BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C09

Length=514
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

sp|Q07796.2|SODC_IPOBA  RecName: Full=Superoxide dismutase              284   4e-95   Ipomoea batatas [batate]
gb|KJB81930.1|  hypothetical protein B456_013G192900                    283   3e-94   Gossypium raimondii
sp|P27082.2|SODC_NICPL  RecName: Full=Superoxide dismutase              279   5e-93   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009624899.1|  PREDICTED: superoxide dismutase [Cu-Zn]            278   1e-92   Nicotiana tomentosiformis
emb|CAE54085.1|  superoxide dismutase                                   278   2e-92   Fagus sylvatica
ref|XP_006382702.1|  Cu/Zn superoxide dismutase family protein          276   6e-92   
gb|AJE26130.1|  superoxide dismutase                                    275   2e-91   Salix matsudana [tortured willow]
gb|ACI46676.1|  Cu/Zn superoxide dismutase                              275   2e-91   Gossypium arboreum [tree cotton]
gb|AFY26880.1|  CuZn superoxide dismutase                               275   2e-91   Ipomoea batatas [batate]
sp|O49073.1|SODC_PAUKA  RecName: Full=Superoxide dismutase              275   3e-91   Paulownia kawakamii
gb|ABS71028.2|  copper-zinc superoxide dismutase                        275   3e-91   Arnebia euchroma
ref|XP_011032547.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          275   3e-91   Populus euphratica
ref|XP_006342731.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          274   3e-91   
ref|XP_010320610.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1 is...    274   3e-91   
gb|AHN82532.1|  Cu/Zn superoxide dismutase                              274   4e-91   Populus alba x Populus glandulosa
gb|ABF48717.1|  cytoplasmic Cu/Zn-superoxide dismutase                  274   5e-91   Populus suaveolens [Mongolian poplar]
gb|ABK92960.1|  unknown                                                 273   1e-90   Populus trichocarpa [western balsam poplar]
gb|EYU43879.1|  hypothetical protein MIMGU_mgv1a015577mg                273   1e-90   Erythranthe guttata [common monkey flower]
gb|AFN42318.1|  Cu,Zn superoxide dismutase C95A                         273   1e-90   synthetic construct
sp|O65768.1|SODC_CARPA  RecName: Full=Superoxide dismutase              273   2e-90   Carica papaya [mamon]
emb|CDO98927.1|  unnamed protein product                                275   2e-90   Coffea canephora [robusta coffee]
gb|AAA88196.1|  cytosolic copper/zinc-superoxide dismutase              273   2e-90   Ipomoea batatas [batate]
pdb|2Q2L|A  Chain A, Crystal Structure Of Superoxide Dismutase Fr...    272   2e-90   Potentilla atrosanguinea
gb|ABA00453.1|  cytoplasmic Cu/ZnSOD                                    272   2e-90   Gossypium hirsutum [American cotton]
gb|KJB81932.1|  hypothetical protein B456_013G192900                    272   3e-90   Gossypium raimondii
dbj|BAG16516.1|  putative Cu/Zn superoxide dismutase                    272   3e-90   Capsicum chinense [bonnet pepper]
sp|Q43779.3|SODC2_SOLLC  RecName: Full=Superoxide dismutase [Cu-Z...    272   4e-90   Solanum lycopersicum
gb|AFS44500.1|  Cu/Zn superoxide dismutase                              271   4e-90   synthetic construct
gb|AAD01605.1|  copper/zinc-superoxide dismutase                        271   4e-90   Populus tremuloides
gb|AFS44502.1|  Cu/Zn superoxide dismutase                              271   4e-90   synthetic construct
gb|ADH59419.1|  cytosolic copper/zinc superoxide dismutase              271   5e-90   Amaranthus hypochondriacus [prince's feather]
ref|NP_001275009.1|  Cu/Zn-superoxide dismutase                         271   6e-90   Solanum tuberosum [potatoes]
gb|KHG04013.1|  Superoxide dismutase [Cu-Zn]                            271   7e-90   Gossypium arboreum [tree cotton]
ref|XP_011090864.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like       271   7e-90   Sesamum indicum [beniseed]
gb|AFS44496.1|  Cu/Zn superoxide dismutase                              271   8e-90   synthetic construct
ref|XP_006855398.1|  hypothetical protein AMTR_s00057p00145850          271   1e-89   
gb|KJB81931.1|  hypothetical protein B456_013G192900                    273   1e-89   Gossypium raimondii
gb|AAD01604.1|  cytoplasmic superoxide dismutase 1                      270   1e-89   Populus tremuloides
gb|ACJ11749.1|  copper/zinc superoxide dismutase                        270   2e-89   Gossypium hirsutum [American cotton]
gb|AFS44503.1|  Cu/Zn superoxide dismutase                              270   2e-89   synthetic construct
gb|AGL12266.1|  Cu-Zn superoxide dismutase                              270   2e-89   Salicornia europaea [chicken-claws]
gb|AAT77951.1|  copper/zinc superoxide dismutase                        270   2e-89   Manihot esculenta [manioc]
ref|XP_007030135.1|  Copper/zinc superoxide dismutase 1                 273   2e-89   
gb|AFS44499.1|  Cu/Zn superoxide dismutase                              270   2e-89   synthetic construct
dbj|BAJ07302.1|  copper/zinc superoxide dismutase                       270   2e-89   Melastoma malabathricum
gb|AFS44497.1|  Cu/Zn superoxide dismutase                              269   3e-89   synthetic construct
ref|XP_004288233.1|  PREDICTED: superoxide dismutase [Cu-Zn]            269   3e-89   Fragaria vesca subsp. vesca
sp|P22233.1|SODC_SPIOL  RecName: Full=Superoxide dismutase              269   4e-89   Spinacia oleracea
gb|AAD48484.1|AF170297_1  copper/zinc-superoxide dismutase              269   4e-89   Manihot esculenta [manioc]
gb|AAT66935.1|  superoxide dismutase                                    269   4e-89   Malus baccata var. xiaojinensis
gb|AFS44501.1|  Cu/Zn superoxide dismutase                              269   5e-89   synthetic construct
gb|AFS44498.1|  Cu/Zn superoxide dismutase                              269   5e-89   synthetic construct
emb|CAH59422.1|  copper-zinc superoxide dismutase                       269   5e-89   Plantago major [cart-track plant]
sp|P93258.1|SODC1_MESCR  RecName: Full=Superoxide dismutase [Cu-Z...    269   5e-89   Mesembryanthemum crystallinum
gb|AAK26435.1|AF354748_1  copper-zinc superoxide dismutase              268   6e-89   Solanum tuberosum [potatoes]
sp|O22373.1|SODC_CAPAN  RecName: Full=Superoxide dismutase              268   6e-89   Capsicum annuum
gb|AFH96953.1|  Cu/Zn superoxide dismutase                              268   7e-89   Eleutherococcus senticosus
ref|XP_008370655.1|  PREDICTED: superoxide dismutase [Cu-Zn]            268   7e-89   
ref|NP_001234031.1|  superoxide dismutase [Cu-Zn] 1                     268   9e-89   
gb|AFD50704.1|  Cu/Zn superoxide dismutase                              268   1e-88   Suaeda salsa
ref|XP_010553746.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     268   1e-88   Tarenaya hassleriana [spider flower]
ref|XP_010674951.1|  PREDICTED: superoxide dismutase [Cu-Zn]            268   1e-88   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010025114.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1 is...    267   2e-88   Eucalyptus grandis [rose gum]
ref|XP_008796193.1|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    267   3e-88   Phoenix dactylifera
gb|AFF57842.1|  Cu/Zn superoxide dismutase                              267   3e-88   Tetradium ruticarpum
gb|AEV43309.1|  Cu/Zn superoxide dismutase                              266   4e-88   Zoysia japonica [Japanese lawn grass]
ref|XP_008450736.1|  PREDICTED: superoxide dismutase [Cu-Zn]            266   4e-88   Cucumis melo [Oriental melon]
ref|XP_007147112.1|  hypothetical protein PHAVU_006G097000g             266   4e-88   Phaseolus vulgaris [French bean]
ref|NP_001267697.1|  superoxide dismutase [Cu-Zn]-like                  266   4e-88   Cucumis sativus [cucumbers]
ref|XP_009352428.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1          266   5e-88   Pyrus x bretschneideri [bai li]
ref|XP_010528833.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1          266   7e-88   Tarenaya hassleriana [spider flower]
sp|Q9SQL5.1|SODC_ANACO  RecName: Full=Superoxide dismutase              266   7e-88   Ananas comosus
ref|XP_010921717.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like       266   8e-88   Elaeis guineensis
gb|ACZ51444.1|  Cu/Zn superoxide dismutase                              264   4e-87   Mikania micrantha [bittervine]
gb|KJB81933.1|  hypothetical protein B456_013G192900                    264   4e-87   Gossypium raimondii
gb|KDP23592.1|  hypothetical protein JCGZ_23425                         263   7e-87   Jatropha curcas
gb|ADI48248.2|  Cu/Zn superoxide dismutase                              263   7e-87   Aeluropus littoralis
ref|XP_003626362.1|  Superoxide dismutase                               263   8e-87   Medicago truncatula
dbj|BAQ21272.1|  copper zinc superoxide dismutase                       263   1e-86   Citrus tamurana
ref|NP_001105704.1|  superoxide dismutase [Cu-Zn] 4AP                   263   1e-86   Zea mays [maize]
ref|XP_002512288.1|  cu/zn superoxide dismutase, putative               263   1e-86   Ricinus communis
ref|XP_010938694.1|  PREDICTED: superoxide dismutase [Cu-Zn]            263   1e-86   Elaeis guineensis
gb|AFC35181.1|  copper/zinc-superoxide dismutase                        262   2e-86   Populus x canadensis [Canadian poplar]
gb|AAK06837.1|AF328859_1  Cu-Zn superoxide dismutase                    262   2e-86   Avicennia marina
ref|XP_002268476.2|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    263   2e-86   Vitis vinifera
gb|KDO42713.1|  hypothetical protein CISIN_1g0318371mg                  262   2e-86   Citrus sinensis [apfelsine]
ref|XP_011023491.1|  PREDICTED: superoxide dismutase [Cu-Zn]            262   3e-86   Populus euphratica
gb|ABX54859.1|  Ole e 5 olive pollen allergen                           262   3e-86   Olea europaea
ref|XP_002319589.1|  Cu/Zn superoxide dismutase family protein          262   3e-86   Populus trichocarpa [western balsam poplar]
gb|ABQ10188.1|  copper/zinc superoxide dismutase                        262   3e-86   Caragana jubata [camel's tail]
gb|ACU52583.1|  copper/zinc superoxide dismutase                        261   3e-86   Lantana camara
ref|XP_002889716.1|  hypothetical protein ARALYDRAFT_888118             261   3e-86   Arabidopsis lyrata subsp. lyrata
gb|AAV97749.1|  CuZn superoxide dismutase                               261   3e-86   Codonopsis lanceolata
sp|Q8L5E0.2|ALL5B_OLEEU  RecName: Full=Superoxide dismutase [Cu-Z...    261   3e-86   Olea europaea
ref|XP_004984367.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4A-l...    261   3e-86   Setaria italica
gb|ACA50531.1|  CuZn superoxide dismutase                               261   4e-86   Avicennia marina
ref|XP_008388620.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     261   5e-86   Malus domestica [apple tree]
gb|AAQ14591.1|  copper/zinc superoxide dismutase                        261   5e-86   Citrus limon [lemon]
sp|O04996.3|SODC_SOLCS  RecName: Full=Superoxide dismutase              261   5e-86   Solidago canadensis var. scabra
gb|ABX54842.1|  Ole e 5 olive pollen allergen                           261   5e-86   Olea europaea
gb|ABX54845.1|  Ole e 5 olive pollen allergen                           261   5e-86   Olea europaea
ref|NP_001060564.1|  Os07g0665200                                       261   6e-86   
gb|AAK38603.1|AF355460_1  Cu/Zn-superoxide dismutase                    261   6e-86   Solanum tuberosum [potatoes]
gb|ADX43877.1|  CuZn-superoxide dismutase 3                             261   7e-86   Haberlea rhodopensis
gb|ADK56447.1|  Cu/Zn superoxide dismutase                              261   8e-86   Aeluropus lagopoides
gb|ABX26143.1|  allergen Ole e 5                                        261   8e-86   Olea europaea
emb|CAC33845.1|  putative cytosolic CuZn-superoxide dismutase           261   8e-86   Populus tremula x Populus tremuloides
gb|ADZ72850.1|  Cu/Zn superoxide dismutase                              261   8e-86   Vigna radiata [mung bean]
ref|XP_009408238.1|  PREDICTED: superoxide dismutase [Cu-Zn]            261   8e-86   Musa acuminata subsp. malaccensis [pisang utan]
gb|AAP81872.1|  cytosolic CuZn-superoxide dismutase                     261   9e-86   Lotus japonicus
gb|ABX54855.1|  Ole e 5 olive pollen allergen                           261   9e-86   Olea europaea
sp|O65174.1|SODC_ZANAE  RecName: Full=Superoxide dismutase              261   9e-86   Zantedeschia aethiopica [arum-lily]
gb|ADN04915.1|  csd1                                                    260   1e-85   Pleioblastus fortunei
ref|NP_172360.1|  superoxide dismutase [Cu-Zn]                          260   1e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008811696.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    260   1e-85   Phoenix dactylifera
ref|XP_010041954.1|  PREDICTED: superoxide dismutase [Cu-Zn]            260   1e-85   Eucalyptus grandis [rose gum]
gb|ABX26141.1|  allergen Ole e 5                                        260   1e-85   Olea europaea
gb|ABX54877.1|  Ole e 5 olive pollen allergen                           260   1e-85   Olea europaea
gb|ABX54862.1|  Ole e 5 olive pollen allergen                           260   1e-85   Olea europaea
gb|ABX54844.1|  Ole e 5 olive pollen allergen                           260   1e-85   Olea europaea
gb|ABX26131.1|  allergen Ole e 5                                        260   1e-85   Olea europaea
ref|XP_002268436.1|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    260   1e-85   Vitis vinifera
gb|ACV04872.1|  superoxide dismutase                                    260   1e-85   Morella rubra [Chinese arbutus]
ref|XP_006417640.1|  hypothetical protein EUTSA_v10008927mg             260   2e-85   
gb|ADX36106.1|  CuZn-superoxide dismutase 2                             259   2e-85   Haberlea rhodopensis
gb|ABP58627.1|  pollen allergen Ole e 5                                 259   2e-85   Olea europaea
gb|ACX94084.1|  copper/zinc-superoxide dismutase                        259   2e-85   Bambusa oldhamii
gb|ACV89347.1|  Cu/Zn superoxide dismutase                              259   2e-85   Knorringia sibirica
ref|XP_008660152.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4AP ...    259   2e-85   
gb|ABX54849.1|  Ole e 5 olive pollen allergen                           259   2e-85   Olea europaea
gb|KCW61706.1|  hypothetical protein EUGRSUZ_H04426                     260   2e-85   Eucalyptus grandis [rose gum]
emb|CAA10132.1|  superoxide dismutase                                   259   2e-85   Cicer arietinum [garbanzo]
ref|XP_006305743.1|  hypothetical protein CARUB_v10010551mg             259   2e-85   Capsella rubella
gb|ABF51006.1|  Cu-Zn superoxide dismutase                              259   2e-85   Arachis hypogaea [goober]
gb|ABX26147.1|  allergen Ole e 5                                        259   3e-85   Olea europaea
ref|XP_010489432.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1          259   3e-85   Camelina sativa [gold-of-pleasure]
gb|ABY65355.1|  copper/zinc-superoxide dismutase                        259   3e-85   Litchi chinensis [litchi]
gb|ABX26140.1|  allergen Ole e 5                                        259   3e-85   Olea europaea
gb|ABX26134.1|  allergen Ole e 5                                        259   3e-85   Olea europaea
gb|ABX26145.1|  allergen Ole e 5                                        259   3e-85   Olea europaea
ref|XP_006417641.1|  hypothetical protein EUTSA_v10008927mg             259   3e-85   Eutrema salsugineum [saltwater cress]
ref|XP_008649061.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4AP ...    259   3e-85   Zea mays [maize]
gb|AGD80596.1|  chloroplast copper/zinc-superoxide dismutase            259   4e-85   Saccharum hybrid cultivar GT28
gb|AGC13158.1|  copper/zinc superoxide dismutase                        259   4e-85   Musa acuminata AAA Group [Cavendish banana]
ref|XP_008218142.1|  PREDICTED: superoxide dismutase [Cu-Zn]            259   4e-85   Prunus mume [ume]
gb|ABP65325.1|  Cu-Zn superoxide dismutase                              259   4e-85   Cenchrus americanus [bulrush millet]
gb|ABN50366.1|  copper zinc superoxide dismutase                        259   4e-85   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007206078.1|  hypothetical protein PRUPE_ppa012845mg             259   4e-85   Prunus persica
gb|AAL85888.1|AF479059_1  copper/zinc superoxide dismutase              259   4e-85   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ABX54869.1|  Ole e 5 olive pollen allergen                           259   5e-85   Olea europaea
ref|XP_010475701.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     259   5e-85   Camelina sativa [gold-of-pleasure]
gb|AHF27437.1|  superoxide dismutase                                    259   5e-85   Cucurbita maxima [Boston marrow]
dbj|BAB78597.1|  copper/zinc superoxide dismutase                       259   5e-85   Bruguiera gymnorhiza [Burma mangrove]
emb|CAH06454.1|  Cu/Zn superoxide dismutase                             258   6e-85   Helianthus annuus
ref|XP_006433125.1|  hypothetical protein CICLE_v10002756mg             258   6e-85   Citrus clementina [clementine]
gb|KCW61709.1|  hypothetical protein EUGRSUZ_H04426                     258   9e-85   Eucalyptus grandis [rose gum]
gb|AAC25568.1|  cytosolic Cu/Zn superoxide dismutase                    258   1e-84   Brassica rapa subsp. pekinensis [bai cai]
ref|XP_010458148.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     258   1e-84   Camelina sativa [gold-of-pleasure]
gb|AFC35179.1|  copper/zinc-superoxide dismutase                        258   1e-84   Bambusa emeiensis
emb|CDX93533.1|  BnaA06g05150D                                          257   2e-84   
ref|XP_003562484.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4A         257   2e-84   Brachypodium distachyon [annual false brome]
gb|AFU52879.1|  Cu/Zn-superoxide dismutase                              257   2e-84   Vitis vinifera
gb|ABV79894.2|  cytosolic copper/zinc-superoxide dismutase              257   2e-84   Dimocarpus longan [longan]
ref|XP_010247119.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          256   3e-84   Nelumbo nucifera [Indian lotus]
gb|AGC13160.1|  copper/zinc superoxide dismutase                        256   3e-84   Musa acuminata [banana]
ref|XP_009118346.1|  PREDICTED: superoxide dismutase [Cu-Zn]            256   3e-84   Brassica rapa
ref|XP_010241018.1|  PREDICTED: superoxide dismutase [Cu-Zn]            256   4e-84   Nelumbo nucifera [Indian lotus]
emb|CDX95028.1|  BnaC05g06430D                                          256   4e-84   
gb|ABX54866.1|  Ole e 5 olive pollen allergen                           256   5e-84   Olea europaea
gb|AGN72377.1|  cytosolic copper-zinc superoxide dismutase              256   5e-84   Plantago ovata [blond psyllium]
gb|AAD05576.1|  Cu/Zn superoxide dismutase                              256   5e-84   Raphanus sativus
gb|ABF95937.1|  Superoxide dismutase 1, putative, expressed             260   6e-84   Oryza sativa Japonica Group [Japonica rice]
gb|ABX54876.1|  Ole e 5 olive pollen allergen                           256   6e-84   Olea europaea
gb|AGC13157.1|  copper/zinc superoxide dismutase                        256   6e-84   Musa acuminata AAA Group [Cavendish banana]
ref|XP_010911239.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like       256   6e-84   Elaeis guineensis
gb|AAZ20281.1|  Cu-Zn superoxide dismutase                              256   6e-84   Arachis hypogaea [goober]
gb|AHF27434.1|  superoxide dismutase                                    256   7e-84   Cucurbita moschata [ayote]
gb|ADB28989.2|  copper/zinc superoxide dismutase                        256   8e-84   Allium sativum
ref|XP_009382001.1|  PREDICTED: superoxide dismutase [Cu-Zn]            255   1e-83   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009148138.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1          255   1e-83   Brassica rapa
sp|Q02610.2|SODC_PEA  RecName: Full=Superoxide dismutase                255   1e-83   Pisum sativum [garden pea]
ref|XP_008813737.1|  PREDICTED: superoxide dismutase [Cu-Zn]            255   1e-83   Phoenix dactylifera
ref|NP_001050118.1|  Os03g0351500                                       255   1e-83   
gb|ABX26138.1|  allergen Ole e 5                                        255   2e-83   Olea europaea
gb|AAW80441.1|  copper-zinc superoxide dismutase                        254   2e-83   Nelumbo nucifera [Indian lotus]
gb|AAW80431.1|  copper-zinc superoxide dismutase                        254   2e-83   Nelumbo nucifera [Indian lotus]
gb|ABX26139.1|  allergen Ole e 5                                        254   2e-83   Olea europaea
ref|XP_006650081.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     254   2e-83   Oryza brachyantha
ref|XP_010097352.1|  sodC protein                                       256   3e-83   
gb|EEE67768.1|  hypothetical protein OsJ_25485                          264   3e-83   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001235298.1|  superoxide dismutase [Cu-Zn]                       254   3e-83   Glycine max [soybeans]
gb|AAW80438.1|  copper-zinc superoxide dismutase                        254   3e-83   Nelumbo nucifera [Indian lotus]
gb|EEC82641.1|  hypothetical protein OsI_27243                          264   4e-83   Oryza sativa Indica Group [Indian rice]
gb|AGC13159.1|  copper/zinc superoxide dismutase                        253   5e-83   Musa acuminata [banana]
ref|XP_004958608.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     253   5e-83   Setaria italica
gb|ADK66275.1|  Cu/Zn superoxide dismutase                              253   6e-83   Aeluropus lagopoides
gb|AAA33917.1|  superoxide dismutase                                    253   7e-83   Oryza sativa Japonica Group [Japonica rice]
sp|P09678.2|SODC_BRAOC  RecName: Full=Superoxide dismutase              253   7e-83   Brassica oleracea var. capitata
gb|KHN04039.1|  Superoxide dismutase [Cu-Zn]                            253   1e-82   Glycine soja [wild soybean]
gb|ACU52586.1|  copper/zinc superoxide dismutase                        252   1e-82   Curcuma aromatica [wild turmeric]
ref|NP_001105423.1|  superoxide dismutase [Cu-Zn] 4A                    252   2e-82   
gb|AGX27516.1|  CUZN-SOD                                                252   2e-82   Populus tomentosa [Chinese white poplar]
gb|AGI65618.1|  Cu/Zn-superoxide dismutase                              251   2e-82   Fragaria x ananassa
ref|XP_004984365.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4A-l...    254   3e-82   
gb|ACS45202.1|  copper-zinc superoxide dismutase CuZn-SOD1              251   5e-82   Nelumbo nucifera [Indian lotus]
gb|AAF99769.1|AC003981_19  F22O13.32                                    251   5e-82   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001235936.1|  uncharacterized protein LOC100305732               251   5e-82   
gb|ACV65038.1|  Cu/Zn superoxide dismutase                              251   7e-82   Deschampsia antarctica
sp|O22668.1|SODC_PANGI  RecName: Full=Superoxide dismutase              250   8e-82   Panax ginseng [Asiatic ginseng]
gb|ACS45203.1|  copper-zinc superoxide dismutase CuZn-SOD2              250   9e-82   Nelumbo nucifera [Indian lotus]
ref|XP_010941777.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    250   1e-81   Elaeis guineensis
ref|XP_011071493.1|  PREDICTED: LOW QUALITY PROTEIN: superoxide d...    250   1e-81   
sp|Q42612.3|SODC2_BRAJU  RecName: Full=Superoxide dismutase [Cu-Z...    249   2e-81   Brassica juncea [brown mustard]
ref|XP_006658075.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     249   2e-81   
gb|AFF27607.1|  cytosolic Cu/Zn superoxide dismutase                    249   2e-81   Triticum aestivum [Canadian hard winter wheat]
gb|AAW80440.1|  copper-zinc superoxide dismutase                        249   3e-81   Nelumbo nucifera [Indian lotus]
emb|CDP18382.1|  unnamed protein product                                249   3e-81   Coffea canephora [robusta coffee]
gb|AAY90123.1|  copper/zinc superoxide dismutase                        249   3e-81   Rheum australe [Himalayan rhubarb]
ref|XP_008651855.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    249   3e-81   Zea mays [maize]
emb|CBI34272.3|  unnamed protein product                                249   4e-81   Vitis vinifera
gb|AAN60796.1|  superoxide dismutase                                    249   4e-81   Brassica juncea [brown mustard]
ref|NP_001105335.1|  superoxide dismutase [Cu-Zn] 2                     248   5e-81   Zea mays [maize]
ref|XP_008800522.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    248   6e-81   Phoenix dactylifera
emb|CDY22663.1|  BnaC08g42970D                                          249   1e-80   Brassica napus [oilseed rape]
gb|ACO90194.1|  superoxide dismutase                                    247   2e-80   Triticum aestivum [Canadian hard winter wheat]
ref|XP_008651854.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    249   3e-80   Zea mays [maize]
