Sbjct  7    ILQCVPNFSEGKDLQKIEKIVDAFRGKEGVKLLDYSRDEDHNRAVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL+  V+     A + I++  H G HPR+G VD +   P+   S+ EA  LAK +A
Sbjct  58   P--QPLKNAVIEAIGIAIEVIDMTKHEGQHPRMGAVDVVPFIPITNVSMTEAVELAKEVA  115

Query  508  AEFGNRFQVPVYLYNDAHPT  567
             E   ++ +P+YLY  A  T
Sbjct  116  EEASKKYNLPIYLYEKAAST  135



>ref|WP_012449199.1| glutamate formiminotransferase [Natranaerobius thermophilus]
 gb|ACB86366.1| glutamate formiminotransferase [Natranaerobius thermophilus JW/NM-WN-LF]
Length=297

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 70/137 (51%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R++  +E I+   K      +++   D ++NR   T+V         G 
Sbjct  3    LIECVPNYSEGRDKAIIEKIESHFKDKEGIKLLDTAPDEDHNRTVITVV---------GE  53

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P   PL + V+A A  A++ I++  H G HPR+G  D I + P+   S++E   L+K +A
Sbjct  54   P--EPLVEAVIASAKTAHEEIDMTKHQGEHPRMGATDVIPLTPVKDISMEECVELSKDIA  111

Query  508  AEFGNRFQVPVYLYNDA  558
               G    +PV++Y ++
Sbjct  112  KRLGEDLDIPVFMYEES  128



>ref|WP_005874204.1| glutamate formiminotransferase [Porphyromonas gingivalis]
 gb|AAQ65543.1| formiminotransferase-cyclodeaminase-related protein [Porphyromonas 
gingivalis W83]
 gb|EIW93199.1| glutamate formimidoyltransferase [Porphyromonas gingivalis W50]
Length=300

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADTLAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>ref|WP_024821150.1| glutamate formiminotransferase [Aminobacterium mobile]
Length=298

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 69/141 (49%), Gaps = 11/141 (8%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M   L+ C  + SE R  + +E+I  AA+  P   +++   D ++NR   T V       
Sbjct  1    MSKKLVECVPNFSEGRRGDVVEAIVDAARGVPGVKVLDYSSDPDHNRTVLTFV-------  53

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G P    +++   A  + A + I++E H G HPR+G  D I   P+A  +++E   LA
Sbjct  54   --GDPE--SVKKAAFACCSKAAELIDMEKHHGEHPRIGATDVIPFIPVANVTMEECVELA  109

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
              L  + G +  +PVY Y +A
Sbjct  110  HSLGKDIGEKLNIPVYFYEEA  130



>ref|WP_017414678.1| glutamate formiminotransferase [Clostridium tunisiense]
Length=298

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 71/137 (52%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+++ +ESI    +      +++   D ++NR   T+V+ V      G+
Sbjct  4    IIECIPNFSEGRDKDKVESIVEVLRKAEGVKLLDYSSDADHNR---TVVTAV------GN  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    LQ  ++ +A   Y+ I++  H G HPR+G +D +   P+   +++E   +A  + 
Sbjct  55   P--EALQAAIINMAEKVYEVIDMSTHEGGHPRMGALDVVPFVPIEGVTMEECVEIANNVG  112

Query  508  AEFGNRFQVPVYLYNDA  558
               G RF VPVYLY  A
Sbjct  113  KVIGERFNVPVYLYEKA  129



>ref|WP_004584814.1| glutamate formiminotransferase [Porphyromonas gingivalis]
 dbj|BAG34152.1| formiminotransferase-cyclodeaminase [Porphyromonas gingivalis 
ATCC 33277]
 gb|EOA10564.1| glutamate formimidoyltransferase [Porphyromonas gingivalis JCVI 
SC001]
Length=300

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>ref|WP_043894149.1| glutamate formiminotransferase [Porphyromonas gingivalis]
Length=300

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 70/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ VPV+LY
Sbjct  113  VGRTIGEKYGVPVFLY  128



>gb|ELK24145.1| Formimidoyltransferase-cyclodeaminase [Myotis davidii]
Length=373

 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 65/125 (52%), Gaps = 17/125 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  PE  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKHVVENIAKAALLGENGKKRPEVSVLNIFSDQDYNRSVITIAASVDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E   G HP LG VD I ++PLA   ++E   
Sbjct  70   -----------LNHAVLAACVEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGA  118