dbj|BAJ94548.1|  predicted protein                                      246   4e-80   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ABM53666.2|  copper/zinc superoxide dismutase                        244   2e-79   Euphorbia characias
gb|AFO64338.1|  Cu/Zn superoxide dismutase                              243   8e-79   Eucalyptus grandis x Eucalyptus urophylla
ref|XP_006382704.1|  hypothetical protein POPTR_0005s04590g             242   1e-78   
gb|EEC75259.1|  hypothetical protein OsI_11574                          242   4e-78   Oryza sativa Indica Group [Indian rice]
sp|Q42611.3|SODC1_BRAJU  RecName: Full=Superoxide dismutase [Cu-Z...    241   4e-78   Brassica juncea [brown mustard]
gb|ABX54851.1|  Ole e 5 olive pollen allergen                           240   1e-77   Olea europaea
sp|P24669.1|SODC_PINSY  RecName: Full=Superoxide dismutase              240   1e-77   Pinus sylvestris [Scotch pine]
gb|ABX54864.1|  Ole e 5 olive pollen allergen                           239   3e-77   Olea europaea
gb|ABK24535.1|  unknown                                                 238   7e-77   Picea sitchensis
gb|ABE01089.1|  putative cytosolic copper/zinc superoxide dismutase     237   2e-76   Gossypium hirsutum [American cotton]
ref|XP_008455574.1|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    236   4e-76   Cucumis melo [Oriental melon]
ref|XP_004139207.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     234   2e-75   Cucumis sativus [cucumbers]
gb|AAO14117.1|AF457209_1  Cu/Zn superoxide dismutase                    234   2e-75   Hevea brasiliensis [jebe]
gb|ABX26132.1|  allergen Ole e 5                                        233   3e-75   Olea europaea
gb|AEY63778.1|  Cu/Zn superoxide dismutase                              232   7e-75   Camellia oleifera [abura-tsubaki]
gb|AAU08173.1|  Cu/Zn superoxide dismutase                              232   7e-75   Camellia sinensis [black tea]
dbj|BAC10110.1|  copper/zinc-superoxide dismutase                       231   4e-74   Oryza sativa Japonica Group [Japonica rice]
gb|ABH10014.1|  Cu/Zn superoxide dismutase                              229   7e-74   Eucalyptus camaldulensis
dbj|BAL27545.1|  cytosolic Cu/Zn superoxide dismutase-2                 229   2e-73   Equisetum arvense [common horsetail]
gb|AFS44490.1|  Cu/Zn superoxide dismutase                              226   1e-72   Eragrostis atrovirens
gb|AEY79519.1|  copper/zinc superoxide dismutase                        226   1e-72   Tetradium glabrifolium
gb|AEY79511.1|  copper/zinc superoxide dismutase                        226   2e-72   Tetradium ruticarpum
ref|XP_001760804.1|  predicted protein                                  227   2e-72   
gb|AGC95069.1|  copper/zinc superoxide dismutase                        226   2e-72   Musa acuminata AAA Group [Cavendish banana]
gb|AEY79517.1|  copper/zinc superoxide dismutase                        226   2e-72   Tetradium ruticarpum
gb|AEY79514.1|  copper/zinc superoxide dismutase                        226   2e-72   Tetradium ruticarpum
gb|AFR90182.1|  copper/zinc-superoxide dismutase                        226   3e-72   Grimmia decipiens
gb|AEY79512.1|  copper/zinc superoxide dismutase                        225   4e-72   Tetradium ruticarpum
ref|XP_009411708.1|  PREDICTED: superoxide dismutase [Cu-Zn] 1-like     226   5e-72   
gb|AFS44491.1|  Cu/Zn superoxide dismutase                              224   6e-72   Echinochloa crus-galli [barnyard grass]
gb|AFW20025.1|  Cu,Zn superoxide dismutase                              224   7e-72   Lantana camara
gb|AEY79516.1|  copper/zinc superoxide dismutase                        224   8e-72   Tetradium ruticarpum
gb|AGC95070.1|  copper/zinc superoxide dismutase                        225   1e-71   Musa acuminata [banana]
gb|ACQ66642.1|  Cu/Zn superoxide dismutase                              224   1e-71   Vigna radiata [mung bean]
dbj|BAL27543.1|  cytosolic Cu/Zn superoxide dismutase-3                 224   1e-71   Pogonatum inflexum
gb|AFS44494.1|  Cu/Zn superoxide dismutase                              224   1e-71   Cenchrus clandestinus
gb|ABK22766.1|  unknown                                                 224   2e-71   Picea sitchensis
ref|XP_010025115.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    223   2e-71   Eucalyptus grandis [rose gum]
gb|ACQ66641.1|  Cu/Zn superoxide dismutase                              223   2e-71   Vigna luteola
gb|ADF56045.1|  copper/zinc-superoxide dismutase                        224   2e-71   Grimmia pilifera
gb|AAZ79665.1|  putative copper/zinc-superoxide dismutase               223   4e-71   Fagus sylvatica
ref|XP_008796192.1|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    224   6e-71   
gb|ABR17559.1|  unknown                                                 223   9e-71   Picea sitchensis
gb|AFX96041.1|  copper/zinc-superoxide dismutase                        221   2e-70   Niphotrichum japonicum
gb|AFS44492.1|  Cu/Zn superoxide dismutase                              220   4e-70   Eleusine indica [crabgrass]
ref|XP_001755582.1|  predicted protein                                  221   5e-70   
gb|AFW20026.1|  Cu,Zn superoxide dismutase                              218   2e-69   Curcuma aromatica [wild turmeric]
emb|CAC34448.1|  superoxide dismutase                                   219   3e-69   Pinus sylvestris [Scotch pine]
gb|AIW62940.1|  Cu/Zn superoxide dismutase                              218   3e-69   Tomicus yunnanensis
gb|ACF79913.1|  unknown                                                 217   1e-68   Zea mays [maize]
ref|XP_010910953.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like       215   4e-68   
ref|XP_008811695.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    216   6e-68   
emb|CAA05633.1|  high pI CuZn-superoxide dismutase                      214   1e-67   
ref|XP_006433126.1|  hypothetical protein CICLE_v10002756mg             214   1e-67   
gb|AEE63298.1|  unknown                                                 214   2e-67   
gb|AAB49912.1|  superoxide dismutase 4                                  212   3e-67   
ref|NP_001242811.1|  uncharacterized protein LOC100780008               213   9e-67   
ref|XP_002974232.1|  hypothetical protein SELMODRAFT_442405             212   1e-66   
emb|CAC33847.1|  putative CuZn-superoxide dismutase                     212   1e-66   
ref|XP_002980788.1|  hypothetical protein SELMODRAFT_233596             211   2e-66   
gb|KHN32767.1|  Superoxide dismutase [Cu-Zn] 2                          212   2e-66   
ref|XP_011034389.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     212   2e-66   
gb|ADR70869.1|  cytosolic copper/zinc superoxide dismutase              211   3e-66   
emb|CAC33846.2|  putative CuZn-superoxide dismutase                     210   6e-66   
ref|XP_006858938.1|  hypothetical protein AMTR_s00068p00084200          210   9e-66   
ref|XP_006349575.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     210   1e-65   
ref|XP_009629378.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          209   1e-65   
gb|AFK41577.1|  unknown                                                 209   1e-65   
pdb|1SRD|A  Chain A, Three-dimensional Structure Of Cu,zn-superox...    209   1e-65   
ref|XP_006443439.1|  hypothetical protein CICLE_v10022494mg             209   1e-65   
gb|ACQ66643.1|  Cu/Zn superoxide dismutase                              208   2e-65   
sp|P07505.2|SODCP_SPIOL  RecName: Full=Superoxide dismutase [Cu-Z...    211   2e-65   
emb|CAB66335.1|  copper/zinc-superoxide dismutase                       207   2e-65   
ref|XP_007151854.1|  hypothetical protein PHAVU_004G081000g             209   2e-65   
ref|XP_002325843.1|  copper/zinc superoxide dismutase 3 family pr...    209   2e-65   
dbj|BAJ39890.1|  CuZn-superoxide dismutase                              210   2e-65   
ref|XP_004234809.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    209   2e-65   
ref|XP_009366463.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     209   3e-65   
ref|XP_010689245.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    210   5e-65   
ref|XP_009776228.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    210   5e-65   
ref|XP_010941778.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    207   5e-65   
ref|XP_008240532.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          208   5e-65   
ref|XP_002281571.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          208   5e-65   
ref|XP_002319157.1|  copper/zinc superoxide dismutase 3 family pr...    208   6e-65   
ref|XP_009773338.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          207   6e-65   
gb|AHY86344.1|  Cu/Zn-superoxide dismutase                              207   6e-65   
ref|XP_010054654.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          207   7e-65   
ref|XP_009353128.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     207   9e-65   
ref|XP_007202705.1|  hypothetical protein PRUPE_ppa012725mg             207   1e-64   
dbj|BAL27544.1|  chloroplastic Cu/Zn superoxide dismutase-1 precu...    209   1e-64   
ref|XP_011021470.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-like     206   2e-64   
gb|ADM64420.1|  copper/zinc superoxide dismutase                        206   2e-64   
gb|ACJ13748.1|  hipI-SODC1s                                             206   3e-64   
gb|AEY99654.1|  Cu-Zn superoxide dismutase                              206   3e-64   
ref|XP_009599053.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    208   4e-64   
gb|AII25435.1|  Cu-Zn SOD                                               207   5e-64   
gb|AII25434.1|  Cu-Zn SOD                                               207   6e-64   
gb|ABB02179.1|  copper-zinc superoxide dismutase                        205   7e-64   
gb|AAW80432.1|  copper-zinc superoxide dismutase                        204   9e-64   
ref|XP_003618947.1|  Superoxide dismutase                               205   1e-63   
ref|XP_008391694.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-li...    205   1e-63   
ref|XP_008455578.1|  PREDICTED: superoxide dismutase [Cu-Zn] isof...    203   2e-63   
gb|AAW80436.1|  copper-zinc superoxide dismutase                        204   2e-63   
ref|XP_004489695.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2-li...    204   2e-63   
gb|KHG04372.1|  SODCC.2: Superoxide dismutase [Cu-Zn] 2                 204   2e-63   
ref|XP_006400355.1|  hypothetical protein EUTSA_v10014873mg             204   2e-63   
ref|XP_008386828.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          204   3e-63   
gb|AEO27875.1|  SOD2                                                    206   3e-63   
dbj|BAA24919.1|  CuZn-superoxide dismutase                              203   3e-63   
gb|AAW80430.1|  copper-zinc superoxide dismutase                        203   4e-63   
emb|CAH06449.1|  Cu/Zn superoxide dismutase precursor                   205   4e-63   
emb|CAN59834.1|  hypothetical protein VITISV_017620                     205   4e-63   
emb|CBI17131.3|  unnamed protein product                                205   4e-63   
sp|O65199.1|SODCP_VITVI  RecName: Full=Superoxide dismutase [Cu-Z...    205   4e-63   
ref|XP_011088797.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    205   4e-63   
ref|XP_010524984.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3 is...    203   4e-63   
ref|NP_001268067.1|  superoxide dismutase [Cu-Zn], chloroplastic        205   5e-63   
gb|AAB67991.1|  Cu/Zn superoxide dismutase                              204   6e-63   
gb|KJB44615.1|  hypothetical protein B456_007G261100                    203   6e-63   
ref|XP_010693815.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          202   6e-63   
ref|XP_004288411.1|  PREDICTED: superoxide dismutase [Cu-Zn] 4AP        202   6e-63   
gb|AAW80433.1|  copper-zinc superoxide dismutase                        202   6e-63   
gb|AAW80429.1|  copper-zinc superoxide dismutase                        202   6e-63   
dbj|BAL27541.1|  chloroplastic Cu/Zn superoxide dismutase-2 precu...    204   7e-63   
ref|XP_007015040.1|  Copper/zinc superoxide dismutase 1                 202   7e-63   
gb|KJB35218.1|  hypothetical protein B456_006G104900                    204   8e-63   
gb|AHE13888.1|  Cu-Zn superoxide dismutase 2                            202   8e-63   
ref|XP_006837962.1|  hypothetical protein AMTR_s00102p00067140          204   8e-63   
ref|XP_001770943.1|  predicted protein                                  202   9e-63   
ref|XP_007132338.1|  hypothetical protein PHAVU_011G086300g             204   9e-63   
gb|AFD50705.1|  Cu/Zn superoxide dismutase                              204   1e-62   
gb|AAW80435.1|  copper-zinc superoxide dismutase                        202   1e-62   
gb|AHX36945.1|  CuZn superoxide dismutase                               202   1e-62   
ref|XP_009372495.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    204   1e-62   
ref|XP_009121015.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3 is...    202   1e-62   
gb|AFG19614.1|  copper/zinc-superoxide dismutase                        204   1e-62   
ref|XP_004287550.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    204   2e-62   
ref|XP_009356939.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    204   2e-62   
ref|XP_010267263.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    201   2e-62   
gb|AAL29462.1|AF434186_1  Cu-Zn-superoxide dismutase precursor          203   2e-62   
emb|CAB51840.1|  copper/zinc superoxide dismutase                       203   2e-62   
gb|ABK96672.1|  unknown                                                 203   2e-62   
ref|XP_010454032.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3          201   2e-62   
gb|AFH08801.1|  chloroplast Cu/Zn-superoxide dismutase 1B-a             203   2e-62   
gb|EYU37029.1|  hypothetical protein MIMGU_mgv1a013225mg                203   2e-62   
gb|AFH08800.1|  chloroplast Cu/Zn-superoxide dismutase 1A-a             203   2e-62   
ref|XP_002405905.1|  superoxide dismutase Cu-Zn                         201   2e-62   
ref|XP_002523728.1|  superoxide dismutase [cu-zn], putative             203   3e-62   
ref|XP_001770912.1|  predicted protein                                  201   3e-62   
ref|XP_006384962.1|  Superoxide dismutase family protein                203   3e-62   
ref|XP_007205695.1|  hypothetical protein PRUPE_ppa009729mg             205   3e-62   
gb|ABK21896.1|  unknown                                                 202   3e-62   
ref|XP_008385499.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    203   4e-62   
emb|CDY38486.1|  BnaA10g16720D                                          201   4e-62   
dbj|BAF80585.1|  Cu-Zn superoxide disumtase                             202   4e-62   
ref|XP_007030079.1|  Superoxide dismutase [Cu-Zn] 2 isoform 1           201   5e-62   
ref|XP_011075057.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    201   5e-62   
sp|O04997.1|SODCP_SOLCS  RecName: Full=Superoxide dismutase [Cu-Z...    202   5e-62   
gb|AAY66847.1|  superoxide dismutase Cu-Zn                              200   6e-62   
ref|XP_010317899.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    200   6e-62   
gb|AAB67990.1|  Cu/Zn superoxide dismutase                              201   6e-62   
ref|XP_008226630.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    202   6e-62   
ref|XP_011075055.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2 is...    200   7e-62   
gb|KJB35215.1|  hypothetical protein B456_006G104900                    202   7e-62   
gb|AJK90567.1|  chloroplast copper/zinc superoxide dismutase            202   7e-62   
ref|XP_011028269.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    202   7e-62   
ref|XP_007016064.1|  Copper/zinc superoxide dismutase 2 isoform 1       202   8e-62   
gb|ACC93639.1|  extracellular Cu/Zn superoxide dismutase                200   8e-62   
ref|XP_004342585.1|  superoxide dismutase Cu-Zn                         199   1e-61   
ref|XP_007202706.1|  hypothetical protein PRUPE_ppa012725mg             199   1e-61   
gb|ADC42883.1|  superoxidase dismutase                                  199   1e-61   
gb|KFK26049.1|  hypothetical protein AALP_AA8G196600                    200   1e-61   
gb|AAD10208.1|  copper/zinc superoxide dismutase                        201   1e-61   
gb|KJE97912.1|  superoxide dismutase Cu-Zn                              199   1e-61   
ref|NP_565666.1|  copper/zinc superoxide dismutase 2                    201   1e-61   
gb|ABL63518.1|  chloroplast Cu/Zn superoxide dismutase                  201   1e-61   
gb|AFF27603.1|  chloroplast Cu/Zn superoxide dismutase                  199   2e-61   
gb|ACJ13749.1|  hipI-SODC1b                                             200   2e-61   
gb|AAZ41971.1|  chloroplast Cu/Zn superoxide dismutase                  201   2e-61   
dbj|BAL27542.1|  chloroplastic Cu/Zn superoxide dismutase-1 precu...    201   2e-61   
gb|ACC93637.1|  chloroplast Cu/Zn superoxide dismutase                  201   2e-61   
sp|O49044.1|SODC2_MESCR  RecName: Full=Superoxide dismutase [Cu-Z...    199   2e-61   
ref|XP_002871801.1|  hypothetical protein ARALYDRAFT_326224             199   2e-61   
ref|XP_010492805.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3-like     199   2e-61   
gb|ABK96750.1|  unknown                                                 197   2e-61   
dbj|BAC66947.1|  chloroplastic copper/zinc superoxide dismutase         199   2e-61   
ref|XP_011426932.1|  PREDICTED: superoxide dismutase [Cu-Zn]-like...    199   2e-61   
ref|XP_008365087.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    201   2e-61   
gb|AIN39808.1|  hypothetical protein                                    202   2e-61   
ref|XP_010420550.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3-like     199   2e-61   
ref|XP_006377160.1|  hypothetical protein POPTR_0011s01280g             203   2e-61   
gb|ADM47614.1|  chloroplast copper/zinc superoxide dismutase            200   3e-61   
ref|XP_002313542.2|  hypothetical protein POPTR_0009s01050g             200   3e-61   
ref|XP_006409840.1|  hypothetical protein EUTSA_v10017094mg             202   4e-61   
gb|AGW52120.1|  Cu/Zn superoxide dismutase                              201   4e-61   
ref|XP_002880945.1|  copper/zinc superoxide dismutase                   200   4e-61   
dbj|BAJ34461.1|  unnamed protein product                                200   4e-61   
gb|ABO70347.1|  chloroplast Cu/Zn superoxide dismutase                  200   4e-61   
ref|XP_006378938.1|  hypothetical protein POPTR_0009s01050g             200   4e-61   
ref|XP_006294965.1|  hypothetical protein CARUB_v10024021mg             200   5e-61   
ref|XP_008555080.1|  PREDICTED: superoxide dismutase [Cu-Zn]            197   5e-61   
gb|ACC93638.1|  chloroplast Cu/Zn superoxide dismutase                  199   5e-61   
gb|ABA00454.1|  chloroplast Cu/ZnSOD                                    201   5e-61   
emb|CAD42722.1|  superoxide dismutase                                   197   5e-61   
ref|XP_006288775.1|  hypothetical protein CARUB_v10002096mg             198   5e-61   
gb|ADO20320.1|  Cu/Zn superoxide dismutase                              197   5e-61   
sp|P11964.1|SODCP_PEA  RecName: Full=Superoxide dismutase [Cu-Zn]...    199   6e-61   
ref|XP_008465422.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    200   6e-61   
gb|KHG11568.1|  Superoxide dismutase [Cu-Zn], chloroplastic             200   6e-61   
gb|AAK60277.1|AF385581_1  copper/zinc superoxide dismutase precursor    199   6e-61   
gb|AHJ09681.1|  superoxide dismutase                                    197   7e-61   
gb|EAZ43665.1|  hypothetical protein OsJ_28291                          199   8e-61   
gb|AGS15005.1|  chloroplastic copper/zinc superoxide dismutase          197   8e-61   
gb|AFD34188.1|  Cu/Zn superoxide dismutase                              197   9e-61   
gb|ADR01108.1|  copper/zinc superoxide dismutase                        198   9e-61   
gb|AFC17494.1|  copper/zinc superoxide dismutase 1                      197   9e-61   
dbj|BAD09607.1|  putative superoxide dismutase [Cu-Zn], chloropla...    199   9e-61   
gb|AEY78487.1|  copper/zinc superoxide dismutase                        197   1e-60   
ref|XP_009140848.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2, c...    199   1e-60   
sp|P10792.1|SODCP_PETHY  RecName: Full=Superoxide dismutase [Cu-Z...    199   1e-60   
ref|XP_011306996.1|  PREDICTED: superoxide dismutase [Cu-Zn]            196   1e-60   
gb|AFG19616.1|  copper/zinc-superoxide dismutase 1                      199   1e-60   
dbj|BAI50563.1|  chloroplastic copper zinc superoxide dismutase         198   1e-60   
gb|ACG30925.1|  superoxide dismutase                                    198   1e-60   
gb|AFC17496.1|  copper/zinc superoxide dismutase                        197   1e-60   
gb|AFG19617.1|  copper/zinc-superoxide dismutase 2                      199   1e-60   
ref|XP_009395581.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2          197   1e-60   
ref|NP_001062514.1|  Os08g0561700                                       198   2e-60   
dbj|BAI50562.1|  chloroplastic copper zinc superoxide dismutase         198   2e-60   
ref|NP_001108127.1|  LOC100136885                                       198   2e-60   
ref|XP_001608103.1|  PREDICTED: superoxide dismutase [Cu-Zn]            196   2e-60   
ref|XP_004974228.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    198   2e-60   
gb|ADR70998.1|  CuZnSOD                                                 196   2e-60   
gb|ACL81496.1|  CuZnSOD                                                 198   2e-60   
gb|AFV52312.1|  Cu/Zn super oxide dismutase                             196   2e-60   
ref|NP_197311.1|  copper/zinc superoxide dismutase 3                    196   2e-60   
ref|XP_004167788.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    198   2e-60   
gb|ADM86714.1|  chloroplast Cu/Zn superoxide dismutase                  196   2e-60   
ref|XP_010510677.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2, c...    198   2e-60   
gb|AAC24833.1|  copper/zinc superoxide dismutase                        196   2e-60   
ref|XP_004145768.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    198   2e-60   
pdb|3KM1|A  Chain A, Zinc-Reconstituted Tomato Chloroplast Supero...    196   2e-60   
dbj|BAI50561.1|  chloroplastic Cu/Zn superoxide dismutase               197   3e-60   
ref|XP_010414582.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2, c...    198   3e-60   
emb|CDP14300.1|  unnamed protein product                                196   3e-60   
gb|ADX43879.1|  CuZn-superoxide dismutase 4                             196   3e-60   
gb|AGC74195.1|  copper/zinc superoxide dismutase                        196   3e-60   
ref|XP_010940533.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    198   3e-60   
ref|XP_003539793.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    197   3e-60   
ref|XP_010243203.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    197   3e-60   
gb|ABF14366.1|  Cu/Zn superoxide dismutase                              196   4e-60   
emb|CDY25459.1|  BnaC09g39740D                                          196   4e-60   
gb|AFC17495.1|  copper/zinc superoxide dismutase 2                      196   4e-60   
ref|XP_003538169.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    197   4e-60   
gb|AES75166.2|  superoxide dismutase [Cu-Zn] protein                    195   4e-60   
gb|KHG04370.1|  SODCC.2: Superoxide dismutase [Cu-Zn] 2                 197   4e-60   
pir||H84681  probable copper/zinc superoxide dismutase [imported]...    197   4e-60
ref|NP_001234769.1|  superoxide dismutase [Cu-Zn], chloroplastic        197   5e-60   
gb|KHN38703.1|  Superoxide dismutase [Cu-Zn], chloroplastic             197   5e-60   
ref|XP_002445671.1|  hypothetical protein SORBIDRAFT_07g023950          197   5e-60   
gb|KJB53586.1|  hypothetical protein B456_009G090300                    196   5e-60   
gb|AIY26425.1|  superoxide dismutase 1a                                 197   5e-60   
ref|XP_003574947.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    197   6e-60   
gb|AAQ09007.1|  superoxidase dismutase                                  197   6e-60   
ref|XP_006659705.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    196   6e-60   
ref|XP_009121014.1|  PREDICTED: superoxide dismutase [Cu-Zn] 3 is...    195   6e-60   
ref|XP_010470130.1|  PREDICTED: superoxide dismutase [Cu-Zn] 2, c...    197   7e-60   
gb|ADF80414.1|  Cu-Zn superoxide dismutase                              195   7e-60   
gb|ABI34607.1|  copper/zinc superoxide dismutase                        195   8e-60   
ref|XP_011503107.1|  PREDICTED: superoxide dismutase [Cu-Zn]            194   9e-60   
gb|KHG04371.1|  SODCC.2: Superoxide dismutase [Cu-Zn] 2                 195   9e-60   
ref|XP_008807696.1|  PREDICTED: superoxide dismutase [Cu-Zn], chl...    196   9e-60   
dbj|BAH83704.1|  copper zinc superoxide dismutase                       195   1e-59   



>sp|Q07796.2|SODC_IPOBA RecName: Full=Superoxide dismutase [Ipomoea batatas]
 emb|CAA51654.1| superoxide dismutase [Ipomoea batatas]
Length=152

 Score =   284 bits (727),  Expect = 4e-95, Method: Compositional matrix adjust.
 Identities = 143/151 (95%), Positives = 147/151 (97%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFF+QEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIFFSQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP DD RHAGDLGNITVGEDGTA+FTITDKQIPLTGANS+IGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPGDDNRHAGDLGNITVGEDGTASFTITDKQIPLTGANSVIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|KJB81930.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
Length=183

 Score =   283 bits (725),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 142/162 (88%), Positives = 152/162 (94%), Gaps = 2/162 (1%)
 Frame = +3

Query  33   RGALRSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGD  212
            RGALRS TKMVK VAVLSS+EGVSGT+FF+QEGDGPTTVTGN+SGLK G HGFHVHALGD
Sbjct  21   RGALRSHTKMVKAVAVLSSNEGVSGTVFFSQEGDGPTTVTGNLSGLKAGLHGFHVHALGD  80

Query  213  TTNGCMSTG--PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGAN  386
            TTNGCMSTG  PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG A+F+ITDKQIPLTG N
Sbjct  81   TTNGCMSTGKRPHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPN  140

Query  387  SIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            SIIGRAVVVH DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  141  SIIGRAVVVHADPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  182



>sp|P27082.2|SODC_NICPL RecName: Full=Superoxide dismutase [Nicotiana plumbaginifolia]
 emb|CAA39444.1| superoxide dismutase [Nicotiana plumbaginifolia]
Length=152

 Score =   279 bits (713),  Expect = 5e-93, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFFTQ+GD PTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIFFTQDGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FT+TDKQIPL G  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTLTDKQIPLAGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_009624899.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nicotiana tomentosiformis]
 ref|XP_009624905.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nicotiana tomentosiformis]
 ref|XP_009792257.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nicotiana sylvestris]
 ref|XP_009792259.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nicotiana sylvestris]
Length=152

 Score =   278 bits (711),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFFTQ+GD PTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIFFTQDGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPL G  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLAGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKATGNAGGRVACGIIGLQ  151



>emb|CAE54085.1| superoxide dismutase [Fagus sylvatica]
Length=166

 Score =   278 bits (710),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 145/160 (91%), Gaps = 0/160 (0%)
 Frame = +3

Query  33   RGALRSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGD  212
            RG LRS   M KGVAVLSS+EGV GTI+F QEGDGPTTVTGN+SGLKPG HGFHVHALGD
Sbjct  6    RGVLRSHRTMAKGVAVLSSNEGVCGTIYFAQEGDGPTTVTGNISGLKPGLHGFHVHALGD  65

Query  213  TTNGCMSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSI  392
            TTNGCMSTGPHFNPAGKEHGAPED  RHAGDLGN+ VG+DGT +FTI DKQIPL G NSI
Sbjct  66   TTNGCMSTGPHFNPAGKEHGAPEDANRHAGDLGNVNVGDDGTVSFTIIDKQIPLCGPNSI  125

Query  393  IGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            IGRAVVVHGDPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  126  IGRAVVVHGDPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  165



>ref|XP_006382702.1| Cu/Zn superoxide dismutase family protein [Populus trichocarpa]
 ref|XP_006382703.1| hypothetical protein POPTR_0005s04590g [Populus trichocarpa]
 gb|ABK93317.1| unknown [Populus trichocarpa]
 gb|ERP60499.1| Cu/Zn superoxide dismutase family protein [Populus trichocarpa]
 gb|ERP60500.1| hypothetical protein POPTR_0005s04590g [Populus trichocarpa]
Length=152

 Score =   276 bits (706),  Expect = 6e-92, Method: Compositional matrix adjust.
 Identities = 139/151 (92%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AJE26130.1| superoxide dismutase [Salix matsudana]
Length=152

 Score =   275 bits (703),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFFTQEGD PTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVCGTIFFTQEGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNITVG+DGTA+FTI+DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNITVGDDGTASFTISDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ACI46676.1| Cu/Zn superoxide dismutase [Gossypium arboreum]
Length=152

 Score =   275 bits (703),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGT+FFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTVFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDVNRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFY26880.1| CuZn superoxide dismutase [Ipomoea batatas]
Length=152

 Score =   275 bits (703),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGV GTIFFTQ+GDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVKGTIFFTQDGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D+ RHAGDLGNITVGEDGTA+FTITDKQIPLTGA+SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDDENRHAGDLGNITVGEDGTASFTITDKQIPLTGAHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHE SK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHEHSKSTGNAGGRVACGIIGLQ  151



>sp|O49073.1|SODC_PAUKA RecName: Full=Superoxide dismutase [Paulownia kawakamii]
 gb|AAB92612.1| superoxide dismutase [Paulownia kawakamii]
Length=152

 Score =   275 bits (702),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVLSSSEGVSGTI+FTQEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKGVAVLSSSEGVSGTIYFTQEGDGPTTVTGNVSGLKPGPHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D++RHAGDLGN+TVGEDGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDDEVRHAGDLGNVTVGEDGTAAFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGN GGRVACGI GLQ
Sbjct  121  DPDDLGKGGHELSKTTGNTGGRVACGINGLQ  151



>gb|ABS71028.2| copper-zinc superoxide dismutase [Arnebia euchroma]
Length=152

 Score =   275 bits (702),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVGEDGTA+FTI DKQ+PLTG  SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGEDGTASFTIVDKQLPLTGLTSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|XP_011032547.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 [Populus euphratica]
 ref|XP_011032548.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 [Populus euphratica]
Length=152

 Score =   275 bits (702),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 145/151 (96%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV+GTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVNGTIFFTQEGDGPTTVTGNLSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPLGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_006342731.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 [Solanum tuberosum]
Length=152

 Score =   274 bits (701),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTI FTQ+GD PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITD+QIPLTG+ SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDQQIPLTGSQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|XP_010320610.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010320614.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 isoform X1 [Solanum 
lycopersicum]
Length=152

 Score =   274 bits (701),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTI FTQ+GD PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|AHN82532.1| Cu/Zn superoxide dismutase [Populus alba x Populus glandulosa]
Length=152

 Score =   274 bits (701),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S EGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSCEGVSGTIFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ABF48717.1| cytoplasmic Cu/Zn-superoxide dismutase [Populus suaveolens]
Length=152

 Score =   274 bits (700),  Expect = 5e-91, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHAL DTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALRDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ABK92960.1| unknown [Populus trichocarpa]
 gb|ABK94197.1| unknown [Populus trichocarpa]
 gb|ABN58428.1| Cu-Zn superoxide dismutase [Populus trichocarpa]
Length=152

 Score =   273 bits (698),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 138/151 (91%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTIFFTQEGDG TTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEGDGQTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|EYU43879.1| hypothetical protein MIMGU_mgv1a015577mg [Erythranthe guttata]
Length=152

 Score =   273 bits (698),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV+GTIFFTQEGDGPTTV GNVSGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKGVAVLKSSEGVNGTIFFTQEGDGPTTVNGNVSGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED++RHAGDLGN+TVGEDGTA FTI D+QIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDEVRHAGDLGNVTVGEDGTAAFTIIDEQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSKTTGNAGGRVACGIIG+Q
Sbjct  121  DADDLGKGGHELSKTTGNAGGRVACGIIGIQ  151



>gb|AFN42318.1| Cu,Zn superoxide dismutase C95A [synthetic construct]
Length=152

 Score =   273 bits (697),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTAAFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>sp|O65768.1|SODC_CARPA RecName: Full=Superoxide dismutase [Carica papaya]
 emb|CAA73929.1| copper/zinc-superoxide dismutase [Carica papaya]
Length=152

 Score =   273 bits (697),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFFTQ  DGPTTVTG +SGLKPGHHGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIFFTQAADGPTTVTGEISGLKPGHHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPEDDIRHAGDLGN+ VG+DG  +F+I D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDDIRHAGDLGNVNVGDDGKVSFSIIDSQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>emb|CDO98927.1| unnamed protein product [Coffea canephora]
Length=226

 Score =   275 bits (704),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/160 (86%), Positives = 143/160 (89%), Gaps = 0/160 (0%)
 Frame = +3

Query  33   RGALRSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGD  212
            RG LRS   MVK V VL  SEGV GTI+FTQEGDGPTTVTG VSGLKPG HGFHVHALGD
Sbjct  66   RGVLRSHKTMVKAVVVLGCSEGVKGTIYFTQEGDGPTTVTGEVSGLKPGLHGFHVHALGD  125

Query  213  TTNGCMSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSI  392
            TTNGC+STGPHFNP GKEHGAPED+ RHAGDLGNITVGEDGTA+F I DKQIPL+G  S+
Sbjct  126  TTNGCLSTGPHFNPGGKEHGAPEDENRHAGDLGNITVGEDGTASFNIVDKQIPLSGPLSV  185

Query  393  IGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            IGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  186  IGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  225



>gb|AAA88196.1| cytosolic copper/zinc-superoxide dismutase [Ipomoea batatas]
 prf||2118341A Cu/Zn-superoxide dismutase
Length=151

 Score =   273 bits (697),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFF+QEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKRVAVLSSSEGVSGTIFFSQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP DD RHAGDLGNITVGEDGTA+FTITDKQIPLTGANS+IGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPGDDNRHAGDLGNITVGEDGTASFTITDKQIPLTGANSVIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVAC  494
            DPDDLGKGGHELSK+TGNAGGRVAC
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVAC  145



>pdb|2Q2L|A Chain A, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina
 pdb|2Q2L|B Chain B, Crystal Structure Of Superoxide Dismutase From P. Atrosanguina
 gb|ACB38158.1| Cu/Zn superoxide dismutase [Potentilla atrosanguinea]
Length=152

 Score =   272 bits (696),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|ABA00453.1| cytoplasmic Cu/ZnSOD [Gossypium hirsutum]
 gb|KHG07500.1| Superoxide dismutase [Cu-Zn] [Gossypium arboreum]
Length=152

 Score =   272 bits (696),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+EGVSGT+FF+QEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSNEGVSGTVFFSQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|KJB81932.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
 gb|KJB81934.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
 gb|KJB81935.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
 gb|KJB81936.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
 gb|KJB81937.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
 gb|KJB81938.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
Length=152

 Score =   272 bits (695),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSS+EGVSGT+FF+QEGDGPTTVTGN+SGLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSNEGVSGTVFFSQEGDGPTTVTGNLSGLKAGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>dbj|BAG16516.1| putative Cu/Zn superoxide dismutase [Capsicum chinense]
Length=152

 Score =   272 bits (695),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSE VSGTI F+Q+GD PTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSECVSGTILFSQDGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGNITVGEDGTA+FTITD+QIPLTG  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDENRHAGDLGNITVGEDGTASFTITDEQIPLTGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>sp|Q43779.3|SODC2_SOLLC RecName: Full=Superoxide dismutase [Cu-Zn] 2 [Solanum lycopersicum]
 emb|CAA60826.1| cytosolic Cu,Zn superoxide dismutase [Solanum lycopersicum]
Length=152

 Score =   272 bits (695),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTI FTQ+G  PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTILFTQDGAAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|AFS44500.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   271 bits (694),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKKTGNAGGRIACGIIGLQ  151



>gb|AAD01605.1| copper/zinc-superoxide dismutase [Populus tremuloides]
Length=152

 Score =   271 bits (694),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 137/151 (91%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTA FTI D QIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTAAFTIIDFQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AFS44502.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   271 bits (694),  Expect = 4e-90, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI F+QEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFSQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|ADH59419.1| cytosolic copper/zinc superoxide dismutase [Amaranthus hypochondriacus]
Length=152

 Score =   271 bits (694),  Expect = 5e-90, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGV VL+SSEGV+GTI+FTQEGDGPTTV+GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVTVLNSSEGVTGTIYFTQEGDGPTTVSGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PEDD+RHAGDLGNIT G+DGTATFT+ D QIPL+GANSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDDVRHAGDLGNITAGDDGTATFTLIDSQIPLSGANSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRIACGIIGLQ  151



>ref|NP_001275009.1| Cu/Zn-superoxide dismutase [Solanum tuberosum]
 gb|AEK65119.1| copper-zinc superoxide dismutase [Solanum tuberosum]
Length=152

 Score =   271 bits (693),  Expect = 6e-90, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI FTQ+GD PTTV GN+SGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLNSSEGVCGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCVSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG+ SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGSQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|KHG04013.1| Superoxide dismutase [Cu-Zn] [Gossypium arboreum]
 gb|KJB80822.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
 gb|KJB80823.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
 gb|KJB80824.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
 gb|KJB80825.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
 gb|KJB80826.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
 gb|KJB80827.1| hypothetical protein B456_013G116800 [Gossypium raimondii]
Length=152

 Score =   271 bits (693),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGT+FFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTVFFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+TVG DG+A+F+I DKQIPL+G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDVNRHAGDLGNVTVGADGSASFSIVDKQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_011090864.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Sesamum indicum]
 ref|XP_011090865.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Sesamum indicum]
Length=153

 Score =   271 bits (693),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSG IFFTQEGDGPTTV G+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGKIFFTQEGDGPTTVVGDVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED++RHAGDLGNI VGEDG+A F I DKQIPL G +SIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDEVRHAGDLGNIKVGEDGSAHFEIVDKQIPLAGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFS44496.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   271 bits (692),  Expect = 8e-90, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKAVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|XP_006855398.1| hypothetical protein AMTR_s00057p00145850 [Amborella trichopoda]
 gb|ERN16865.1| hypothetical protein AMTR_s00057p00145850 [Amborella trichopoda]
Length=176

 Score =   271 bits (694),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 134/152 (88%), Positives = 141/152 (93%), Gaps = 0/152 (0%)
 Frame = +3

Query  57   KMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMST  236
            KMVK VAVL S EGVSGT+FFTQEGDGPTTVTG++SGL+PG HGFHVHALGDTTNGCMST
Sbjct  24   KMVKAVAVLGSKEGVSGTVFFTQEGDGPTTVTGSLSGLQPGPHGFHVHALGDTTNGCMST  83

Query  237  GPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVH  416
            GPHFNP GKEHGAPED+ RHAGDLGN+TVGEDGTA FTI D QIPL+G NSIIGRAVVVH
Sbjct  84   GPHFNPVGKEHGAPEDENRHAGDLGNVTVGEDGTANFTIVDSQIPLSGPNSIIGRAVVVH  143

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  144  ADPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  175



>gb|KJB81931.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
Length=211

 Score =   273 bits (697),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 142/190 (75%), Positives = 152/190 (80%), Gaps = 30/190 (16%)
 Frame = +3

Query  33   RGALRSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGD  212
            RGALRS TKMVK VAVLSS+EGVSGT+FF+QEGDGPTTVTGN+SGLK G HGFHVHALGD
Sbjct  21   RGALRSHTKMVKAVAVLSSNEGVSGTVFFSQEGDGPTTVTGNLSGLKAGLHGFHVHALGD  80

Query  213  TTNGCMSTG------------------------------PHFNPAGKEHGAPEDDIRHAG  302
            TTNGCMSTG                              PHFNPAGKEHGAPED+ RHAG
Sbjct  81   TTNGCMSTGKRLEVGFVGFSWLLCICFLDFDLEVNLFAGPHFNPAGKEHGAPEDENRHAG  140

Query  303  DLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGG  482
            DLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH DPDDLGKGGHELSK+TGNAGG
Sbjct  141  DLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKSTGNAGG  200

Query  483  RVACGIIGLQ  512
            RVACGIIGLQ
Sbjct  201  RVACGIIGLQ  210



>gb|AAD01604.1| cytoplasmic superoxide dismutase 1 [Populus tremuloides]
Length=152

 Score =   270 bits (691),  Expect = 1e-89, Method: Compositional matrix adjust.
 Identities = 136/151 (90%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGTIFFTQEGDGPTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEGDGPTTVIGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTA FTI DKQIPLTG +SIIG AVVVHG
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTAAFTIIDKQIPLTGPHSIIGWAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ACJ11749.1| copper/zinc superoxide dismutase [Gossypium hirsutum]
Length=152

 Score =   270 bits (690),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSS+EGVSGT+FF+QEGDGPTTVTGN+SGLK G HGFHVHALGD TNGCMSTG
Sbjct  1    MVKAVAVLSSNEGVSGTVFFSQEGDGPTTVTGNLSGLKAGLHGFHVHALGDITNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFS44503.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   270 bits (690),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 142/150 (95%), Gaps = 0/150 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGL  509
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGL
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGL  150