Query  490  LAKRL  504
            +A+ L
Sbjct  119  VARML  123



>ref|WP_036611367.1| glutamate formiminotransferase [Parabacteroides distasonis]
 gb|KDS35352.1| glutamate formiminotransferase [Parabacteroides distasonis str. 
3776 D15 i]
 gb|KDS52627.1| glutamate formiminotransferase [Parabacteroides distasonis str. 
3776 Po2 i]
 gb|KDS74117.1| glutamate formiminotransferase [Parabacteroides distasonis str. 
3776 D15 iv]
Length=301

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+   +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRGCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGARYAVPVFLY  129



>ref|WP_044545280.1| glutamate formiminotransferase [Parabacteroides distasonis]
Length=301

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 41/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            ++ C  + SE R+ E ++ I    +      +++   D ++NR+  T+V         G 
Sbjct  7    IMECVPNFSEGRDLEKIDKIVAPFRAKTGVKLLDYSNDEDHNRLVVTVV---------GE  57

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P+   L+Q V+     A + I+L  HSG HPR+G VD +   P+   +++EA  L+K + 
Sbjct  58   PV--ALKQAVLEAIGVAVELIDLNKHSGQHPRMGAVDVVPFIPIRGCTMEEAIALSKEVG  115

Query  508  AEFGNRFQVPVYLY  549
             E G R+ VPV+LY
Sbjct  116  EEVGARYAVPVFLY  129



>ref|WP_024821683.1| glutamate formiminotransferase [Aminobacterium mobile]
Length=306

 Score = 70.5 bits (171),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/127 (31%), Positives = 67/127 (53%), Gaps = 11/127 (9%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + S  +++E +E++    +      ++  F D ++NR   T++  +      G P   PL
Sbjct  12   NFSNGKDKEVIEAVVDEIRKAKGVKLIGYFPDADFNR---TVIECL------GEP--EPL  60

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++ ++ +A  AY+ I++E   G HPR+G  D I V PL   SL+E   LA+ +  E   R
Sbjct  61   KKALLNMAGKAYELIDMEKQKGKHPRIGAQDTIPVFPLRNISLEECTELAEEIGKEIWER  120

Query  526  FQVPVYL  546
            +QVPVY 
Sbjct  121  YQVPVYF  127



>ref|XP_006111372.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Pelodiscus 
sinensis]
Length=628

 Score = 72.0 bits (175),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 67/150 (45%), Gaps = 11/150 (7%)
 Frame = +1

Query  109  PNSKEKKSVMQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYT  288
            P    KK+   S L+ C  + SE  N+E +++I +A    P  V++++      NR  YT
Sbjct  36   PRPGRKKTRTMSKLVECVPNFSEGNNKEVIDAIGQAIAQTPGCVLLDVDAGPSTNRTVYT  95

Query  289  LVSYVIHDATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARA  468
             V     D  TG+          +  A  A   I++  H G HPR+G +D     P+   
Sbjct  96   FVGSP-DDVVTGA----------LRAARVALQLIDMGKHKGEHPRMGALDVCPFVPVRNV  144

Query  469  SLDEAAWLAKRLAAEFGNRFQVPVYLYNDA  558
            ++DE    A R   +      VPVYLY +A
Sbjct  145  TMDECVCCATRFGQQLSEELGVPVYLYGEA  174



>ref|WP_012869662.1| glutamate formiminotransferase [Thermanaerovibrio acidaminovorans]
 ref|YP_003317429.1| glutamate formiminotransferase [Thermanaerovibrio acidaminovorans 
DSM 6589]
 gb|ACZ19147.1| glutamate formiminotransferase [Thermanaerovibrio acidaminovorans 
DSM 6589]
Length=306

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/141 (30%), Positives = 69/141 (49%), Gaps = 11/141 (8%)
 Frame = +1

Query  136  MQSVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDA  315
            M   L+ C  + SE R ++ +E+I    K  P   + +   D ++NR+  +LV       
Sbjct  1    MSKALVECVPNYSEGRRKDVIEAIVAPFKDRPGVYLFDYRADEDHNRLVVSLV-------  53

Query  316  TTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLA  495
              G+P    LQ  ++  A  A   I++  H GAHPR+G VD I   P++  +++E   LA
Sbjct  54   --GNP--DALQDALIDSAKIAQSHIDMNSHQGAHPRIGAVDVIPFTPISGITMEECVQLA  109

Query  496  KRLAAEFGNRFQVPVYLYNDA  558
            +     +    ++PVY Y DA
Sbjct  110  RSFGERYHQETKIPVYYYEDA  130



>ref|WP_039426191.1| glutamate formiminotransferase [Porphyromonas gulae]
 gb|KGN85393.1| glutamate formiminotransferase [Porphyromonas gulae]
Length=300

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/136 (31%), Positives = 69/136 (51%), Gaps = 11/136 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S ++ C  + SE R++E +E I    +      ++N   D ++NR+  T+V         
Sbjct  4    SRIMECVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------  54

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P   PL+  V+     A + I+L  HSG HPR+G VD I   P+   + ++A  LAK 
Sbjct  55   GEP--EPLRDAVLEAVGIAVELIDLTKHSGQHPRMGAVDVIPFIPIKNVTAEDADALAKE  112

Query  502  LAAEFGNRFQVPVYLY  549
            +    G ++ +PV+LY
Sbjct  113  VGRTIGEKYGIPVFLY  128



>ref|WP_006798984.1| glutamate formiminotransferase [Dysgonomonas gadei]
 gb|EGK02199.1| glutamate formiminotransferase [Dysgonomonas gadei ATCC BAA-286]
Length=300

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/134 (31%), Positives = 70/134 (52%), Gaps = 11/134 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE R+ E +E I  A +      +++   D+++NR+  T+V         G P  
Sbjct  9    CVPNFSEGRDLEKVEKIANAFRAKEGVKLLDYSTDKDHNRMVVTVV---------GEP--  57

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
              L++ V+     A + I+L  H G HPR+G VD +   P+   S++EA  L+K +A E 
Sbjct  58   ESLKKAVIEAIGIAVEIIDLNHHKGQHPRMGAVDVVPFIPIRNVSMEEAINLSKEVAKEV  117

Query  517  GNRFQVPVYLYNDA  558
             +++ +PVYLY  A
Sbjct  118  ADKYNLPVYLYEKA  131



>ref|XP_005070787.1| PREDICTED: formimidoyltransferase-cyclodeaminase [Mesocricetus 
auratus]
Length=541

 Score = 71.6 bits (174),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 45/142 (32%), Positives = 67/142 (47%), Gaps = 11/142 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S L+ C  + SE  N+E +++I RA    P  V++++      NR  YT V         
Sbjct  2    SQLVECVPNFSEGNNQEVIDAISRAISQTPGCVLLDVDAGPSTNRTVYTFV---------  52

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P  C ++  + A A  A+  I++  H+G HPR+G +D     P+   S+DE    AK 
Sbjct  53   GQP-ECVVEGALSA-ARTAWQLIDMSKHTGEHPRMGALDVCPFIPVRGVSMDECVLCAKA  110

Query  502  LAAEFGNRFQVPVYLYNDAHPT  567
                      VPVYLY +A  T
Sbjct  111  FGQRLAEELNVPVYLYGEAAQT  132



>ref|WP_044349867.1| glutamate formiminotransferase [Desulfarculus sp. SPR]
 gb|KIX13064.1| glutamate formiminotransferase [Desulfarculus sp. SPR]
Length=300

 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 71/130 (55%), Gaps = 11/130 (8%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + SE R+++ +E+I    +      +++ + D E+NR   T++  +      G P   PL
Sbjct  10   NFSEGRDQKIIEAIVSQVRETEGCKLIDFYPDAEFNR---TVIEAI------GRP--EPL  58

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++ ++ +A  +Y+ I++E   GAHPR+G  D I + PL   +L+E   LA+ +  E   R
Sbjct  59   KEAMLKMAGKSYELIDMEKQQGAHPRIGAQDTIPLFPLKGVTLEECVALAEEIGREIYKR  118

Query  526  FQVPVYLYND  555
            ++VPV+   +
Sbjct  119  YEVPVFFSGE  128



>ref|XP_007965245.1| PREDICTED: uncharacterized protein LOC103218311 [Chlorocebus 
sabaeus]
Length=521

 Score = 71.2 bits (173),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 46/146 (32%), Positives = 78/146 (53%), Gaps = 22/146 (15%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  P+  ++NIF D++YNR   T+ + V  
Sbjct  298  LAACLLNISEARRKYIVENIAKAALLDKNGKKHPQVSVLNIFSDQDYNRSVITIAASVDK  357

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L  +V+A    A+  I++E+  G HP LG VD + ++PL+  +++E   
Sbjct  358  -----------LGSSVLAACLEAFQAIDMEVQEGIHPCLGAVDLVPIYPLSGITVEECGV  406

Query  490  LAKRLAAEFGNRFQVP---VYLYNDA  558
            +A+ LA +      VP   V+L+ +A
Sbjct  407  VARSLAEDLVR--HVPGCSVFLFGEA  430



>ref|XP_006771874.1| PREDICTED: formimidoyltransferase-cyclodeaminase-like [Myotis 
davidii]
Length=341