>gb|AGL12266.1| Cu-Zn superoxide dismutase [Salicornia europaea]
Length=152

 Score =   270 bits (690),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K V VLSSSEGV+GTI FTQEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MGKAVVVLSSSEGVAGTINFTQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCVSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVG+DGTATFTI D QIPL+GANSI+GRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGDDGTATFTIIDSQIPLSGANSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AAT77951.1| copper/zinc superoxide dismutase [Manihot esculenta]
Length=152

 Score =   270 bits (690),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV+GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVAGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPEDDIRHAGDLGN+T G+DGTA+FTI DK IPL+G +SI+GRAVVVH 
Sbjct  61   PHFNPGGKEHGAPEDDIRHAGDLGNVTAGDDGTASFTIVDKDIPLSGPHSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>ref|XP_007030135.1| Copper/zinc superoxide dismutase 1 [Theobroma cacao]
 gb|EOY10637.1| Copper/zinc superoxide dismutase 1 [Theobroma cacao]
Length=235

 Score =   273 bits (698),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/150 (89%), Positives = 141/150 (94%), Gaps = 0/150 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTIFFTQEGDGPTTVTGN+SGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIFFTQEGDGPTTVTGNISGLEPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG  +F+I DKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCVSFSIIDKQIPLTGPLSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGL  509
            DPDDLGKGGHELSKTTGNAGGRVACGIIGL
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGL  150



>gb|AFS44499.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   270 bits (689),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHE SK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHEESKSTGNAGGRIACGIIGLQ  151



>dbj|BAJ07302.1| copper/zinc superoxide dismutase [Melastoma malabathricum]
Length=152

 Score =   270 bits (689),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL +SEGVSGT++FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGNSEGVSGTVYFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DGTATFTITDKQIPL G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGTATFTITDKQIPLFGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|AFS44497.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   269 bits (688),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKIVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|XP_004288233.1| PREDICTED: superoxide dismutase [Cu-Zn] [Fragaria vesca subsp. 
vesca]
Length=152

 Score =   269 bits (688),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL SSEGV+GTI FTQEGDGPTTVTGN++GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLCSSEGVAGTILFTQEGDGPTTVTGNITGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNITVG+DG A FTI DKQIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNITVGDDGKACFTIVDKQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>sp|P22233.1|SODC_SPIOL RecName: Full=Superoxide dismutase [Spinacia oleracea]
 emb|CAA37866.1| unnamed protein product [Spinacia oleracea]
Length=152

 Score =   269 bits (688),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K V VLSSSEGVSGT++F QEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKAVVVLSSSEGVSGTVYFAQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NP GKEHGAPEDD+RHAGDLGNITVG+DGTATFTI D QIPL+G NSI+GRAVVVH 
Sbjct  61   PHYNPNGKEHGAPEDDVRHAGDLGNITVGDDGTATFTIIDSQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            +PDDLG+GGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  EPDDLGRGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AAD48484.1|AF170297_1 copper/zinc-superoxide dismutase [Manihot esculenta]
Length=152

 Score =   269 bits (688),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 143/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK  AVL+SSEGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAEAVLTSSEGVSGTIFFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP+GK+HGAPED+IRHAGDLGN+T G+DGTA+FTI DK IPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPSGKDHGAPEDEIRHAGDLGNVTAGDDGTASFTIIDKHIPLSGQNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGRVACGIIGL+
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACGIIGLR  151



>gb|AAT66935.1| superoxide dismutase [Malus baccata var. xiaojinensis]
Length=152

 Score =   269 bits (687),  Expect = 4e-89, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI F QEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLGSSEGVKGTISFVQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED++RHAGDLGNIT G+DGTATFTI DKQIPL G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDELRHAGDLGNITAGDDGTATFTIVDKQIPLAGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFS44501.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   269 bits (687),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+A GIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIAAGIIGLQ  151



>gb|AFS44498.1| Cu/Zn superoxide dismutase [synthetic construct]
Length=152

 Score =   269 bits (687),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV+GTI FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNG MSTG
Sbjct  1    MAKGVAVLSSSEGVAGTILFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGAMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+PED+ RHAGDLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGSPEDETRHAGDLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>emb|CAH59422.1| copper-zinc superoxide dismutase [Plantago major]
Length=152

 Score =   269 bits (687),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 144/151 (95%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVLSSSEGVSGT+ F+QEG+GPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLSSSEGVSGTVLFSQEGEGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPA KEHGAP+D++RHAGDLGN+TVG+DGTA+FTI DK IPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAAKEHGAPDDEVRHAGDLGNVTVGDDGTASFTIVDKLIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACGIIGLQ  151



>sp|P93258.1|SODC1_MESCR RecName: Full=Superoxide dismutase [Cu-Zn] 1 [Mesembryanthemum 
crystallinum]
 gb|AAB40394.1| cytosolic copper/zinc superoxide dismutase [Mesembryanthemum 
crystallinum]
Length=152

 Score =   269 bits (687),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VLSSSEGVSGT+ FTQEG GPTTVTGNVSGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLSSSEGVSGTVQFTQEGSGPTTVTGNVSGLRPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNITVG+DGTATFTI D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDETRHAGDLGNITVGDDGTATFTIIDSQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGRGGHELSKATGNAGGRVACGVIGLQ  151



>gb|AAK26435.1|AF354748_1 copper-zinc superoxide dismutase [Solanum tuberosum]
Length=148

 Score =   268 bits (686),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 131/147 (89%), Positives = 140/147 (95%), Gaps = 0/147 (0%)
 Frame = +3

Query  72   VAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFN  251
            VAVLSSSEGV GTI FTQ+GD PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTGPH+N
Sbjct  1    VAVLSSSEGVCGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTGPHYN  60

Query  252  PAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDD  431
            PAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG+ SIIGRAVVVH DPDD
Sbjct  61   PAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGSQSIIGRAVVVHADPDD  120

Query  432  LGKGGHELSKTTGNAGGRVACGIIGLQ  512
            LGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  LGKGGHELSKSTGNAGGRIACGIIGLQ  147



>sp|O22373.1|SODC_CAPAN RecName: Full=Superoxide dismutase [Capsicum annuum]
 gb|AAB66812.1| Cu/Zn superoxide dismutase [Capsicum annuum]
Length=152

 Score =   268 bits (686),  Expect = 6e-89, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSE VSGTI F+Q+GD PTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSECVSGTILFSQDGDAPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGNITVGEDGTA+FTITD+QIPLTG  SIIGR VVVH 
Sbjct  61   PHYNPAGKEHGAPEDENRHAGDLGNITVGEDGTASFTITDEQIPLTGPQSIIGRGVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHEL+KTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELTKTTGNAGGRVACGIIGLQ  151



>gb|AFH96953.1| Cu/Zn superoxide dismutase [Eleutherococcus senticosus]
Length=152

 Score =   268 bits (686),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSS GVSGTI+FTQE DGPTTVTGN+SGL PG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLSSSAGVSGTIYFTQEEDGPTTVTGNLSGLAPGPHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+TVGEDGTATFTI DKQIPL G+ SIIGRAVVVHG
Sbjct  61   PHYNPAGKEHGAPEDENRHAGDLGNVTVGEDGTATFTIVDKQIPLIGSGSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_008370655.1| PREDICTED: superoxide dismutase [Cu-Zn] [Malus domestica]
 ref|XP_008345699.1| PREDICTED: superoxide dismutase [Cu-Zn] [Malus domestica]
Length=152

 Score =   268 bits (686),  Expect = 7e-89, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI F QEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLGSSEGVKGTISFVQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED +RHAGDLGNIT G+DGTATFTI DKQIPL G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDXVRHAGDLGNITAGDDGTATFTIVDKQIPLAGPDSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|NP_001234031.1| superoxide dismutase [Cu-Zn] 1 [Solanum lycopersicum]
 sp|P14830.2|SODC1_SOLLC RecName: Full=Superoxide dismutase [Cu-Zn] 1 [Solanum lycopersicum]
 emb|CAA32199.1| unnamed protein product [Solanum lycopersicum]
 gb|AAA34194.1| superoxide dismutase (SOD) [Solanum lycopersicum]
Length=152

 Score =   268 bits (685),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGVSGT  FTQ G  PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVSGTYLFTQVGVAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|AFD50704.1| Cu/Zn superoxide dismutase [Suaeda salsa]
Length=152

 Score =   268 bits (685),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K V VLSSS GV+GTI+FTQEG+GPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKAVVVLSSSAGVAGTIYFTQEGEGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGNITVG+DGTATFTI D QIPL+G NSI+GRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNITVGDDGTATFTIIDSQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010553746.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Tarenaya hassleriana]
Length=152

 Score =   268 bits (684),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGV GTI F QEGDGPT V+GNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVKGTINFAQEGDGPTNVSGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNITVG DGTA FTI D QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDEHRHAGDLGNITVGADGTANFTIVDNQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010674951.1| PREDICTED: superoxide dismutase [Cu-Zn] [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010674952.1| PREDICTED: superoxide dismutase [Cu-Zn] [Beta vulgaris subsp. 
vulgaris]
Length=152

 Score =   268 bits (684),  Expect = 1e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K V VL+SSEGV+GTI+FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKAVVVLNSSEGVTGTIYFTQEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED++RHAGDLGN+TVG+DGTATFTI D QIPL G NS++GRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEVRHAGDLGNVTVGDDGTATFTIIDSQIPLCGPNSVVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACGVIGLQ  151



>ref|XP_010025114.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 isoform X1 [Eucalyptus 
grandis]
 gb|KCW61707.1| hypothetical protein EUGRSUZ_H04426 [Eucalyptus grandis]
 gb|KCW61708.1| hypothetical protein EUGRSUZ_H04426 [Eucalyptus grandis]
Length=152

 Score =   267 bits (683),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GT+ F QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVTGTVHFVQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG++GTATFTITDKQIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDNGTATFTITDKQIPLTGPNSIVGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_008796193.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X2 [Phoenix dactylifera]
 ref|XP_008796194.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X2 [Phoenix dactylifera]
Length=152

 Score =   267 bits (682),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  SEGV GT++FTQEGDGPTTVTG++SGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGSEGVKGTVYFTQEGDGPTTVTGSLSGLQPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+IRHAGDLGN+  G+DGT +FTITD QIPL+G NSIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDEIRHAGDLGNVIAGDDGTVSFTITDSQIPLSGPNSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFF57842.1| Cu/Zn superoxide dismutase [Tetradium ruticarpum]
Length=152

 Score =   267 bits (682),  Expect = 3e-88, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV GT+ FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVKGTVSFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+ VG+DGTATFTI D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVNVGDDGTATFTIVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AEV43309.1| Cu/Zn superoxide dismutase [Zoysia japonica]
Length=152

 Score =   266 bits (681),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+EGV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSNEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+IRHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEIRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_008450736.1| PREDICTED: superoxide dismutase [Cu-Zn] [Cucumis melo]
 ref|XP_008450737.1| PREDICTED: superoxide dismutase [Cu-Zn] [Cucumis melo]
Length=152

 Score =   266 bits (681),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGVSGTIFFTQEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED+ RHAGDLGNI VGEDGTA FTITD QI L G +SIIGRAVVVHG
Sbjct  61   PHFNPAGKQHGAPEDENRHAGDLGNIIVGEDGTANFTITDNQISLCGKDSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAG RVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLSTGNAGARVACGIIGLQ  151



>ref|XP_007147112.1| hypothetical protein PHAVU_006G097000g [Phaseolus vulgaris]
 gb|AHA84142.1| opper/zinc superoxide dismutase [Phaseolus vulgaris]
 gb|ESW19106.1| hypothetical protein PHAVU_006G097000g [Phaseolus vulgaris]
Length=152

 Score =   266 bits (681),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GT++F+QEG+GPTTVTG++SGLKPGHHGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVTGTVYFSQEGNGPTTVTGSLSGLKPGHHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+ VG+DGTA FT+TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPNGKEHGAPEDESRHAGDLGNVNVGDDGTANFTLTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|NP_001267697.1| superoxide dismutase [Cu-Zn]-like [Cucumis sativus]
 ref|XP_004157274.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Cucumis sativus]
 gb|ACA49507.1| cytosolic superoxide dismutase [Cucumis sativus]
 gb|KGN66141.1| hypothetical protein Csa_1G573600 [Cucumis sativus]
Length=152

 Score =   266 bits (681),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGVSGTIFFTQEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED+ RHAGDLGNI VGEDG A FTITD QIPL G  SIIGRAVVVHG
Sbjct  61   PHFNPAGKQHGAPEDENRHAGDLGNIIVGEDGKANFTITDCQIPLCGHESIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAG RVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSSSTGNAGARVACGIIGLQ  151



>ref|XP_009352428.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 [Pyrus x bretschneideri]
 ref|XP_009342015.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 [Pyrus x bretschneideri]
Length=152

 Score =   266 bits (680),  Expect = 5e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI F QEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLGSSEGVKGTISFVQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNIT G+DGT TFTI DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDEDRHAGDLGNITAGDDGTVTFTIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010528833.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 [Tarenaya hassleriana]
Length=152

 Score =   266 bits (679),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 135/151 (89%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLS SEGV GTI FTQEGDGPTTVTGNVSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSCSEGVKGTINFTQEGDGPTTVTGNVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D  RHAGDLGNITVG+DGTA FTI D QIPL G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDDGNRHAGDLGNITVGDDGTANFTIVDSQIPLAGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>sp|Q9SQL5.1|SODC_ANACO RecName: Full=Superoxide dismutase [Ananas comosus]
 emb|CAB60191.1| copper/zinc-superoxide dismutase [Ananas comosus]
Length=152

 Score =   266 bits (679),  Expect = 7e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV GTI+FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVKGTIYFTQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG EHGAPED+ RHAGDLGN+TVGEDGT    I D QIPL+G+NSIIGRAVVVH 
Sbjct  61   PHFNPAGNEHGAPEDETRHAGDLGNVTVGEDGTVNVNIVDSQIPLSGSNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_010921717.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Elaeis guineensis]
 ref|XP_010921718.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Elaeis guineensis]
 ref|XP_010921719.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Elaeis guineensis]
Length=152

 Score =   266 bits (679),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL  SEGV GT++FTQEGDGPTTV G++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLGCSEGVKGTVYFTQEGDGPTTVAGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPEDD RHAGDLGN+TVG+DGT +FTITD QI L+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDDNRHAGDLGNVTVGDDGTVSFTITDNQISLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ACZ51444.1| Cu/Zn superoxide dismutase [Mikania micrantha]
Length=153

 Score =   264 bits (675),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 133/152 (88%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDG-PTTVTGNVSGLKPGHHGFHVHALGDTTNGCMST  236
            MVK VAVL+SSEGVSGTIFFTQE DG PTTVTG++ GLKPG HGFHVHALGDTTNGCMST
Sbjct  1    MVKAVAVLNSSEGVSGTIFFTQEADGAPTTVTGDLCGLKPGPHGFHVHALGDTTNGCMST  60

Query  237  GPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVH  416
            GPH+NP GKEHGAP+D+IRHAGDLGN+TVGEDGTA FTI DKQIPL GA SIIGRAVVVH
Sbjct  61   GPHYNPHGKEHGAPDDEIRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGAQSIIGRAVVVH  120

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  ADPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  152



>gb|KJB81933.1| hypothetical protein B456_013G192900 [Gossypium raimondii]
Length=153

 Score =   264 bits (674),  Expect = 4e-87, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 141/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSS+EGVSGT+FF+QEGDGPTTVTGN+SGLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSNEGVSGTVFFSQEGDGPTTVTGNLSGLKAGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DG A+F+ITDKQIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTVGDDGCASFSITDKQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG + + 
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGKLSIS  151



>gb|KDP23592.1| hypothetical protein JCGZ_23425 [Jatropha curcas]
Length=152

 Score =   263 bits (673),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFFTQE DGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVKGTIFFTQEADGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+ VG+DGT  FTI DKQIPLTG +SI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDGNRHAGDLGNVNVGDDGTVNFTIVDKQIPLTGPHSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>gb|ADI48248.2| Cu/Zn superoxide dismutase [Aeluropus littoralis]
Length=152

 Score =   263 bits (673),  Expect = 7e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+EGV G+IFFTQEGDGPT VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSNEGVKGSIFFTQEGDGPTAVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+IRHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDEIRHAGDLGNVTAGADGVANVNVTDCQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_003626362.1| Superoxide dismutase [Medicago truncatula]
 gb|ACJ83988.1| unknown [Medicago truncatula]
 gb|AES82580.1| superoxide dismutase [Cu-Zn] protein [Medicago truncatula]
 gb|AFK41926.1| unknown [Medicago truncatula]
Length=152

 Score =   263 bits (673),  Expect = 8e-87, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL +S  VSGTI FTQEG+GPTTVTGN+SGLKPG HGFH+HALGDTTNGC+STG
Sbjct  1    MVKAVAVLGNSNDVSGTISFTQEGNGPTTVTGNLSGLKPGLHGFHIHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTA+FTITD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPNGKEHGAPEDETRHAGDLGNVTVGDDGTASFTITDNQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>dbj|BAQ21272.1| copper zinc superoxide dismutase [Citrus tamurana]
Length=152

 Score =   263 bits (672),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  +EGV GT+ FTQEGDGPTTV+G++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGTEGVKGTVSFTQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPEDD RHAGDLGN+ VG+DGTATFT+ D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDDNRHAGDLGNVNVGDDGTATFTVVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|NP_001105704.1| superoxide dismutase [Cu-Zn] 4AP [Zea mays]
 sp|P23345.2|SODC4_MAIZE RecName: Full=Superoxide dismutase [Cu-Zn] 4A [Zea mays]
 emb|CAB57992.1| superoxide dismutase-4AP [Zea mays]
 gb|ACR37759.1| unknown [Zea mays]
Length=152

 Score =   263 bits (671),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPA KEHGAPED+ RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_002512288.1| cu/zn superoxide dismutase, putative [Ricinus communis]
 gb|EEF49740.1| cu/zn superoxide dismutase, putative [Ricinus communis]
Length=152

 Score =   263 bits (671),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSEGV GTIFFTQE DGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLGSSEGVKGTIFFTQEADGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAP D+ RHAGDLGN+TVG+DGTATFTI D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPGDENRHAGDLGNVTVGDDGTATFTIVDTQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|XP_010938694.1| PREDICTED: superoxide dismutase [Cu-Zn] [Elaeis guineensis]
Length=152

 Score =   263 bits (671),  Expect = 1e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  SEGV GT++FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGSEGVKGTVYFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG EHGAPED+IRHAGDLGN+T G+DGT  FTI D +IPL+G+NSIIGRAVVVH 
Sbjct  61   PHFNPAGHEHGAPEDEIRHAGDLGNVTAGDDGTVNFTIIDSKIPLSGSNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AFC35181.1| copper/zinc-superoxide dismutase, partial [Populus x canadensis]
Length=143

 Score =   262 bits (669),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 132/142 (93%), Positives = 137/142 (96%), Gaps = 0/142 (0%)
 Frame = +3

Query  87   SSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKE  266
            SSEGVSGTIFFTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTGPHFNP GKE
Sbjct  1    SSEGVSGTIFFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPLGKE  60

Query  267  HGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGG  446
            HGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHGDPDDLGKGG
Sbjct  61   HGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHGDPDDLGKGG  120

Query  447  HELSKTTGNAGGRVACGIIGLQ  512
            HELSKTTGNAGGRVACGIIGLQ
Sbjct  121  HELSKTTGNAGGRVACGIIGLQ  142



>gb|AAK06837.1|AF328859_1 Cu-Zn superoxide dismutase [Avicennia marina]
Length=152

 Score =   262 bits (670),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVLSS+EGV GT++FTQEGDGPTTVTGN+SG K G HGFHVHALGDTTNGCMSTG
Sbjct  1    MPKAVAVLSSNEGVRGTVYFTQEGDGPTTVTGNLSGFKSGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED++RHAGDLGNITVGEDGTA   I DKQIPL+G +SI+GRAVVVH 
Sbjct  61   PHFNPAGKDHGAPEDEVRHAGDLGNITVGEDGTAAVNIVDKQIPLSGPHSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_002268476.2| PREDICTED: superoxide dismutase [Cu-Zn] isoform X1 [Vitis vinifera]
Length=189

 Score =   263 bits (673),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 127/152 (84%), Positives = 139/152 (91%), Gaps = 0/152 (0%)
 Frame = +3

Query  57   KMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMST  236
            KMVK VAVL+S+EG  GTI+F +EGDG TTVTG++SGLKPG HGFHVHALGDTTNGCMST
Sbjct  37   KMVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMST  96

Query  237  GPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVH  416
            GPHFNPAGKEHGAPED+ RHAGDLGN+ VGEDGT  F I DKQIPLTG+NSI+GRAVVVH
Sbjct  97   GPHFNPAGKEHGAPEDENRHAGDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVH  156

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  157  ADPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  188



>gb|KDO42713.1| hypothetical protein CISIN_1g0318371mg [Citrus sinensis]
Length=152

 Score =   262 bits (669),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  +EGV GT+ F+QEGDGPTTV+G++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPEDD RHAGDLGN+ VG+DGTATFT+ D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDDNRHAGDLGNVNVGDDGTATFTVVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_011023491.1| PREDICTED: superoxide dismutase [Cu-Zn] [Populus euphratica]
 ref|XP_011023492.1| PREDICTED: superoxide dismutase [Cu-Zn] [Populus euphratica]
Length=152

 Score =   262 bits (669),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI FTQEGDGPTTVTG++ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTAT +I D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATVSIVDNQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>gb|ABX54859.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   262 bits (669),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVAGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_002319589.1| Cu/Zn superoxide dismutase family protein [Populus trichocarpa]
 ref|XP_006375790.1| hypothetical protein POPTR_0013s03160g [Populus trichocarpa]
 gb|ABK95956.1| unknown [Populus trichocarpa]
 gb|EEE95512.1| Cu/Zn superoxide dismutase family protein [Populus trichocarpa]
 gb|ERP53587.1| hypothetical protein POPTR_0013s03160g [Populus trichocarpa]
Length=152