 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 64/123 (52%), Gaps = 17/123 (14%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAA------KHDPETVIVNIFEDREYNRINYTLVSYVIH  309
            L  C L+ISE+R +  +E+I +AA      K  PE  ++NIF D++YNR   T+ + V  
Sbjct  10   LAACLLNISEARRKHVVENIAKAALLGENGKKRPEVSVLNIFSDQDYNRSVITIAASVDE  69

Query  310  DATTGSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAW  489
                       L   V+A    A+  I++E   G HP LG VD I ++PLA   ++E   
Sbjct  70   -----------LNHAVLAACVEAFRSIDMEAQEGIHPCLGAVDLIPIYPLAGVGVEECGA  118

Query  490  LAK  498
            +A+
Sbjct  119  VAR  121



>ref|WP_035134405.1| glutamate formiminotransferase [Clostridium sulfidigenes]
 gb|KEZ85458.1| glutamate formiminotransferase [Clostridium sulfidigenes]
Length=298

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/134 (28%), Positives = 69/134 (51%), Gaps = 11/134 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE R++E +E+I    +      +++   D ++NR   T+V         G P  
Sbjct  7    CIPNFSEGRDKEKIEAIVNVFRGVEGVKLLDYSSDADHNRSVVTVV---------GEP--  55

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
              L++ ++ +A   Y+ I++  H+GAHPR+G +D +   P+   +++E   +A R+    
Sbjct  56   EALEKAIINMAEKVYENIDMSAHTGAHPRMGALDVVPFVPIDGITMEECVEIANRVGKVI  115

Query  517  GNRFQVPVYLYNDA  558
              RF +PVYLY  A
Sbjct  116  AERFNIPVYLYEKA  129



>gb|ERJ65512.1| glutamate formimidoyltransferase [Porphyromonas gingivalis F0569]
Length=294

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE R++E +E I    +      ++N   D ++NR+  T+V         G P  
Sbjct  3    CVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------GEP--  51

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
             PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK +    
Sbjct  52   EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKEVGRTI  111

Query  517  GNRFQVPVYLY  549
            G ++ VPV+LY
Sbjct  112  GEKYGVPVFLY  122



>gb|ERJ64221.1| glutamate formimidoyltransferase [Porphyromonas gingivalis F0570]
 gb|ERJ66045.1| glutamate formimidoyltransferase [Porphyromonas gingivalis F0568]
 gb|ERJ81664.1| glutamate formimidoyltransferase [Porphyromonas gingivalis F0566]
 gb|ETA27331.1| glutamate formiminotransferase [Porphyromonas gingivalis SJD2]
Length=294

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 41/131 (31%), Positives = 67/131 (51%), Gaps = 11/131 (8%)
 Frame = +1

Query  157  CKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIY  336
            C  + SE R++E +E I    +      ++N   D ++NR+  T+V         G P  
Sbjct  3    CVPNFSEGRDKEKIEKIVNPFRTREGVKLLNYSNDEDHNRLVVTVV---------GEP--  51

Query  337  CPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEF  516
             PL++ V+     A + I+L  H+G HPR+G VD I   P+   + ++A  LAK +    
Sbjct  52   EPLREAVLEAVGIAVELIDLTKHTGQHPRMGAVDVIPFIPIKNVTAEDADALAKEVGRTI  111

Query  517  GNRFQVPVYLY  549
            G ++ VPV+LY
Sbjct  112  GEKYGVPVFLY  122



>ref|WP_004573051.1| glutamate formiminotransferase [Acetonema longum]
 gb|EGO65892.1| glutamate formiminotransferase [Acetonema longum DSM 6540]
Length=296

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 42/140 (30%), Positives = 70/140 (50%), Gaps = 11/140 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R R+A+++I    +      ++N+  D  +NR   T+V+++      G 
Sbjct  4    LVECVPNFSEGRRRDAIDAIVAEVRRVEGVKLLNVQSDASHNR---TVVTFI------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    ++Q      A A   I++E H+G HPR+G  D I   P+   +++E   LA  LA
Sbjct  55   P--AAVKQAAFQSCAKAAQLIDMEKHTGEHPRIGATDVIPFIPVKDVTMEECVALANELA  112

Query  508  AEFGNRFQVPVYLYNDAHPT  567
             E   +  +PVY+Y  A  T
Sbjct  113  QEIAQKLDIPVYMYEAAAKT  132



>ref|WP_011343625.1| MULTISPECIES: glutamate formiminotransferase [Carboxydothermus]
 gb|ABB14845.1| glutamate formiminotransferase [Carboxydothermus hydrogenoformans 
Z-2901]
Length=305