 Score =   262 bits (669),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI FTQEGDGPTTVTG++ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTAT +I D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATVSIIDNQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>gb|ABQ10188.1| copper/zinc superoxide dismutase [Caragana jubata]
Length=152

 Score =   262 bits (669),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+EGV+GTI F+QEG+GPTTVTGN++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSNEGVTGTISFSQEGNGPTTVTGNLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED  RHAGDLGN+ VG+DGTA FTITD QIPLTG NSIIGRAVVVHG
Sbjct  61   PHFNPQGKEHGAPEDVNRHAGDLGNVNVGDDGTAKFTITDSQIPLTGPNSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ACU52583.1| copper/zinc superoxide dismutase [Lantana camara]
Length=152

 Score =   261 bits (668),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTI F+QEGD  TTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTILFSQEGDDTTTVTGSLSGLKPGQHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGN+TVGEDG A+FTI DKQIPLTG +SI+GRAVVVH 
Sbjct  61   PHFNPGGKEHGAPGDENRHAGDLGNVTVGEDGKASFTIVDKQIPLTGPHSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_002889716.1| hypothetical protein ARALYDRAFT_888118 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65975.1| hypothetical protein ARALYDRAFT_888118 [Arabidopsis lyrata subsp. 
lyrata]
Length=152

 Score =   261 bits (668),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/151 (89%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDTQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|AAV97749.1| CuZn superoxide dismutase [Codonopsis lanceolata]
Length=152

 Score =   261 bits (668),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SS GVSGT+ FTQEGDGPT VTG++SGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSSAGVSGTVQFTQEGDGPTKVTGSLSGLQPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+IRHAGDLGN+TVGEDGTA FTI D QIPL+G +SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEIRHAGDLGNVTVGEDGTANFTIVDNQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>sp|Q8L5E0.2|ALL5B_OLEEU RecName: Full=Superoxide dismutase [Cu-Zn] 2; AltName: Full=Allergen 
Ole e V; AltName: Allergen=Ole e 5 [Olea europaea]
 emb|CAD21706.2| Cu /Zn super-oxide dismutase [Olea europaea]
 gb|ABP58626.1| pollen allergen Ole e 5 [Olea europaea]
 gb|ABP58628.1| pollen allergen Ole e 5 [Olea europaea]
 gb|ABP58629.1| pollen allergen Ole e 5 [Olea europaea]
 gb|ABP58630.1| pollen allergen Ole e 5 [Olea europaea]
 gb|ABP58631.1| pollen allergen Ole e 5 [Olea europaea]
 gb|ABX26133.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26135.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26136.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26137.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26142.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26144.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26146.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26148.1| allergen Ole e 5 [Olea europaea]
 gb|ABX26149.1| allergen Ole e 5 [Olea europaea]
 gb|ABX54839.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54840.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54841.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54843.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54846.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54847.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54848.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54850.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54852.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54853.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54856.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54857.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54858.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54860.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54861.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54863.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54865.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54867.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54868.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54870.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54871.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54872.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54873.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54875.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54879.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   261 bits (668),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_004984367.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A-like isoform X3 [Setaria 
italica]
Length=152

 Score =   261 bits (668),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSEGV GTI+FTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSEGVKGTIYFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPEDD RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDDNRHAGDLGNVTAGADGVANIHVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|ACA50531.1| CuZn superoxide dismutase [Avicennia marina]
Length=152

 Score =   261 bits (668),  Expect = 4e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVLSS+EGV GT++FTQEGDGPTTVTGN+SG K G HGFHVHALGDTTNGCMSTG
Sbjct  1    MPKAVAVLSSNEGVRGTVYFTQEGDGPTTVTGNLSGFKSGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED++RHAGDLGNITVGEDGTA   I DKQIPL+G +SI+GRAVVVH 
Sbjct  61   PHFNPAGKDHGAPEDEVRHAGDLGNITVGEDGTAAVNIVDKQIPLSGPHSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGI+GLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIVGLQ  151



>ref|XP_008388620.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Malus domestica]
 ref|XP_008388621.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Malus domestica]
 ref|XP_008388622.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Malus domestica]
 gb|ABD91536.1| Sod2 [Malus baccata var. xiaojinensis]
Length=152

 Score =   261 bits (667),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI F QEGDGPTTVTG +SGLKPG HGFHVHA GDTTNGC+STG
Sbjct  1    MVKGVAVLGSSEGVKGTINFVQEGDGPTTVTGCISGLKPGLHGFHVHAFGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFT+ DKQIPLTG +S+IGRAVVVHG
Sbjct  61   PHFNPNGKEHGAPEDEDRHAGDLGNVTVGDDGTATFTLIDKQIPLTGPHSVIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AAQ14591.1| copper/zinc superoxide dismutase [Citrus limon]
Length=152

 Score =   261 bits (667),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  +EGV GT+ FTQEGDGPTTV+G++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGTEGVKGTVSFTQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPEDD RHAGDLGN+ V +DGTATFT+ D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDDNRHAGDLGNVNVSDDGTATFTVVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>sp|O04996.3|SODC_SOLCS RecName: Full=Superoxide dismutase [Solidago canadensis var. 
scabra]
 dbj|BAA19674.1| copper/zinc-superoxide dismutase [Solidago canadensis var. scabra]
Length=153

 Score =   261 bits (667),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 132/152 (87%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDG-PTTVTGNVSGLKPGHHGFHVHALGDTTNGCMST  236
            MVK VAVLSSSEGVSGTIFF+QE +G PTTVTG++SGLKPG HGFHVHALGDTTNGCMST
Sbjct  1    MVKAVAVLSSSEGVSGTIFFSQEAEGAPTTVTGDLSGLKPGPHGFHVHALGDTTNGCMST  60

Query  237  GPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVH  416
            GPH+NP GK+HGAP+D+ RHAGDLGN+TVGEDGTA FTI DKQIPL GA SIIGRAVVVH
Sbjct  61   GPHYNPHGKDHGAPDDEHRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGAQSIIGRAVVVH  120

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  ADPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  152



>gb|ABX54842.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54854.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54874.1| Ole e 5 olive pollen allergen [Olea europaea]
 gb|ABX54878.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   261 bits (667),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTT+TGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTITGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54845.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   261 bits (667),  Expect = 5e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGN+TVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNVTVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|NP_001060564.1| Os07g0665200 [Oryza sativa Japonica Group]
 sp|P28757.2|SODC2_ORYSJ RecName: Full=Superoxide dismutase [Cu-Zn] 2 [Oryza sativa Japonica 
Group]
 dbj|BAA00800.1| copper/zinc-superoxide dismutase [Oryza sativa Japonica Group]
 gb|AAC14465.1| cytosolic copper/zinc-superoxide dismutase [Oryza sativa Japonica 
Group]
 dbj|BAF22478.1| Os07g0665200 [Oryza sativa Japonica Group]
 gb|ABY52933.1| copper/zinc-superoxide dismutase [Oryza sativa Japonica Group]
 dbj|BAH01571.1| unnamed protein product [Oryza sativa Japonica Group]
Length=152

 Score =   261 bits (667),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFF+QEGDGPT+VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP+D+ RHAGDLGNIT G DG A   ++D QIPLTGA+SIIGRAVVVH 
Sbjct  61   PHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AAK38603.1|AF355460_1 Cu/Zn-superoxide dismutase [Solanum tuberosum]
Length=144

 Score =   261 bits (666),  Expect = 6e-86, Method: Compositional matrix adjust.
 Identities = 126/143 (88%), Positives = 137/143 (96%), Gaps = 0/143 (0%)
 Frame = +3

Query  84   SSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGK  263
            +S+EGVSGTI FTQ+GD PTTV GN+SGLKPG HGFHVHALGDTTNGCMSTGPH+NPAGK
Sbjct  1    TSTEGVSGTILFTQDGDAPTTVNGNISGLKPGLHGFHVHALGDTTNGCMSTGPHYNPAGK  60

Query  264  EHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKG  443
            EHGAPED++RHAGDLGNITVGEDGTA+FTITDKQIPLTG+ SIIGRAVVVH DPDDLGKG
Sbjct  61   EHGAPEDEVRHAGDLGNITVGEDGTASFTITDKQIPLTGSQSIIGRAVVVHADPDDLGKG  120

Query  444  GHELSKTTGNAGGRVACGIIGLQ  512
            GHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  GHELSKSTGNAGGRIACGIIGLQ  143



>gb|ADX43877.1| CuZn-superoxide dismutase 3 [Haberlea rhodopensis]
Length=152

 Score =   261 bits (666),  Expect = 7e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 142/151 (94%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGV+GT+ F QEGDG T+VTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVNGTVHFVQEGDGHTSVTGHLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED++RHAGDLGN+TVGE+GTA+FTI DKQIPL+G +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDEVRHAGDLGNVTVGENGTASFTIVDKQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRLACGIIGLQ  151



>gb|ADK56447.1| Cu/Zn superoxide dismutase [Aeluropus lagopoides]
Length=152

 Score =   261 bits (666),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+EGV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSNEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+IRHAGDLGN+T G DG A   +TD QIPLTG +SIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDEIRHAGDLGNVTAGADGVANINVTDCQIPLTGPSSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIG Q
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGPQ  151



>gb|ABX26143.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   261 bits (666),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I D+QIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDRQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>emb|CAC33845.1| putative cytosolic CuZn-superoxide dismutase [Populus tremula 
x Populus tremuloides]
 dbj|BAD51399.1| CuZn-superoxide dismutase [Populus alba x Populus glandulosa]
 dbj|BAD51400.1| CuZn-superoxide dismutase [Populus alba x Populus glandulosa]
Length=152

 Score =   261 bits (666),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI FTQEGDGPTTVTG++ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTAT +I D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATVSIIDNQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>gb|ADZ72850.1| Cu/Zn superoxide dismutase [Vigna radiata]
 gb|ADZ72851.1| Cu/Zn superoxide dismutase [Vigna radiata]
Length=152

 Score =   261 bits (666),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GT++F+Q+G+GPTTVTG ++GLKPGHHGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVTGTVYFSQDGNGPTTVTGTLAGLKPGHHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+ VG+DGT TF+ITD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVTFSITDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_009408238.1| PREDICTED: superoxide dismutase [Cu-Zn] [Musa acuminata subsp. 
malaccensis]
Length=152

 Score =   261 bits (666),  Expect = 8e-86, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL SS+ V GT++F QEGDGPTTVTG +SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKAVAVLGSSDSVKGTVYFAQEGDGPTTVTGTISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D  RHAGDLGN+T GEDGT TF+ITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDDAGRHAGDLGNVTAGEDGTVTFSITDSQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AAP81872.1| cytosolic CuZn-superoxide dismutase [Lotus japonicus]
 gb|AFK38532.1| unknown [Lotus japonicus]
Length=152

 Score =   261 bits (666),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+ V GTI F+QEGDGPT V+G +SGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSDNVKGTITFSQEGDGPTNVSGTISGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED IRHAGDLGN+TVG+DGT +F+ITD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDAIRHAGDLGNVTVGDDGTTSFSITDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ABX54855.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   261 bits (666),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA  +I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAISIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+ GHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRSGHELSKSTGNAGGRVACGIIGLQ  151



>sp|O65174.1|SODC_ZANAE RecName: Full=Superoxide dismutase [Zantedeschia aethiopica]
 gb|AAC08581.1| cytosolic Cu/Zn-superoxide dismutase [Zantedeschia aethiopica]
Length=152

 Score =   261 bits (666),  Expect = 9e-86, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GT+FF QEG+GPTT+TG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTGSEGVQGTVFFAQEGEGPTTITGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+TVGEDGT  FT+TD QIPLTG NS++GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDGNRHAGDLGNVTVGEDGTVNFTVTDSQIPLTGLNSVVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSKTTGNAGGR+ACG+IGLQ
Sbjct  121  DSDDLGKGGHELSKTTGNAGGRLACGVIGLQ  151



>gb|ADN04915.1| csd1 [Pleioblastus fortunei]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFF+QEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTSSEGVKGTIFFSQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T G DG A   + D QIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTAGADGVANVNVVDSQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|NP_172360.1| superoxide dismutase [Cu-Zn] [Arabidopsis thaliana]
 ref|NP_001077494.1| superoxide dismutase [Cu-Zn] [Arabidopsis thaliana]
 sp|P24704.2|SODC1_ARATH RecName: Full=Superoxide dismutase [Cu-Zn] 1; AltName: Full=Copper/zinc 
superoxide dismutase 1 [Arabidopsis thaliana]
 emb|CAA43270.1| superoxide dismutase [Arabidopsis thaliana]
 gb|AAK93609.1| putative superoxidase dismutase [Arabidopsis thaliana]
 gb|AAM14107.1| putative superoxide dismutase [Arabidopsis thaliana]
 gb|AAM64826.1| superoxidase dismutase [Arabidopsis thaliana]
 gb|AEE28354.1| superoxide dismutase [Cu-Zn] [Arabidopsis thaliana]
 gb|AEE28355.1| superoxide dismutase [Cu-Zn] [Arabidopsis thaliana]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV+GTIFFTQEGDG TTV+G VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>ref|XP_008811696.1| PREDICTED: superoxide dismutase [Cu-Zn]-like isoform X2 [Phoenix 
dactylifera]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL  S GV GT++F QEGDGPT VTG++SGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLGGSGGVKGTVYFIQEGDGPTAVTGSLSGLEPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DGT +FTITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDESRHAGDLGNVTVGDDGTVSFTITDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010041954.1| PREDICTED: superoxide dismutase [Cu-Zn] [Eucalyptus grandis]
 gb|KCW84941.1| hypothetical protein EUGRSUZ_B01760 [Eucalyptus grandis]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSEGV GT++FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLKSSEGVCGTVYFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED  RHAGDLGN+ VG+DGT  FTI D QIPL+G +SI+GRAVVVHG
Sbjct  61   PHFNPCGKEHGAPEDQNRHAGDLGNVNVGDDGTVNFTIIDNQIPLSGPSSIVGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>gb|ABX26141.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFH HALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVAGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHAHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54877.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V V +SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVFNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54862.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   260 bits (665),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDD G+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDFGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54844.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   260 bits (664),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGD TNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDATNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX26131.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   260 bits (664),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNI VGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNIAVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_002268436.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X2 [Vitis vinifera]
 ref|XP_010659986.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X2 [Vitis vinifera]
 ref|XP_010659987.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X2 [Vitis vinifera]
 emb|CBI34281.3| unnamed protein product [Vitis vinifera]
Length=152

 Score =   260 bits (664),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S+EG  GTI+F +EGDG TTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+ VGEDGT  F I DKQIPLTG+NSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>gb|ACV04872.1| superoxide dismutase [Morella rubra]
Length=152

 Score =   260 bits (664),  Expect = 1e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SS+ V GTIFF QE DGPTTVTGN++GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSDSVKGTIFFAQETDGPTTVTGNITGLKPGIHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK HGAPED+IRHAGDLGNITVG+DGTA FTI DKQIPL G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKVHGAPEDEIRHAGDLGNITVGDDGTANFTIIDKQIPLCGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLSTGNAGGRVACGIIGLQ  151



>ref|XP_006417640.1| hypothetical protein EUTSA_v10008927mg [Eutrema salsugineum]
 gb|ESQ35993.1| hypothetical protein EUTSA_v10008927mg [Eutrema salsugineum]
Length=170

 Score =   260 bits (665),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 139/156 (89%), Gaps = 1/156 (1%)
 Frame = +3

Query  45   RSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNG  224
            R QT M KGVAVLSSSEGV GTIFFTQEG G TTV+G VSGLKPG HGFHVHALGDTTNG
Sbjct  15   RIQT-MAKGVAVLSSSEGVKGTIFFTQEGQGETTVSGTVSGLKPGLHGFHVHALGDTTNG  73

Query  225  CMSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRA  404
            CMSTGPHFNP GK+HGAPED  RHAGDLGNI VG+DGTATF+ITD QIPLTG NSIIGRA
Sbjct  74   CMSTGPHFNPDGKQHGAPEDANRHAGDLGNIVVGDDGTATFSITDCQIPLTGPNSIIGRA  133

Query  405  VVVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            VVVH DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  134  VVVHADPDDLGKGGHELSLATGNAGGRVACGIIGLQ  169



>gb|ADX36106.1| CuZn-superoxide dismutase 2 [Haberlea rhodopensis]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGV+GT+ F QEGDG T+VTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVNGTVHFVQEGDGHTSVTGHLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D++RHAGDLGN+T GEDGT  FTI DKQIPL+G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPKDEVRHAGDLGNVTAGEDGTVVFTIVDKQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABP58627.1| pollen allergen Ole e 5 [Olea europaea]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHG P D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGTPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ACX94084.1| copper/zinc-superoxide dismutase [Bambusa oldhamii]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI+F QEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLASSEGVKGTIYFVQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T G DG A   + D QIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTAGADGVANVNVVDSQIPLTGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ACV89347.1| Cu/Zn superoxide dismutase [Knorringia sibirica]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SS GVSGT+ F+QEGDGPTTV GN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSSAGVSGTVHFSQEGDGPTTVIGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+TVG+DGTATFTI D QIPL G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDEHRHAGDLGNVTVGDDGTATFTIIDNQIPLDGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIG Q
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGRQ  151



>ref|XP_008660152.1| PREDICTED: superoxide dismutase [Cu-Zn] 4AP isoform X1 [Zea mays]
 ref|XP_008660153.1| PREDICTED: superoxide dismutase [Cu-Zn] 4AP isoform X1 [Zea mays]
 sp|P23346.2|SODC5_MAIZE RecName: Full=Superoxide dismutase [Cu-Zn] 4AP [Zea mays]
 gb|ACG25237.1| superoxide dismutase 2 [Zea mays]
 gb|ACG31930.1| superoxide dismutase 2 [Zea mays]
 gb|ACG32382.1| superoxide dismutase 2 [Zea mays]
 gb|ACG33425.1| superoxide dismutase 2 [Zea mays]
 gb|ACG40356.1| superoxide dismutase 2 [Zea mays]
 gb|ACG49083.1| superoxide dismutase 2 [Zea mays]
 gb|ACN31479.1| unknown [Zea mays]
 gb|AFW88389.1| superoxide dismutase9 isoform 1 [Zea mays]
 gb|AFW88390.1| superoxide dismutase9 isoform 2 [Zea mays]
 gb|AFW88391.1| superoxide dismutase9 isoform 3 [Zea mays]
 gb|AFW88392.1| superoxide dismutase9 isoform 4 [Zea mays]
 gb|AFW88393.1| superoxide dismutase9 isoform 5 [Zea mays]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+GV GTIFFTQEGDGPT VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSDGVKGTIFFTQEGDGPTAVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPA KEHGAPED+ RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54849.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGD TNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDITNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|KCW61706.1| hypothetical protein EUGRSUZ_H04426 [Eucalyptus grandis]
Length=169

 Score =   260 bits (665),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 128/147 (87%), Positives = 138/147 (94%), Gaps = 0/147 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GT+ F QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVTGTVHFVQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG++GTATFTITDKQIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDNGTATFTITDKQIPLTGPNSIVGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGI  500
            DPDDLGKGGHELSKTTGNAGGRVACG+
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGL  147



>emb|CAA10132.1| superoxide dismutase [Cicer arietinum]
 emb|CAA10160.1| superoxide dismutase [Cicer arietinum]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+ VSGTI F+QEGDGPTTVTGN++GLKPG HGFH+HALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSDTVSGTINFSQEGDGPTTVTGNLAGLKPGLHGFHIHALGDTTNGCISTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHG+PED IRHAGDLGNI VG+DGT +F+ITD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPNGKEHGSPEDPIRHAGDLGNINVGDDGTVSFSITDNQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_006305743.1| hypothetical protein CARUB_v10010551mg [Capsella rubella]
 gb|EOA38641.1| hypothetical protein CARUB_v10010551mg [Capsella rubella]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEG G TTVTG +SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGQGVTTVTGTLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDATRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS TTGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLTTGNAGGRIACGIIGLQ  151



>gb|ABF51006.1| Cu-Zn superoxide dismutase [Arachis hypogaea]
Length=152

 Score =   259 bits (663),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 140/151 (93%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTI F+QEG+GPTTVTGN++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLSSSEGVSGTIQFSQEGNGPTTVTGNLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+ VG+DGT +F+I+D QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVSFSISDSQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX26147.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   259 bits (663),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHV+ALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVNALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010489432.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 [Camelina sativa]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEG+G TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGEGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|ABY65355.1| copper/zinc-superoxide dismutase [Litchi chinensis]
 gb|AGB58021.1| copper/zinc-superoxide dismutase 4 [Litchi chinensis]
 gb|AIB06350.1| copper/zinc-superoxide dismutase 4 variant [Litchi chinensis]
 gb|AIB06351.1| copper/zinc-superoxide dismutase 4 variant 1 [Litchi chinensis]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GT+ FTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNGSEGVKGTVNFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPA KEHGAPED+ RHAGDLGN+ VG+DGT +FTI DKQIPLTG NS++GRAVVVH 
Sbjct  61   PHFNPADKEHGAPEDENRHAGDLGNVNVGDDGTVSFTIVDKQIPLTGPNSVVGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRLACGVIGLQ  151



>gb|ABX26140.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTT+TGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTITGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRV CGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVTCGIIGLQ  151



>gb|ABX26134.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHE SK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHEQSKSTGNAGGRVACGIIGLQ  151



>gb|ABX26145.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHV ALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVRALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_006417641.1| hypothetical protein EUTSA_v10008927mg [Eutrema salsugineum]
 gb|ABQ59346.1| Cu-Zn superoxide dismutase [Eutrema halophilum]
 dbj|BAJ34481.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35994.1| hypothetical protein EUTSA_v10008927mg [Eutrema salsugineum]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVLSSSEGV GTIFFTQEG G TTV+G VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLSSSEGVKGTIFFTQEGQGETTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATF+ITD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIVVGDDGTATFSITDCQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>ref|XP_008649061.1| PREDICTED: superoxide dismutase [Cu-Zn] 4AP isoform X1 [Zea mays]
 gb|ACF81870.1| unknown [Zea mays]
 tpg|DAA45383.1| TPA: superoxide dismutase4 isoform 1 [Zea mays]
 tpg|DAA45384.1| TPA: superoxide dismutase4 isoform 2 [Zea mays]
Length=152