 Score = 69.3 bits (168),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 65/127 (51%), Gaps = 11/127 (9%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + SE R +E +E+I    ++ P   ++  F D ++NR    L+         G P   PL
Sbjct  10   NFSEGRRKEVVEAIVDQVRNVPGVKLIGYFPDADFNRTVVELI---------GKP--EPL  58

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++ ++ +AA A + I++E   G HPR+G  D I + P+   +L+E   LA+ +  E   R
Sbjct  59   KEALINMAAKAIELIDMEQQRGNHPRIGAQDTIPIFPMRNITLEECIQLAEEIGVELNKR  118

Query  526  FQVPVYL  546
              VP++ 
Sbjct  119  TGVPIFF  125



>ref|WP_009201259.1| glutamate formiminotransferase [Anaerobaculum hydrogeniformans]
 gb|EFD24848.1| glutamate formimidoyltransferase [Anaerobaculum hydrogeniformans 
ATCC BAA-1850]
Length=303

 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 42/137 (31%), Positives = 69/137 (50%), Gaps = 11/137 (8%)
 Frame = +1

Query  148  LLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGS  327
            L+ C  + SE R  + +E+I +  K      +++   D+++NR+  +LV         G 
Sbjct  4    LIECVPNYSEGRREDVIEAIVKPFKETKGCYLLDYRADKDHNRLVVSLV---------GE  54

Query  328  PIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLA  507
            P    L + +V  A  A   I+L  H GAHPR+G VD I   PL   +++E    +++ A
Sbjct  55   P--DALGKALVESAEIAIKNIDLNKHEGAHPRIGAVDVIPFVPLRNITMEECVEFSRKFA  112

Query  508  AEFGNRFQVPVYLYNDA  558
             +F  R  VPVY Y ++
Sbjct  113  EDFYRRTSVPVYFYEES  129



>ref|WP_013238800.1| MULTISPECIES: glutamate formiminotransferase [Clostridium]
 gb|ADK15210.1| glutamate formiminotransferase [Clostridium ljungdahlii DSM 13528]
 gb|AGY74470.1| glutamate formiminotransferase [Clostridium autoethanogenum DSM 
10061]
Length=298

 Score = 68.9 bits (167),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 39/139 (28%), Positives = 72/139 (52%), Gaps = 11/139 (8%)
 Frame = +1

Query  142  SVLLCCKLHISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATT  321
            S L+ C  + SE RN+E +ESI    +      +++   D+++NR   ++V+++      
Sbjct  2    SKLVECVPNFSEGRNKEIIESIVDEVRKTEGVKLLDYSSDKDHNR---SVVTFL------  52

Query  322  GSPIYCPLQQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKR  501
            G P    +++    +   A + I++  H GAHPR+G  D +   P+   + +E   ++K+
Sbjct  53   GGP--EEVEEAAFKLIKKAAELIDMRNHQGAHPRMGATDVVPFIPIKDVTTEECVEISKK  110

Query  502  LAAEFGNRFQVPVYLYNDA  558
            L    G   ++PVYLY DA
Sbjct  111  LGKRVGEELKIPVYLYEDA  129



>ref|WP_012065545.1| glutamate formiminotransferase [Alkaliphilus metalliredigens]
 gb|ABR50657.1| glutamate formiminotransferase [Alkaliphilus metalliredigens 
QYMF]
Length=302

 Score = 68.9 bits (167),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 71/130 (55%), Gaps = 11/130 (8%)
 Frame = +1

Query  166  HISESRNREALESIQRAAKHDPETVIVNIFEDREYNRINYTLVSYVIHDATTGSPIYCPL  345
            + S+ R +E +E++    ++     +V+   + ++NR   T++         G P   PL
Sbjct  13   NFSDGRRKEVIEAVVEPLRNVEGVKLVSYEPEHDFNRTVVTVI---------GEP--GPL  61

Query  346  QQTVVAIAAAAYDGINLELHSGAHPRLGVVDDITVHPLARASLDEAAWLAKRLAAEFGNR  525
            ++ ++ +AA +Y+ I++E   G+HPR+G  D I + P    S++E A LA+ + +E   R
Sbjct  62   KEALLNMAAKSYELISMEEQQGSHPRIGAQDTIPLFPFRNISIEECAKLAEEIGSEVYKR  121

Query  526  FQVPVYLYND  555
            F+VPVY   +
Sbjct  122  FEVPVYFSGE  131



Lambda      K        H        a         alpha
   0.316    0.131    0.374    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960