 Score =   259 bits (662),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+GV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSDGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPA KEHGAPED+ RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHEL K+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELRKSTGNAGGRVACGIIGLQ  151



>gb|AGD80596.1| chloroplast copper/zinc-superoxide dismutase [Saccharum hybrid 
cultivar GT28]
Length=152

 Score =   259 bits (662),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCISTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPA KEHGAPED+ R AGDLGN+T G DG A  ++TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPASKEHGAPEDENRRAGDLGNVTAGADGVANISVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AGC13158.1| copper/zinc superoxide dismutase [Musa acuminata AAA Group]
 gb|AIT56206.1| copper/zinc superoxide dismutase protein 1C [Musa acuminata AAA 
Group]
Length=152

 Score =   259 bits (662),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL SS+ V GT++F QEGDGPTTVTG +SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKAVAVLGSSDSVKGTVYFAQEGDGPTTVTGTISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+D  RHAGDLGN+T GEDGT TF+ITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDDAGRHAGDLGNVTAGEDGTVTFSITDSQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGL+
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLK  151



>ref|XP_008218142.1| PREDICTED: superoxide dismutase [Cu-Zn] [Prunus mume]
Length=152

 Score =   259 bits (661),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI FTQEGDGPTTVTG++SGLKPG HGFHVH  GDTTNGC+STG
Sbjct  1    MVKGVAVLGSSEGVKGTINFTQEGDGPTTVTGSISGLKPGLHGFHVHEFGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  K HG+PED+IRHAGDLGNITVG+DGTA FTI DKQIPLTG  SIIGRA+VVH 
Sbjct  61   PHFNPDAKHHGSPEDEIRHAGDLGNITVGDDGTANFTIIDKQIPLTGPQSIIGRAIVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABP65325.1| Cu-Zn superoxide dismutase [Cenchrus americanus]
Length=152

 Score =   259 bits (661),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV GTI FTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLASSEGVKGTIHFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRIACGIIGLQ  151



>gb|ABN50366.1| copper zinc superoxide dismutase [Arabidopsis thaliana]
Length=152

 Score =   259 bits (661),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV+GTIFFTQEGDG TTV+G VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGI GLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIFGLQ  151



>ref|XP_007206078.1| hypothetical protein PRUPE_ppa012845mg [Prunus persica]
 gb|AFP87312.1| CuZnSOD [Prunus persica]
 gb|EMJ07277.1| hypothetical protein PRUPE_ppa012845mg [Prunus persica]
Length=152

 Score =   259 bits (661),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 130/151 (86%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL SSEGV GTI FTQEGDGPTTVTG++SGLKPG HGFHVH  GDTTNGC+STG
Sbjct  1    MVKGVAVLGSSEGVKGTINFTQEGDGPTTVTGSISGLKPGLHGFHVHEFGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED+IRHAGDLGNITVG+DGTA FTI DKQIPL G  SIIGRAVVVH 
Sbjct  61   PHFNPDGKHHGAPEDEIRHAGDLGNITVGDDGTANFTIIDKQIPLAGPQSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRTACGIIGLQ  151



>gb|AAL85888.1|AF479059_1 copper/zinc superoxide dismutase [Sandersonia aurantiaca]
Length=152

 Score =   259 bits (661),  Expect = 4e-85, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GT+FFTQEGDGPTTVT ++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNGSEGVKGTVFFTQEGDGPTTVTASLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T GEDG   FT +D QIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTAGEDGNVNFTTSDCQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX54869.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   259 bits (661),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGH LSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHVLSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010475701.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Camelina sativa]
 ref|XP_010475702.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Camelina sativa]
Length=152

 Score =   259 bits (661),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 133/151 (88%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEG G TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGQGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|AHF27437.1| superoxide dismutase [Cucurbita maxima]
Length=152

 Score =   259 bits (661),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL +SE V GTIFF+QEGDGPTTVTG+VSGLK G HGFHVHA+GDTTNGCMSTG
Sbjct  1    MVKAVAVLGNSECVVGTIFFSQEGDGPTTVTGDVSGLKAGLHGFHVHAMGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED+ RHAGDLGNITVGEDG A+FTITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKQHGAPEDENRHAGDLGNITVGEDGKASFTITDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAG RVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLSTGNAGARVACGIIGLQ  151



>dbj|BAB78597.1| copper/zinc superoxide dismutase [Bruguiera gymnorhiza]
Length=153

 Score =   259 bits (661),  Expect = 5e-85, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 135/150 (90%), Gaps = 0/150 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SS GV+GT+FF QEGDGPTTVTGNVSGLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSAGVTGTVFFNQEGDGPTTVTGNVSGLKSGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+ V +DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPGSKEHGAPEDENRHAGDLGNVNVADDGTATFTITDNQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGL  509
            DPDDLGKGGHELSK+TGNAGGRVACGIIGL
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGL  150



>emb|CAH06454.1| Cu/Zn superoxide dismutase [Helianthus annuus]
Length=153

 Score =   258 bits (660),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 131/152 (86%), Positives = 139/152 (91%), Gaps = 1/152 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDG-PTTVTGNVSGLKPGHHGFHVHALGDTTNGCMST  236
            MVK V VL+SSEGVSGTIFFTQE +G PTTVTG++SGLKPG HGFHVHALGDTTNGCMST
Sbjct  1    MVKAVTVLNSSEGVSGTIFFTQEAEGAPTTVTGDISGLKPGPHGFHVHALGDTTNGCMST  60

Query  237  GPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVH  416
            GPH NP GKEHGAP+D+IRHAGDLGN+TVGEDGTA FTI DKQIPL G  SIIGRAVVVH
Sbjct  61   GPHXNPHGKEHGAPDDEIRHAGDLGNVTVGEDGTAKFTIVDKQIPLIGGQSIIGRAVVVH  120

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  ADPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  152



>ref|XP_006433125.1| hypothetical protein CICLE_v10002756mg [Citrus clementina]
 ref|XP_006471806.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Citrus sinensis]
 gb|ESR46365.1| hypothetical protein CICLE_v10002756mg [Citrus clementina]
Length=152

 Score =   258 bits (660),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  +EGV GT+ F+QEGDGPTTV+G++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGTEGVKGTVSFSQEGDGPTTVSGSLSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG PED+ RHAGDLGN+ VG+DGTATFT+ D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGPPEDENRHAGDLGNVNVGDDGTATFTVVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|KCW61709.1| hypothetical protein EUGRSUZ_H04426 [Eucalyptus grandis]
Length=147

 Score =   258 bits (658),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 137/146 (94%), Gaps = 0/146 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GT+ F QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVTGTVHFVQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG++GTATFTITDKQIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDNGTATFTITDKQIPLTGPNSIVGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACG  497
            DPDDLGKGGHELSKTTGNAGGRVACG
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACG  146



>gb|AAC25568.1| cytosolic Cu/Zn superoxide dismutase [Brassica rapa subsp. pekinensis]
Length=152

 Score =   258 bits (659),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGDGATTVTGTVSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNI VG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNIIVGDDGTATFTITDSQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELS +TGNAGGRVACGIIGLQ
Sbjct  121  DRDDLGKGGHELSLSTGNAGGRVACGIIGLQ  151



>ref|XP_010458148.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Camelina sativa]
Length=152

 Score =   258 bits (658),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFF+QEG G TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFSQEGQGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|AFC35179.1| copper/zinc-superoxide dismutase [Bambusa emeiensis]
Length=152

 Score =   258 bits (658),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFFTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTSSEGVKGTIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+T G DG A   + D QIPLTG  SII RAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDVNRHAGDLGNVTAGADGVANVNVVDSQIPLTGPQSIIDRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>emb|CDX93533.1| BnaA06g05150D [Brassica napus]
Length=152

 Score =   257 bits (657),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 132/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVAVLNSSEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>ref|XP_003562484.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A [Brachypodium distachyon]
 ref|XP_010234212.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A [Brachypodium distachyon]
Length=152

 Score =   257 bits (657),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLS SEGV GTIFFTQEGDGPTTVTG+VSGLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSGSEGVKGTIFFTQEGDGPTTVTGSVSGLKEGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T G DG A   + D QIPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPAGKEHGAPEDETRHAGDLGNVTAGVDGVANINVVDTQIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAG RVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGARVACGIIGLQ  151



>gb|AFU52879.1| Cu/Zn-superoxide dismutase [Vitis vinifera]
Length=152

 Score =   257 bits (657),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S+EG  GTI+F +EGDG TTVTG++SGLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSNEGACGTIYFAEEGDGSTTVTGSLSGLKSGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+ VGEDGT  F I DKQIPLTG+NSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVIVGEDGTVNFKIVDKQIPLTGSNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>gb|ABV79894.2| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|ACJ07158.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|ACT54525.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|ACV42800.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|ADK70175.2| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|ADK70176.2| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
 gb|AEN71837.1| cytosolic copper/zinc-superoxide dismutase [Dimocarpus longan]
Length=152

 Score =   257 bits (656),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GT+ FTQEGDGPTTVTG++ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNGSEGVKGTVNFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPA KEHG+PED+ RHAGDLGN+ VG+DGT +FTI DKQIPLTG NS++GRAVVVH 
Sbjct  61   PHFNPAAKEHGSPEDENRHAGDLGNVNVGDDGTVSFTIVDKQIPLTGPNSVVGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRLACGVIGLQ  151



>ref|XP_010247119.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 [Nelumbo nucifera]
 ref|XP_010247120.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 [Nelumbo nucifera]
Length=152

 Score =   256 bits (655),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S EGVSGTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSREGVSGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+TVGEDGT   TI DKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPQSKEHGAPEDENRHAGDLGNVTVGEDGTVNITIVDKQIPLTGPYSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AGC13160.1| copper/zinc superoxide dismutase [Musa acuminata]
Length=152

 Score =   256 bits (655),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL SS+ V GT++F QEGDGPTTVTG +SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKAVAVLGSSDSVKGTVYFAQEGDGPTTVTGTISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAP+   RHAGDLGN+T GEDGT TF+ITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPDGADRHAGDLGNVTAGEDGTVTFSITDCQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_009118346.1| PREDICTED: superoxide dismutase [Cu-Zn] [Brassica rapa]
 gb|AAY40317.1| Cu/Zn superoxide dismutase [Brassica napus]
 gb|ABE28385.1| Cu/Zn superoxide dismutase protein [Brassica napus]
 gb|AGX01606.1| copper and zinc superoxide dismutase [Brassica rapa subsp. oleifera]
 emb|CDY06331.1| BnaA09g48720D [Brassica napus]
Length=152

 Score =   256 bits (655),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTQEGDGATTVTGTVSGLKPGPHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNI VG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNIIVGDDGTATFTITDSQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            + DDLGKGGHELS +TGNAGGRVACGIIGLQ
Sbjct  121  ERDDLGKGGHELSLSTGNAGGRVACGIIGLQ  151



>ref|XP_010241018.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nelumbo nucifera]
 ref|XP_010241024.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nelumbo nucifera]
 ref|XP_010241032.1| PREDICTED: superoxide dismutase [Cu-Zn] [Nelumbo nucifera]
Length=152

 Score =   256 bits (655),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S+ GV+GTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSNAGVNGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVGEDGT  FTI DKQIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPHGKEHGAPEDENRHAGDLGNVTVGEDGTVNFTIVDKQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>emb|CDX95028.1| BnaC05g06430D [Brassica napus]
Length=152

 Score =   256 bits (655),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEGDG T+VTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVAVLNSSEGVKGTIFFTQEGDGVTSVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|ABX54866.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   256 bits (654),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKE GAP D+ RHAG LGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEQGAPGDENRHAGVLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AGN72377.1| cytosolic copper-zinc superoxide dismutase [Plantago ovata]
Length=152

 Score =   256 bits (654),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVKGVAVL+SSEGVSGT+ F+QEGD PTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKGVAVLNSSEGVSGTVLFSQEGDAPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHG+P+D++ HAGDLGN+TVG+DG A FTI DK IPL G +SI GRAVVVH 
Sbjct  61   PHFNPAGKEHGSPDDEVHHAGDLGNVTVGDDGKANFTIVDKMIPLCGPHSINGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDD+G+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDVGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AAD05576.1| Cu/Zn superoxide dismutase [Raphanus sativus]
Length=152

 Score =   256 bits (654),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFTQEG+G TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVAVLNSSEGVKGTIFFTQEGNGSTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTA+FTITD QIPL G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTASFTITDSQIPLDGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>gb|ABF95937.1| Superoxide dismutase 1, putative, expressed [Oryza sativa Japonica 
Group]
 gb|EAZ26916.1| hypothetical protein OsJ_10843 [Oryza sativa Japonica Group]
Length=270

 Score =   260 bits (665),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSE V GTI F QEGDGPTTVTG+VSGLKPG HGFH+HALGDTTNGCMSTG
Sbjct  119  MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTG  178

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T GEDG A   + D QIPLTG NSIIGRAVVVH 
Sbjct  179  PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA  238

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  239  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  269



>gb|ABX54876.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=152

 Score =   256 bits (654),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQ+GDGPTT+TGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQKGDGPTTITGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHF P GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFLPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AGC13157.1| copper/zinc superoxide dismutase [Musa acuminata AAA Group]
 gb|AIT56199.1| copper/zinc superoxide dismutase 1B [Musa acuminata AAA Group]
 gb|AIT56212.1| copper/zinc superoxide dismutase protein 1B [Musa acuminata AAA 
Group]
 gb|AIT56213.1| copper/zinc superoxide dismutase 1B [Musa acuminata AAA Group]
Length=152

 Score =   256 bits (654),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL  SE V GTI+F+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGGSEDVKGTIYFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPEDD RHAGDLGN+T GEDGT T +  D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDDNRHAGDLGNVTAGEDGTVTISKVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_010911239.1| PREDICTED: superoxide dismutase [Cu-Zn]-like [Elaeis guineensis]
Length=152

 Score =   256 bits (653),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL  +EGV+GT++FTQEGDGPTTVT N+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKAVAVLGGTEGVTGTVYFTQEGDGPTTVTANISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN T GEDGT TF+I D QIPL+G  SI+GRAVVVH 
Sbjct  61   PHFNPHGKEHGAPEDENRHAGDLGNATAGEDGTVTFSIVDNQIPLSGPKSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>gb|AAZ20281.1| Cu-Zn superoxide dismutase [Arachis hypogaea]
Length=152

 Score =   256 bits (653),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 139/151 (92%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTI F+QEG+GPTTVTGN++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLSSSEGVSGTIQFSQEGNGPTTVTGNLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+ VG+DGT +F+I+D QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVSFSISDSQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGG VACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGGVACGIIGLQ  151



>gb|AHF27434.1| superoxide dismutase [Cucurbita moschata]
Length=152

 Score =   256 bits (653),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL +S  V GTIFF+QEGDGPTTVTG+VSGLK G HGFHVHA+GDTTNGCMSTG
Sbjct  1    MVKAVAVLGNSVCVVGTIFFSQEGDGPTTVTGDVSGLKAGLHGFHVHAMGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK+HGAPED+ RHAGDLGNITVGEDG A+FTITD QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKQHGAPEDENRHAGDLGNITVGEDGKASFTITDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAG RVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLSTGNAGARVACGIIGLQ  151



>gb|ADB28989.2| copper/zinc superoxide dismutase, partial [Allium sativum]
Length=152

 Score =   256 bits (653),  Expect = 8e-84, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S+EGV G +FF +EGDGPT VTG +SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSAEGVKGHVFFKKEGDGPTAVTGTISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+T  EDGT T +++D QIPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPLGKEHGAPEDENRHAGDLGNVTAAEDGTVTLSLSDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRIACGIIGLQ  151



>ref|XP_009382001.1| PREDICTED: superoxide dismutase [Cu-Zn] [Musa acuminata subsp. 
malaccensis]
 ref|XP_009382009.1| PREDICTED: superoxide dismutase [Cu-Zn] [Musa acuminata subsp. 
malaccensis]
Length=152

 Score =   255 bits (652),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL  SE V GT++F+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGGSEDVKGTVYFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPEDD RHAGDLGN+T GEDGT T +  D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDDNRHAGDLGNVTAGEDGTVTISKVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_009148138.1| PREDICTED: superoxide dismutase [Cu-Zn] 1 [Brassica rapa]
Length=152

 Score =   255 bits (652),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+S EGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVAVLNSGEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS  TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACGIIGLQ  151



>sp|Q02610.2|SODC_PEA RecName: Full=Superoxide dismutase [Pisum sativum]
 gb|AAA33659.1| Cu/Zn-superoxide dismutase [Pisum sativum]
 dbj|BAC81657.1| superoxide dismutase [Pisum sativum]
 dbj|BAD90559.1| copper zinc superoxide dismutase [Pisum sativum]
 prf||1803526A Cu/Zn superoxide dismutase
Length=152

 Score =   255 bits (652),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLS+S  VSGTI F+QEG+GPTTVTG ++GLKPG HGFH+HALGDTTNGC+STG
Sbjct  1    MVKAVAVLSNSNEVSGTINFSQEGNGPTTVTGTLAGLKPGLHGFHIHALGDTTNGCISTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGNI VG+DGT +FTITD  IPLTG NSIIGRAVVVH 
Sbjct  61   PHFNPNGKEHGAPEDETRHAGDLGNINVGDDGTVSFTITDNHIPLTGTNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>ref|XP_008813737.1| PREDICTED: superoxide dismutase [Cu-Zn] [Phoenix dactylifera]
 ref|XP_008813738.1| PREDICTED: superoxide dismutase [Cu-Zn] [Phoenix dactylifera]
Length=152

 Score =   255 bits (651),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL  +EGV+GT++FTQEGDGPTTVT N+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKAVAVLGGTEGVTGTVYFTQEGDGPTTVTANISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED  RHAGDLGN+T GEDGT TF+I D QIPL+G NSI+GRA+VVH 
Sbjct  61   PHFNPDAKEHGAPEDKNRHAGDLGNVTAGEDGTVTFSIVDNQIPLSGPNSIVGRAIVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  151



>ref|NP_001050118.1| Os03g0351500 [Oryza sativa Japonica Group]
 sp|Q0DRV6.1|SODC1_ORYSJ RecName: Full=Superoxide dismutase [Cu-Zn] 1 [Oryza sativa Japonica 
Group]
 sp|A2XGP6.2|SODC1_ORYSI RecName: Full=Superoxide dismutase [Cu-Zn] 1 [Oryza sativa Indica 
Group]
 dbj|BAA00799.1| copper/zinc-superoxide dismutase [Oryza sativa Japonica Group]
 gb|AAC14464.1| cytosolic copper/zinc-superoxide dismutase [Oryza sativa Japonica 
Group]
 gb|AAY56345.1| cytoplasmic copper/zinc-superoxide dismutase [Oryza sativa Indica 
Group]
 dbj|BAF12032.1| Os03g0351500 [Oryza sativa Japonica Group]
 prf||2111424A Cu/Zn superoxide dismutase
Length=152

 Score =   255 bits (651),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSE V GTI F QEGDGPTTVTG+VSGLKPG HGFH+HALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T GEDG A   + D QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ABX26138.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   255 bits (651),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 138/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHV+ALG TTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVNALGATTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHF+P GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFDPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AAW80441.1| copper-zinc superoxide dismutase, partial [Nelumbo nucifera]
Length=152

 Score =   254 bits (650),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+S EGVSGTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSKEGVSGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+TVGEDGT   TI DKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPQSKEHGAPEDENRHAGDLGNVTVGEDGTVNITIVDKQIPLTGPYSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGI+GLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIVGLQ  151



>gb|AAW80431.1| copper-zinc superoxide dismutase, partial [Nelumbo nucifera]
 gb|AAW80439.1| copper-zinc superoxide dismutase, partial [Nelumbo nucifera]
 gb|ABB04108.1| copper-zinc superoxide dismutase [Nelumbo nucifera]
Length=152

 Score =   254 bits (650),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL S+ GV+GTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSNAGVNGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVGEDGT  FTI DKQIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPHGKEHGAPEDENRHAGDLGNVTVGEDGTVNFTIVDKQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|ABX26139.1| allergen Ole e 5 [Olea europaea]
Length=152

 Score =   254 bits (650),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V V +SSEGV+GT++FTQEGDG TTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVFNSSEGVTGTVYFTQEGDGLTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGNITVGEDGTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDLGNITVGEDGTAAINIVDKQIPLTGPHSIIGRAVVVHS  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TG+AGGRVACGIIGLQ
Sbjct  121  DPDDLGRGGHELSKSTGDAGGRVACGIIGLQ  151



>ref|XP_006650081.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Oryza brachyantha]
Length=152

 Score =   254 bits (649),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SS+ V GTI F QEGDGPTTV+G+VSGLKPG HGFH+HALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSDTVKGTISFVQEGDGPTTVSGSVSGLKPGLHGFHIHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T GEDG A   + D QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANINVVDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGVIGLQ  151



>ref|XP_010097352.1| sodC protein [Morus notabilis]
 gb|EXB67662.1| sodC protein [Morus notabilis]
Length=193

 Score =   256 bits (653),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/146 (86%), Positives = 136/146 (93%), Gaps = 0/146 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL+SSEGV+GTI+FTQEGDGPTTVTGNV GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MGKAVAVLASSEGVTGTIYFTQEGDGPTTVTGNVCGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPA K+HGAPED+ RHAGDLGNIT G+DGTAT TI DKQIPL+G +SIIGRAVVVHG
Sbjct  61   PHFNPASKDHGAPEDEHRHAGDLGNITAGDDGTATVTIVDKQIPLSGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACG  497
            DPDDLG+GGHELSKTTGNAGGRVACG
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACG  146



>gb|EEE67768.1| hypothetical protein OsJ_25485 [Oryza sativa Japonica Group]
Length=426

 Score =   264 bits (674),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   SQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGC  227
            S   MVK VAVL+SSEGV GTIFF+QEGDGPT+VTG+VSGLKPG HGFHVHALGDTTNGC
Sbjct  271  SPETMVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGC  330

Query  228  MSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAV  407
            MSTGPHFNP GKEHGAP+D+ RHAGDLGNIT G DG A   ++D QIPLTGA+SIIGRAV
Sbjct  331  MSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAV  390

Query  408  VVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            VVH DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  391  VVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  425



>ref|NP_001235298.1| superoxide dismutase [Cu-Zn] [Glycine max]
 sp|Q7M1R5.1|SODC_SOYBN RecName: Full=Superoxide dismutase [Glycine max]
 gb|ACU14529.1| unknown [Glycine max]
 gb|KHN43238.1| Superoxide dismutase [Cu-Zn] [Glycine soja]
Length=152

 Score =   254 bits (649),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 137/151 (91%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GTIFFTQEG+GPTTVTG+++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVTGTIFFTQEGNGPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
             HFNP   EHGAPED+ RHAGDLGN+ VG+DGT +F+ITD QIPLTG NSIIGRAVVVH 
Sbjct  61   AHFNPNNNEHGAPEDENRHAGDLGNVNVGDDGTVSFSITDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DSDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AAW80438.1| copper-zinc superoxide dismutase, partial [Nelumbo nucifera]
Length=152

 Score =   254 bits (649),  Expect = 3e-83, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL S+ GV+GTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSNAGVNGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVGEDGT  FTI DKQIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPHGKEHGAPEDENRHAGDLGNVTVGEDGTVNFTIVDKQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGI+GLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIVGLQ  151



>gb|EEC82641.1| hypothetical protein OsI_27243 [Oryza sativa Indica Group]
Length=456

 Score =   264 bits (675),  Expect = 4e-83, Method: Compositional matrix adjust.
 Identities = 130/155 (84%), Positives = 139/155 (90%), Gaps = 0/155 (0%)
 Frame = +3

Query  48   SQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGC  227
            S   MVK VAVL+SSEGV GTIFF+QEGDGPT+VTG+VSGLKPG HGFHVHALGDTTNGC
Sbjct  301  SPETMVKAVAVLASSEGVKGTIFFSQEGDGPTSVTGSVSGLKPGLHGFHVHALGDTTNGC  360

Query  228  MSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAV  407
            MSTGPHFNP GKEHGAP+D+ RHAGDLGNIT G DG A   ++D QIPLTGA+SIIGRAV
Sbjct  361  MSTGPHFNPTGKEHGAPQDENRHAGDLGNITAGADGVANVNVSDSQIPLTGAHSIIGRAV  420

Query  408  VVHGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            VVH DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  421  VVHADPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  455



>gb|AGC13159.1| copper/zinc superoxide dismutase [Musa acuminata]
Length=152

 Score =   253 bits (647),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  SE V GT++F+QEGDGPTTVTG+++GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGSENVKGTVYFSQEGDGPTTVTGSITGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED  RHAGDLGN+T GEDGT T +  D QIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDANRHAGDLGNVTAGEDGTVTISKVDNQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_004958608.1| PREDICTED: superoxide dismutase [Cu-Zn] 2-like [Setaria italica]
Length=151

 Score =   253 bits (647),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 137/151 (91%), Gaps = 1/151 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ S+ V GTIFF+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLAGSD-VKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  59

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T GEDG A   ITD QIPLTG +SIIGRAVVVH 
Sbjct  60   PHFNPAGKEHGAPEDENRHAGDLGNVTAGEDGVANVNITDCQIPLTGPHSIIGRAVVVHA  119

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  120  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  150



>gb|ADK66275.1| Cu/Zn superoxide dismutase [Aeluropus lagopoides]
Length=152

 Score =   253 bits (647),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VA L SSEGV GTIFFTQEGDGPTTVTG+VSGL PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVASLGSSEGVKGTIFFTQEGDGPTTVTGSVSGLNPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NP GKEHGAPED+IRHAGDLGN+T G+DG A   +TD QIPLTG +SIIGRAVVVH 
Sbjct  61   PHYNPEGKEHGAPEDEIRHAGDLGNVTAGQDGVANVNVTDSQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGR AC II LQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRFACEIIELQ  151



>gb|AAA33917.1| superoxide dismutase [Oryza sativa Japonica Group]
Length=152

 Score =   253 bits (646),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSE V GTI F QEGDGPTTVTG+VSGLKPG HGFH+HALGDTTNGC+STG
Sbjct  1    MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCISTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T GEDG A   + D QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>sp|P09678.2|SODC_BRAOC RecName: Full=Superoxide dismutase [Brassica oleracea var. capitata]
Length=152

 Score =   253 bits (646),  Expect = 7e-83, Method: Compositional matrix adjust.
 Identities = 127/151 (84%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFFT EG+G TTVTG VSGL+PG HGFHVHALGD TNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVKGTIFFTHEGNGATTVTGTVSGLRPGLHGFHVHALGDNTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRA+VVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNIIVGDDGTATFTITDSQIPLSGPNSIVGRAIVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS +TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSLSTGNAGGRVACGIIGLQ  151



>gb|KHN04039.1| Superoxide dismutase [Cu-Zn] [Glycine soja]
Length=152

 Score =   253 bits (645),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GTI F QEG GPTTVTG+++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVTGTIHFVQEGSGPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
             HFNP  KEHGAPED+ RHAGDLGN+ VG+DGT +FTITD QIPLTG N+IIGRAVVVH 
Sbjct  61   SHFNPNNKEHGAPEDENRHAGDLGNVNVGDDGTVSFTITDSQIPLTGPNNIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ACU52586.1| copper/zinc superoxide dismutase [Curcuma aromatica]
Length=152

 Score =   252 bits (644),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV GTI+F QEGDGPTTVTG+++GLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSEGVKGTIYFVQEGDGPTTVTGSITGLKAGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED  RHAGDLGN+T  EDG    ++ DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDVNRHAGDLGNVTASEDGIVAVSVVDKQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGIIGLQ  151



>ref|NP_001105423.1| superoxide dismutase [Cu-Zn] 4A [Zea mays]
 gb|AAB49913.1| superoxide dismutase 4A [Zea mays]
 emb|CAB57993.1| superoxide dismutase-4A [Zea mays]
Length=152

 Score =   252 bits (644),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+GV GTIFFTQEGDGPT VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSDGVKGTIFFTQEGDGPTAVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
              +NPA KEHGAPED+ RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   HDYNPASKEHGAPEDENRHAGDLGNVTAGADGVANINVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AGX27516.1| CUZN-SOD [Populus tomentosa]
Length=154

 Score =   252 bits (644),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/146 (86%), Positives = 134/146 (92%), Gaps = 0/146 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTI FTQEGDGPTTVTG++ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEGVKGTINFTQEGDGPTTVTGSLCGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTAT +I D QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATVSIIDNQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACG  497
            DPDDLGKGGHELSK+TGNAGGRVACG
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACG  146



>gb|AGI65618.1| Cu/Zn-superoxide dismutase, partial [Fragaria x ananassa]
Length=143

 Score =   251 bits (642),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 125/143 (87%), Positives = 133/143 (93%), Gaps = 0/143 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL SSEGV+GTI FTQEGDGPTTVTGN++GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLCSSEGVAGTILFTQEGDGPTTVTGNITGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGNITVG+DG A FTI DKQIPLTG +SIIGRA VVHG
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNITVGDDGKACFTIVDKQIPLTGPHSIIGRAAVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRV  488
            DPDDLGKGGHELSK+TGNAGGR+
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRI  143



>ref|XP_004984365.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A-like isoform X1 [Setaria 
italica]
 ref|XP_004984366.1| PREDICTED: superoxide dismutase [Cu-Zn] 4A-like isoform X2 [Setaria 
italica]
Length=208

 Score =   254 bits (648),  Expect = 3e-82, Method: Compositional matrix adjust.
 Identities = 124/148 (84%), Positives = 132/148 (89%), Gaps = 0/148 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSEGV GTI+FTQEGDGPTTVTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLGSSEGVKGTIYFTQEGDGPTTVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPEDD RHAGDLGN+T G DG A   +TD QIPLTG NSIIGRAVVVH 
Sbjct  61   PHYNPAGKEHGAPEDDNRHAGDLGNVTAGADGVANIHVTDSQIPLTGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGII  503
            DPDDLGKGGHELSK+TGNAGGR+ACG+ 
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRIACGMF  148



>gb|ACS45202.1| copper-zinc superoxide dismutase CuZn-SOD1 [Nelumbo nucifera]
Length=152

 Score =   251 bits (641),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S EGVSGTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSKEGVSGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+TVGE GT   TI DKQIPLTG   IIGRAVVVH 
Sbjct  61   PHFNPQSKEHGAPEDENRHAGDLGNVTVGEGGTVNITIVDKQIPLTGPYLIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>gb|AAF99769.1|AC003981_19 F22O13.32 [Arabidopsis thaliana]
Length=147

 Score =   251 bits (640),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 128/146 (88%), Positives = 133/146 (91%), Gaps = 0/146 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV+GTIFFTQEGDG TTV+G VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MAKGVAVLNSSEGVTGTIFFTQEGDGVTTVSGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPLTG NSI+GRAVVVH 
Sbjct  61   PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDCQIPLTGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACG  497
            DPDDLGKGGHELS  TGNAGGRVACG
Sbjct  121  DPDDLGKGGHELSLATGNAGGRVACG  146



>ref|NP_001235936.1| uncharacterized protein LOC100305732 [Glycine max]
 gb|ACU13571.1| unknown [Glycine max]
Length=152

 Score =   251 bits (641),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SSEGV+GTI F QEG GPTTVTG+++GLKPG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLGSSEGVTGTIHFVQEGSGPTTVTGSLAGLKPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
             HFNP  KEHGAPED  RHAGDLGN+ VG+DGT +FTITD QIPLTG N+IIGRAVVVH 
Sbjct  61   SHFNPNNKEHGAPEDVNRHAGDLGNVNVGDDGTVSFTITDSQIPLTGPNNIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|ACV65038.1| Cu/Zn superoxide dismutase [Deschampsia antarctica]
Length=152

 Score =   251 bits (640),  Expect = 7e-82, Method: Compositional matrix adjust.
 Identities = 128/151 (85%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLS SEGV GTIFFTQEGDGPTTVTG+V+GLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSGSEGVKGTIFFTQEGDGPTTVTGSVTGLKQGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG  HGAPED+IRHAGDLGN+T G DG AT    DK IPLTG +SIIGRAVVVHG
Sbjct  61   PHFNPAGHVHGAPEDEIRHAGDLGNVTAGADGVATIHAVDKHIPLTGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSKTTGNAG RVACGIIGLQ
Sbjct  121  DADDLGKGGHELSKTTGNAGARVACGIIGLQ  151



>sp|O22668.1|SODC_PANGI RecName: Full=Superoxide dismutase [Panax ginseng]
 gb|AAB87572.1| Cu/Zn superoxide dismutase [Panax ginseng]
Length=152

 Score =   250 bits (639),  Expect = 8e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VLS S GVSG I FTQE DGPTTVTG +SGL PG HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVTVLSGSGGVSGVIHFTQEEDGPTTVTGKLSGLAPGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPA KEHGAPED+ RHAGDLGN+TVGEDGTA FTI DKQIPL G+ SIIGRAVVVH 
Sbjct  61   PHYNPANKEHGAPEDETRHAGDLGNVTVGEDGTAEFTIVDKQIPLIGSGSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACG IGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRLACGFIGLQ  151



>gb|ACS45203.1| copper-zinc superoxide dismutase CuZn-SOD2 [Nelumbo nucifera]
Length=152

 Score =   250 bits (639),  Expect = 9e-82, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+S EGVSGTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSKEGVSGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+TVGE GT   TI DKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPQSKEHGAPEDENRHAGDLGNVTVGEGGTVNITIVDKQIPLTGPYSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIG Q
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGWQ  151



>ref|XP_010941777.1| PREDICTED: superoxide dismutase [Cu-Zn]-like isoform X1 [Elaeis 
guineensis]
Length=154

 Score =   250 bits (638),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VAVL  +E ++GT++F QEG GPT V  N+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKAVAVLGGTEDITGTVYFIQEGHGPTKVIANISGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T GEDGT  F+I DKQIPL+G NSIIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTAGEDGTVNFSIIDKQIPLSGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_011071493.1| PREDICTED: LOW QUALITY PROTEIN: superoxide dismutase [Cu-Zn]-like 
[Sesamum indicum]
Length=154

 Score =   250 bits (638),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 126/153 (82%), Positives = 136/153 (89%), Gaps = 2/153 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLSSSEGVSGTI+FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSSSEGVSGTIYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSI--IGRAVVV  413
            PHFNPAGKEHGAP+D++RHAGDLGN+TVGEDGTA+FTI D  IPL+G NSI         
Sbjct  61   PHFNPAGKEHGAPDDEVRHAGDLGNVTVGEDGTASFTIVDNLIPLSGPNSIXXXXXXXXX  120

Query  414  HGDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
              DPDDLG+GGHELSKTTGNAGGR+ACGIIGLQ
Sbjct  121  XXDPDDLGRGGHELSKTTGNAGGRIACGIIGLQ  153



>sp|Q42612.3|SODC2_BRAJU RecName: Full=Superoxide dismutase [Cu-Zn] 2 [Brassica juncea]
 emb|CAA65041.1| cytosolic Cu/Zn-superoxide dismutase [Brassica juncea]
Length=152

 Score =   249 bits (637),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 129/151 (85%), Positives = 135/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+SSEGV GTIFF QEG+G TTVTG VSGLKPG HGFHVHALGDTTNG MSTG
Sbjct  1    MGKGVAVLNSSEGVKGTIFFAQEGEGKTTVTGTVSGLKPGLHGFHVHALGDTTNGSMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPD LGKGGHELS TTGNAGGRVACGIIGLQ
Sbjct  121  DPDVLGKGGHELSLTTGNAGGRVACGIIGLQ  151



>ref|XP_006658075.1| PREDICTED: superoxide dismutase [Cu-Zn] 2-like [Oryza brachyantha]
Length=152

 Score =   249 bits (637),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV G IFF+QEGDG TTVTG+VSGL+PG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLASSEGVKGIIFFSQEGDGVTTVTGSVSGLRPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED+ RH GDLGN+T G DG A   I+D QIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPTGKVHGAPEDENRHGGDLGNVTAGADGVANVNISDSQIPLTGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  151



>gb|AFF27607.1| cytosolic Cu/Zn superoxide dismutase [Triticum aestivum]
 gb|AFF27608.1| cytosolic Cu/Zn superoxide dismutase [Triticum aestivum]
 gb|AFF27609.1| cytosolic Cu/Zn superoxide dismutase [Triticum aestivum]
 gb|AFF27610.1| cytosolic Cu/Zn superoxide dismutase [Triticum aestivum]
Length=152

 Score =   249 bits (637),  Expect = 2e-81, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GTIFFTQEGDGPTTVTG+V+GLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTGSEGVKGTIFFTQEGDGPTTVTGSVTGLKEGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG  HGAPED+IRHAGDLGN+T G DG A   +TD  IPLTG NSI+GRAVVVHG
Sbjct  61   PHFNPAGHVHGAPEDEIRHAGDLGNVTAGADGVANINVTDCHIPLTGPNSIVGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSK+TGNAG RVACGIIGLQ
Sbjct  121  DADDLGKGGHELSKSTGNAGARVACGIIGLQ  151



>gb|AAW80440.1| copper-zinc superoxide dismutase, partial [Nelumbo nucifera]
Length=152

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 123/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+S EG SGTI+FT+E DG T VTG+VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSKEGASGTIYFTEEEDGSTKVTGSVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGN+TVGE GT   TI DKQIPLTG  SIIGRAVVVH 
Sbjct  61   PHFNPQSKEHGAPEDENRHAGDLGNVTVGEGGTVNITIVDKQIPLTGPYSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG++GLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGVVGLQ  151



>emb|CDP18382.1| unnamed protein product [Coffea canephora]
Length=152

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 134/151 (89%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVLS +E VSGTIF TQEGDGPTTVTG ++GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLSGNECVSGTIFLTQEGDGPTTVTGTITGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDLGN+T G+DGTA   + D QIPLTG +S++GRAVVVH 
Sbjct  61   PHFNPKGKEHGAPCDENRHAGDLGNVTAGQDGTANVLVVDNQIPLTGPHSVVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSKTTGNAGGRVACG+IGLQ
Sbjct  121  DPDDLGRGGHELSKTTGNAGGRVACGVIGLQ  151



>gb|AAY90123.1| copper/zinc superoxide dismutase [Rheum australe]
Length=152

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+S+EGVSGTI F Q+G+GPTTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVVVLNSAEGVSGTINFVQDGEGPTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP  KEHGAPED+ RHAGDLGNIT G DGTA   + D QIPL G NSIIGRAVVVH 
Sbjct  61   PHFNPNAKEHGAPEDENRHAGDLGNITAGADGTAAVNVVDSQIPLVGPNSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELS TTGNAGGR+ACGIIGLQ
Sbjct  121  DPDDLGKGGHELSTTTGNAGGRIACGIIGLQ  151



>ref|XP_008651855.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 isoform X3 [Zea mays]
Length=165

 Score =   249 bits (636),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ ++ V GTIFF+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  15   MVKAVAVLAGTD-VKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  73

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+T GEDG     ITD QIPL G +SIIGRAVVVH 
Sbjct  74   PHFNPVGKEHGAPEDEDRHAGDLGNVTAGEDGVVNVNITDSQIPLAGPHSIIGRAVVVHA  133

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  134  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  164



>emb|CBI34272.3| unnamed protein product [Vitis vinifera]
Length=148

 Score =   249 bits (635),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 136/151 (90%), Gaps = 4/151 (3%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+S+EGV GTI+F +EGDG TTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSNEGVCGTIYFAEEGDGSTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+ VGEDGT  F I    IPLTG+NSI+GRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVIVGEDGTVNFKI----IPLTGSNSIVGRAVVVHA  116

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACG+IGLQ
Sbjct  117  DPDDLGKGGHELSKSTGNAGGRVACGVIGLQ  147



>gb|AAN60796.1| superoxide dismutase [Brassica juncea]
Length=152

 Score =   249 bits (635),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 128/150 (85%), Positives = 133/150 (89%), Gaps = 0/150 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGVAVL+S EGV GTIFFTQEGDG TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVAVLNSGEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRAVVVH 
Sbjct  61   PHFNPDGKQHGAPEDANRHAGDLGNIIVGDDGTATFTITDCQIPLSGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGL  509
            DPDDL KGGHELS  TGNA GRVACGIIGL
Sbjct  121  DPDDLXKGGHELSLATGNAXGRVACGIIGL  150



>ref|NP_001105335.1| superoxide dismutase [Cu-Zn] 2 [Zea mays]
 ref|XP_008651856.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 isoform X1 [Zea mays]
 sp|P11428.2|SODC2_MAIZE RecName: Full=Superoxide dismutase [Cu-Zn] 2 [Zea mays]
 gb|AAA33510.1| superoxide dismutase 2 [Zea mays]
 gb|AAA33511.1| SOD2 protein [Zea mays]
 gb|ACG30489.1| superoxide dismutase 2 [Zea mays]
 gb|ACG30955.1| superoxide dismutase 2 [Zea mays]
 tpg|DAA64025.1| TPA: superoxide dismutase2 isoform 1 [Zea mays]
 tpg|DAA64026.1| TPA: superoxide dismutase2 isoform 2 [Zea mays]
 tpg|DAA64027.1| TPA: superoxide dismutase2 isoform 3 [Zea mays]
Length=151

 Score =   248 bits (634),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ ++ V GTIFF+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLAGTD-VKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  59

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+T GEDG     ITD QIPL G +SIIGRAVVVH 
Sbjct  60   PHFNPVGKEHGAPEDEDRHAGDLGNVTAGEDGVVNVNITDSQIPLAGPHSIIGRAVVVHA  119

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  120  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  150



>ref|XP_008800522.1| PREDICTED: superoxide dismutase [Cu-Zn]-like isoform X1 [Phoenix 
dactylifera]
 ref|XP_008800523.1| PREDICTED: superoxide dismutase [Cu-Zn]-like isoform X1 [Phoenix 
dactylifera]
Length=154

 Score =   248 bits (634),  Expect = 6e-81, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL  +EGV+GT+ F QEGDGPTTVT N+ GLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGGTEGVTGTVHFFQEGDGPTTVTANIYGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGKEHGAPED+ RHAGDLGN+T GEDGT  F+I D QIPL G  +IIGRAVVVH 
Sbjct  61   PHFNPAGKEHGAPEDENRHAGDLGNVTAGEDGTVNFSIVDNQIPLIGPTAIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAG RVACGIIGL+
Sbjct  121  DPDDLGKGGHELSKSTGNAGARVACGIIGLR  151



>emb|CDY22663.1| BnaC08g42970D [Brassica napus]
Length=190

 Score =   249 bits (636),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 125/151 (83%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  45   RSQTKMVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNG  224
            +    M KGVAVL+SSEGV GTIFFT EG+G TTVTG VSGLKPG HGFHVHALGDTTNG
Sbjct  39   KDHKTMAKGVAVLNSSEGVKGTIFFTHEGNGATTVTGTVSGLKPGLHGFHVHALGDTTNG  98

Query  225  CMSTGPHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRA  404
            CMSTGPHFNP GK HGAPED  RHAGDLGNI VG+DGTATFTITD QIPL+G NSI+GRA
Sbjct  99   CMSTGPHFNPDGKTHGAPEDANRHAGDLGNIIVGDDGTATFTITDSQIPLSGPNSIVGRA  158

Query  405  VVVHGDPDDLGKGGHELSKTTGNAGGRVACG  497
            VVVH DPDDLGKGGHELS +TGNAGGRVACG
Sbjct  159  VVVHADPDDLGKGGHELSLSTGNAGGRVACG  189



>gb|ACO90194.1| superoxide dismutase [Triticum aestivum]
Length=152

 Score =   247 bits (630),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GTIFFTQEG+GPTTVTG+V+GLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTGSEGVKGTIFFTQEGEGPTTVTGSVTGLKEGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG  HGAPED+IRHAGDLGN+T G DG A+  ITD  IPLTG NSI+ RAVVVHG
Sbjct  61   PHFNPAGHVHGAPEDEIRHAGDLGNVTAGVDGVASINITDCHIPLTGPNSIVARAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSK+TGNAG RVACGIIGLQ
Sbjct  121  DADDLGKGGHELSKSTGNAGARVACGIIGLQ  151



>ref|XP_008651854.1| PREDICTED: superoxide dismutase [Cu-Zn] 2 isoform X2 [Zea mays]
 gb|ACR34594.1| unknown [Zea mays]
 tpg|DAA64028.1| TPA: superoxide dismutase2 [Zea mays]
Length=210

 Score =   249 bits (635),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 134/151 (89%), Gaps = 1/151 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ ++ V GTIFF+QEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  60   MVKAVAVLAGTD-VKGTIFFSQEGDGPTTVTGSISGLKPGLHGFHVHALGDTTNGCMSTG  118

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+T GEDG     ITD QIPL G +SIIGRAVVVH 
Sbjct  119  PHFNPVGKEHGAPEDEDRHAGDLGNVTAGEDGVVNVNITDSQIPLAGPHSIIGRAVVVHA  178

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  179  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  209



>dbj|BAJ94548.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=152

 Score =   246 bits (628),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+ SEGV GTIFFTQEGDGPTTVTG+V+GLK G HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLTGSEGVKGTIFFTQEGDGPTTVTGSVTGLKEGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAG  HGAPED+IRHAGDLGN+T G DG A   +TD  IPL G +SIIGRAVVVHG
Sbjct  61   PHFNPAGHVHGAPEDEIRHAGDLGNVTAGADGVANINVTDCHIPLAGPHSIIGRAVVVHG  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            D DDLGKGGHELSK+TGNAG RVACGIIGLQ
Sbjct  121  DADDLGKGGHELSKSTGNAGARVACGIIGLQ  151



>gb|ABM53666.2| copper/zinc superoxide dismutase [Euphorbia characias]
Length=153

 Score =   244 bits (624),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 130/152 (86%), Positives = 141/152 (93%), Gaps = 1/152 (1%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL SS+GV GT+FFTQEGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGSSDGVKGTVFFTQEGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANS-IIGRAVVVH  416
            PHFNP  KEHGAP+D+ RHAGDLGNITVG+DGTA FTI DKQIPLTG+NS ++GRAVVVH
Sbjct  61   PHFNPESKEHGAPDDETRHAGDLGNITVGDDGTANFTIIDKQIPLTGSNSVVVGRAVVVH  120

Query  417  GDPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
             DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  ADPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  152



>gb|AFO64338.1| Cu/Zn superoxide dismutase [Eucalyptus grandis x Eucalyptus urophylla]
Length=152

 Score =   243 bits (620),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 133/151 (88%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL   +G  GT FF+Q+G+GPTTVTG +SGLKPG  G HVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLGRKDGERGTEFFSQDGEGPTTVTGKLSGLKPGLQGLHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK HGAPED  RHAGDLGN+TVG DG+A+F+I DKQIPL+G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKGHGAPEDVNRHAGDLGNVTVGADGSASFSIVDKQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_006382704.1| hypothetical protein POPTR_0005s04590g [Populus trichocarpa]
 gb|ERP60501.1| hypothetical protein POPTR_0005s04590g [Populus trichocarpa]
Length=139

 Score =   242 bits (617),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 126/151 (83%), Positives = 132/151 (87%), Gaps = 13/151 (9%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEG             PTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVAVLNSSEG-------------PTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  47

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAPED+ RHAGDLGN+TVG+DGTATFTI DKQIPLTG +SIIGRAVVVHG
Sbjct  48   PHFNPVGKEHGAPEDENRHAGDLGNVTVGDDGTATFTIIDKQIPLTGPHSIIGRAVVVHG  107

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ
Sbjct  108  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  138



>gb|EEC75259.1| hypothetical protein OsI_11574 [Oryza sativa Indica Group]
Length=187

 Score =   242 bits (618),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/146 (82%), Positives = 126/146 (86%), Gaps = 0/146 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL SSE V GTI F QEGDGPTTVTG+VSGLKPG HGFH+HALGDTTNGCMSTG
Sbjct  20   MVKAVVVLGSSEIVKGTIHFVQEGDGPTTVTGSVSGLKPGLHGFHIHALGDTTNGCMSTG  79

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PH+NPAGKEHGAPED+ RHAGDLGN+T GEDG A   + D QIPLTG NSIIGRAVVVH 
Sbjct  80   PHYNPAGKEHGAPEDETRHAGDLGNVTAGEDGVANIHVVDSQIPLTGPNSIIGRAVVVHA  139

Query  420  DPDDLGKGGHELSKTTGNAGGRVACG  497
            DPDDLGKGGHELSKTTGNAGGRV  G
Sbjct  140  DPDDLGKGGHELSKTTGNAGGRVLAG  165



>sp|Q42611.3|SODC1_BRAJU RecName: Full=Superoxide dismutase [Cu-Zn] 1 [Brassica juncea]
 emb|CAA65043.1| cytosolic Cu/Zn-superoxide dismutase [Brassica juncea]
Length=152

 Score =   241 bits (615),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 131/151 (87%), Positives = 136/151 (90%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M KGV VL+SSEGV GTIFFTQEG+G TTVTG VSGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MGKGVRVLNSSEGVKGTIFFTQEGNGTTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK HGAPED  RHAGDLGNITVG+DGTATFTITD QIPL G NSI+GRAVVVH 
Sbjct  61   PHFNPEGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDSQIPLDGPNSIVGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            +PDDLGKGGHELS TTGNAGGRVACGIIGLQ
Sbjct  121  EPDDLGKGGHELSLTTGNAGGRVACGIIGLQ  151



>gb|ABX54851.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=144

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 122/151 (81%), Positives = 131/151 (87%), Gaps = 8/151 (5%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDL        GTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDL--------GTAAINIVDKQIPLTGPHSIIGRAVVVHS  112

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  113  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  143



>sp|P24669.1|SODC_PINSY RecName: Full=Superoxide dismutase [Pinus sylvestris]
 emb|CAA41454.1| CuZn superoxide dismutase [Pinus sylvestris]
Length=154

 Score =   240 bits (612),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            ++K V VL+ +  V G + FTQEGDGPTTVTG +SGL PG HGFHVHALGDTTNGCMSTG
Sbjct  3    LLKAVVVLNGAADVKGVVQFTQEGDGPTTVTGKISGLSPGLHGFHVHALGDTTNGCMSTG  62

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP DD RHAGDLGN+TVG DGT  F+ITD QIPL+G +SI+GRAVVVH 
Sbjct  63   PHFNPLGKEHGAPTDDNRHAGDLGNVTVGTDGTVEFSITDSQIPLSGPHSIVGRAVVVHA  122

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGR+ACG++GLQ
Sbjct  123  DPDDLGKGGHELSKSTGNAGGRLACGVVGLQ  153



>gb|ABX54864.1| Ole e 5 olive pollen allergen [Olea europaea]
Length=144

 Score =   239 bits (609),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 121/151 (80%), Positives = 131/151 (87%), Gaps = 8/151 (5%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V V++SSEGV+GT++FTQEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVINSSEGVTGTVYFTQEGDGPTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDL        GTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDL--------GTAAINIVDKQIPLTGPHSIIGRAVVVHS  112

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GGHELSK+TGNAGGRVACGIIGLQ
Sbjct  113  DPDDLGRGGHELSKSTGNAGGRVACGIIGLQ  143



>gb|ABK24535.1| unknown [Picea sitchensis]
 gb|ABK26834.1| unknown [Picea sitchensis]
 gb|ACN40304.1| unknown [Picea sitchensis]
Length=154

 Score =   238 bits (607),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/150 (77%), Positives = 128/150 (85%), Gaps = 0/150 (0%)
 Frame = +3

Query  63   VKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGP  242
            +K VAVL+ +  V G + FTQEGDGPTTVT  VSGL PG HGFHVHALGDTTNGCMSTGP
Sbjct  4    LKAVAVLTGAADVKGVVQFTQEGDGPTTVTAKVSGLNPGLHGFHVHALGDTTNGCMSTGP  63

Query  243  HFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGD  422
            HFNP GKEHGAP D IRHAGDLGN+T G DG   F+ITD QIPL+G +SI+GRAVVVH D
Sbjct  64   HFNPLGKEHGAPTDQIRHAGDLGNVTAGADGIVEFSITDSQIPLSGPHSIVGRAVVVHAD  123

Query  423  PDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            PDDLGKGGHELSK+TGNAGGR+ACG++GLQ
Sbjct  124  PDDLGKGGHELSKSTGNAGGRLACGVVGLQ  153



>gb|ABE01089.1| putative cytosolic copper/zinc superoxide dismutase [Gossypium 
hirsutum]
Length=152

 Score =   237 bits (604),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 118/151 (78%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M K VA     +G  GT FF+Q+G+GPTTVTG +SGLKPG  G HVHALGDTTNGCMSTG
Sbjct  1    MAKAVAGFGRKDGERGTEFFSQDGEGPTTVTGKLSGLKPGLQGLHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNPAGK HGAPED  RHAGDLGN+TVG DG+A+F+I DKQIPL+G +SIIGRAVVVH 
Sbjct  61   PHFNPAGKGHGAPEDVNRHAGDLGNVTVGADGSASFSIVDKQIPLSGPHSIIGRAVVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSK+TGNAGGRVACGIIGLQ
Sbjct  121  DPDDLGKGGHELSKSTGNAGGRVACGIIGLQ  151



>ref|XP_008455574.1| PREDICTED: superoxide dismutase [Cu-Zn] isoform X1 [Cucumis melo]
Length=152

 Score =   236 bits (602),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 132/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S++GVSGTIFF+Q G+GPTT+TGN+SGLK G HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLESNQGVSGTIFFSQNGNGPTTITGNISGLKAGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAP+D+ RH GDLGN+  G++GTATF+I DKQI L G NS++GR++VVH 
Sbjct  61   PHFNPEGKDHGAPDDENRHVGDLGNVVAGDNGTATFSIIDKQISLVGRNSVLGRSIVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GG ELS TTGNAG R+ CG+IGLQ
Sbjct  121  DPDDLGRGGTELSLTTGNAGERIGCGVIGLQ  151



>ref|XP_004139207.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Cucumis sativus]
 ref|XP_004156438.1| PREDICTED: superoxide dismutase [Cu-Zn] 1-like [Cucumis sativus]
 gb|KGN60844.1| hypothetical protein Csa_2G013250 [Cucumis sativus]
Length=152

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/151 (73%), Positives = 131/151 (87%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL S++GVSG+IFF+Q G+GPT +TGN+SGLK G HGFHVHALGDTTNGC+STG
Sbjct  1    MVKAVAVLESNQGVSGSIFFSQNGNGPTIITGNISGLKAGLHGFHVHALGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GK+HGAP+D+ RH GDLGN+  G+DGTATF+I DKQI L G NS++GR++VVH 
Sbjct  61   PHFNPEGKDHGAPDDENRHVGDLGNVVAGDDGTATFSIIDKQISLVGPNSVLGRSIVVHA  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+GG ELS TTGNAG R+ CG+IGLQ
Sbjct  121  DPDDLGRGGTELSLTTGNAGERIGCGVIGLQ  151



>gb|AAO14117.1|AF457209_1 Cu/Zn superoxide dismutase [Hevea brasiliensis]
Length=152

 Score =   234 bits (597),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 116/151 (77%), Positives = 130/151 (86%), Gaps = 0/151 (0%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            M+K VAV++SSEG+SG IFFTQEGDGPTTVTG+VSGLKPG HGFHVH  GDTTNGC+STG
Sbjct  1    MLKAVAVITSSEGISGKIFFTQEGDGPTTVTGSVSGLKPGLHGFHVHTFGDTTNGCLSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
             HFNPA K+HG PED+ RHAGDLGN+ VG+DGTA FTI DK IPL+G +SI GR+VV H 
Sbjct  61   LHFNPASKDHGGPEDENRHAGDLGNVNVGDDGTANFTIVDKHIPLSGPHSIAGRSVVFHE  120

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
              DDLGKGGHELSK TGNAG R+ACGIIGLQ
Sbjct  121  GRDDLGKGGHELSKITGNAGDRIACGIIGLQ  151



>gb|ABX26132.1| allergen Ole e 5 [Olea europaea]
Length=144

 Score =   233 bits (595),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 120/151 (79%), Positives = 129/151 (85%), Gaps = 8/151 (5%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK V VL+SSEGV+GT++FTQEGDG TTVTGN+SGLKPG HGFHVHALGDTTNGCMSTG
Sbjct  1    MVKAVTVLNSSEGVTGTVYFTQEGDGLTTVTGNLSGLKPGLHGFHVHALGDTTNGCMSTG  60

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP D+ RHAGDL        GTA   I DKQIPLTG +SIIGRAVVVH 
Sbjct  61   PHFNPVGKEHGAPGDENRHAGDL--------GTAAINIVDKQIPLTGPHSIIGRAVVVHS  112

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLG+G HELSK+TGNAGGRVACGIIGLQ
Sbjct  113  DPDDLGRGCHELSKSTGNAGGRVACGIIGLQ  143



>gb|AEY63778.1| Cu/Zn superoxide dismutase, partial [Camellia oleifera]
Length=125

 Score =   232 bits (591),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 120/125 (96%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  GPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAGDLGN  314
            GPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPED+ RHAGDLGN
Sbjct  1    GPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDETRHAGDLGN  60

Query  315  ITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVAC  494
            +TVG+DGTA+FTI DKQIPLTG NSIIGRAVVVH DPDDLGKGGHELSKTTGNAGGR+AC
Sbjct  61   VTVGDDGTASFTIVDKQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRIAC  120

Query  495  GIIGL  509
            GIIGL
Sbjct  121  GIIGL  125



>gb|AAU08173.1| Cu/Zn superoxide dismutase [Camellia sinensis]
Length=134

 Score =   232 bits (592),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 116/130 (89%), Positives = 123/130 (95%), Gaps = 1/130 (1%)
 Frame = +3

Query  123  QEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAG  302
            QEGDGPTTVTGN+SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHG+PED+ RHAG
Sbjct  3    QEGDGPTTVTGNISGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGSPEDETRHAG  62

Query  303  DLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGG  482
            DLGNITVG+DGTA FTI DKQIPLTG +SIIGRAVVVH DPDDLGKGGHELSK+TGNAGG
Sbjct  63   DLGNITVGDDGTACFTIVDKQIPLTGPHSIIGRAVVVHADPDDLGKGGHELSKSTGNAGG  122

Query  483  RVACGIIGLQ  512
            R+ACG IGLQ
Sbjct  123  RIACG-IGLQ  131



>dbj|BAC10110.1| copper/zinc-superoxide dismutase [Oryza sativa Japonica Group]
 dbj|BAD30565.1| copper/zinc-superoxide dismutase [Oryza sativa Japonica Group]
Length=147

 Score =   231 bits (588),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 124/151 (82%), Positives = 133/151 (88%), Gaps = 5/151 (3%)
 Frame = +3

Query  60   MVKGVAVLSSSEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            MVK VAVL+SSEGV GTIFF+QEGD PT+VTG+VSGLKPG HGFHVHALGDTTNGCMST 
Sbjct  1    MVKAVAVLASSEGVKGTIFFSQEGD-PTSVTGSVSGLKPGLHGFHVHALGDTTNGCMST-  58

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
            PHFNP GKEHGAP+D+ RHAGDLGNIT G D  A   ++D QIPLTGA+SIIGRAVVVH 
Sbjct  59   PHFNPTGKEHGAPQDENRHAGDLGNITAGAD-VANVNVSDSQIPLTGAHSIIGRAVVVHA  117

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGK GHELSKTTGNAGGRVAC IIGLQ
Sbjct  118  DPDDLGK-GHELSKTTGNAGGRVAC-IIGLQ  146



>gb|ABH10014.1| Cu/Zn superoxide dismutase [Eucalyptus camaldulensis]
Length=130

 Score =   229 bits (585),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/129 (88%), Positives = 120/129 (93%), Gaps = 0/129 (0%)
 Frame = +3

Query  126  EGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAGD  305
            EGDGPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTGPHFNP GKEHGAPED  RHAGD
Sbjct  1    EGDGPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPCGKEHGAPEDQNRHAGD  60

Query  306  LGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGR  485
            LGN+ VG+DGT +FTI D QIPL+G NSI+GRAVVVHGDPDDLGKGGHELSKTTGNAGGR
Sbjct  61   LGNVNVGDDGTVSFTIIDNQIPLSGPNSIVGRAVVVHGDPDDLGKGGHELSKTTGNAGGR  120

Query  486  VACGIIGLQ  512
            VACGIIGLQ
Sbjct  121  VACGIIGLQ  129



>dbj|BAL27545.1| cytosolic Cu/Zn superoxide dismutase-2 [Equisetum arvense]
 dbj|BAL27547.1| cytosolic copper zinc superoxide dismutase [Equisetum arvense]
Length=156

 Score =   229 bits (585),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 115/151 (76%), Positives = 130/151 (86%), Gaps = 1/151 (1%)
 Frame = +3

Query  63   VKGVAVLSSSEGVSGTIFFTQEG-DGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTG  239
            +K VAVLS S GV+G + F+Q+  +GPTTV G++SGL PG HGFHVHALGDTTNGCMSTG
Sbjct  3    LKAVAVLSGSAGVAGVVHFSQDTPNGPTTVVGSLSGLSPGLHGFHVHALGDTTNGCMSTG  62

Query  240  PHFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHG  419
             H+NPA K HGAPED+ RHAGDLGN+TVG+DG A  +ITD QIPL G NSIIGRAVVVH 
Sbjct  63   AHYNPANKVHGAPEDEDRHAGDLGNVTVGDDGKAQLSITDCQIPLDGPNSIIGRAVVVHA  122

Query  420  DPDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            DPDDLGKGGHELSKTTGNAGGR+ACG+IGLQ
Sbjct  123  DPDDLGKGGHELSKTTGNAGGRLACGVIGLQ  153



>gb|AFS44490.1| Cu/Zn superoxide dismutase, partial [Eragrostis atrovirens]
 gb|AFS44495.1| Cu/Zn superoxide dismutase, partial [Toona sinensis]
Length=129

 Score =   226 bits (577),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 113/130 (87%), Positives = 121/130 (93%), Gaps = 1/130 (1%)
 Frame = +3

Query  123  QEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAG  302
            QEGDGPTTVTGN+SGLKPG HGFH+HALGDTTNGC+STGPHFNP GK+HGAPED+ RHAG
Sbjct  1    QEGDGPTTVTGNLSGLKPGLHGFHIHALGDTTNGCLSTGPHFNPNGKDHGAPEDETRHAG  60

Query  303  DLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGG  482
            DLGNI VG+DGT +FTITD QIPLTG NSIIGRAVVVH DPDDLGKGGHELSKTTGNAGG
Sbjct  61   DLGNINVGDDGTVSFTITDYQIPLTGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGG  120

Query  483  RVACGIIGLQ  512
            R+ACG IGLQ
Sbjct  121  RIACG-IGLQ  129



>gb|AEY79519.1| copper/zinc superoxide dismutase, partial [Tetradium glabrifolium]
Length=125

 Score =   226 bits (576),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  GPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAGDLGN  314
            GPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDD RHAGDLGN
Sbjct  1    GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDNRHAGDLGN  60

Query  315  ITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVAC  494
            +TV +DGTA+FTI D QIPL+G NSIIGRAVVVH DPDDLGKGGHELSKTTGNAGGRVAC
Sbjct  61   VTVSDDGTASFTIVDNQIPLSGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVAC  120

Query  495  GIIGL  509
            GIIGL
Sbjct  121  GIIGL  125



>gb|AEY79511.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum]
 gb|AEY79513.1| copper/zinc superoxide dismutase, partial [Tetradium ruticarpum]
Length=125

 Score =   226 bits (576),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/125 (90%), Positives = 118/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  135  GPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDDIRHAGDLGN  314
            GPTTVTG++SGLKPG HGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPED+ RHAGDLGN
Sbjct  1    GPTTVTGSLSGLKPGLHGFHVHALGDTTNGCMSTGPHFNPAGKEHGAPEDENRHAGDLGN  60

Query  315  ITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGDPDDLGKGGHELSKTTGNAGGRVAC  494
            + VG+DGTATFTI D QIPL+G NSIIGRAVVVH DPDDLGKGGHELSKTTGNAGGRVAC
Sbjct  61   VNVGDDGTATFTIVDNQIPLSGPNSIIGRAVVVHADPDDLGKGGHELSKTTGNAGGRVAC  120

Query  495  GIIGL  509
            GIIGL
Sbjct  121  GIIGL  125



>ref|XP_001760804.1| predicted protein [Physcomitrella patens]
 gb|EDQ74543.1| predicted protein [Physcomitrella patens]
Length=157

 Score =   227 bits (578),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 124/150 (83%), Gaps = 1/150 (1%)
 Frame = +3

Query  66   KGVAVLSS-SEGVSGTIFFTQEGDGPTTVTGNVSGLKPGHHGFHVHALGDTTNGCMSTGP  242
            K V VL+S S  VSG I F  EG G TTV G + GL PG HGFHVHALGDTTNGCMSTGP
Sbjct  5    KAVCVLTSPSSNVSGVISFVDEGSGYTTVEGEIKGLNPGKHGFHVHALGDTTNGCMSTGP  64

Query  243  HFNPAGKEHGAPEDDIRHAGDLGNITVGEDGTATFTITDKQIPLTGANSIIGRAVVVHGD  422
            HFNP G EHGAPED++RHAGDLGN+  G+DG A  ++ D QIPLTGA+SIIGRAVVVH D
Sbjct  65   HFNPKGFEHGAPEDEVRHAGDLGNVIAGDDGVAKVSLKDFQIPLTGADSIIGRAVVVHAD  124

Query  423  PDDLGKGGHELSKTTGNAGGRVACGIIGLQ  512
            PDDLGKGGHELSK+TGNAGGR+ACGIIGLQ
Sbjct  125  PDDLGKGGHELSKSTGNAGGRIACGIIGLQ  154



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720