BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C07

Length=528
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_008229835.1|  PREDICTED: eukaryotic translation initiation...    217   1e-68   Prunus mume [ume]
ref|XP_002279938.1|  PREDICTED: eukaryotic translation initiation...    217   1e-68   Vitis vinifera
ref|XP_010046096.1|  PREDICTED: eukaryotic translation initiation...    217   1e-68   Eucalyptus grandis [rose gum]
ref|XP_010050042.1|  PREDICTED: eukaryotic translation initiation...    216   2e-68   Eucalyptus grandis [rose gum]
gb|KDP30840.1|  hypothetical protein JCGZ_13783                         216   2e-68   Jatropha curcas
ref|XP_008342155.1|  PREDICTED: eukaryotic translation initiation...    216   2e-68   
ref|XP_002320498.1|  translation initiation factor eIF-1A family ...    216   3e-68   Populus trichocarpa [western balsam poplar]
gb|AFK39830.1|  unknown                                                 216   3e-68   Lotus japonicus
ref|XP_008783155.1|  PREDICTED: eukaryotic translation initiation...    216   3e-68   Phoenix dactylifera
ref|XP_009788620.1|  PREDICTED: eukaryotic translation initiation...    216   4e-68   Nicotiana sylvestris
ref|XP_004304062.1|  PREDICTED: eukaryotic translation initiation...    216   4e-68   Fragaria vesca subsp. vesca
gb|AJA79061.1|  eukaryotic translation initiation factor 1Aa            216   4e-68   Mangifera indica
ref|XP_007051647.1|  Nucleic acid-binding, OB-fold-like protein         216   4e-68   Theobroma cacao [chocolate]
ref|XP_010261458.1|  PREDICTED: eukaryotic translation initiation...    215   6e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006447686.1|  hypothetical protein CICLE_v10017092mg             215   7e-68   Citrus clementina [clementine]
ref|XP_004240089.1|  PREDICTED: eukaryotic translation initiation...    215   7e-68   Solanum lycopersicum
ref|XP_010252626.1|  PREDICTED: eukaryotic translation initiation...    215   8e-68   Nelumbo nucifera [Indian lotus]
ref|XP_006856118.1|  hypothetical protein AMTR_s00059p00147020          215   8e-68   Amborella trichopoda
ref|XP_006843145.1|  hypothetical protein AMTR_s00146p00027250          215   8e-68   Amborella trichopoda
ref|XP_010912398.1|  PREDICTED: eukaryotic translation initiation...    214   1e-67   Elaeis guineensis
ref|XP_004487629.1|  PREDICTED: eukaryotic translation initiation...    214   1e-67   Cicer arietinum [garbanzo]
ref|XP_002528946.1|  eif-1a, putative                                   214   1e-67   Ricinus communis
ref|XP_002302848.1|  translation initiation factor eIF-1A family ...    214   1e-67   Populus trichocarpa [western balsam poplar]
ref|XP_009631127.1|  PREDICTED: eukaryotic translation initiation...    214   1e-67   Nicotiana tomentosiformis
ref|XP_004144524.1|  PREDICTED: eukaryotic translation initiation...    214   2e-67   Cucumis sativus [cucumbers]
ref|XP_010915988.1|  PREDICTED: eukaryotic translation initiation...    214   2e-67   Elaeis guineensis
ref|XP_004147021.1|  PREDICTED: eukaryotic translation initiation...    214   2e-67   Cucumis sativus [cucumbers]
ref|XP_008457652.1|  PREDICTED: eukaryotic translation initiation...    214   2e-67   Cucumis melo [Oriental melon]
ref|XP_010040579.1|  PREDICTED: eukaryotic translation initiation...    214   2e-67   Eucalyptus grandis [rose gum]
gb|KJB24602.1|  hypothetical protein B456_004G153400                    214   2e-67   Gossypium raimondii
ref|XP_010099476.1|  Eukaryotic translation initiation factor 1A        213   3e-67   Morus notabilis
gb|ADV04051.1|  eukaryotic translation initiation factor 1Aa            213   4e-67   Hevea brasiliensis [jebe]
ref|XP_010924898.1|  PREDICTED: eukaryotic translation initiation...    213   4e-67   Elaeis guineensis
ref|XP_008808570.1|  PREDICTED: eukaryotic translation initiation...    213   5e-67   Phoenix dactylifera
gb|ABK21455.1|  unknown                                                 213   5e-67   Picea sitchensis
ref|XP_010925962.1|  PREDICTED: eukaryotic translation initiation...    213   7e-67   Elaeis guineensis
ref|XP_011093064.1|  PREDICTED: eukaryotic translation initiation...    212   8e-67   Sesamum indicum [beniseed]
emb|CAN77264.1|  hypothetical protein VITISV_041156                     211   9e-67   Vitis vinifera
ref|XP_006345573.1|  PREDICTED: eukaryotic translation initiation...    212   9e-67   Solanum tuberosum [potatoes]
ref|XP_010650771.1|  PREDICTED: eukaryotic translation initiation...    213   1e-66   
ref|XP_011093318.1|  PREDICTED: eukaryotic translation initiation...    212   1e-66   Sesamum indicum [beniseed]
ref|XP_004229971.1|  PREDICTED: eukaryotic translation initiation...    211   1e-66   
ref|XP_008806275.1|  PREDICTED: eukaryotic translation initiation...    211   2e-66   Phoenix dactylifera
ref|XP_010270106.1|  PREDICTED: eukaryotic translation initiation...    211   2e-66   Nelumbo nucifera [Indian lotus]
ref|XP_008362314.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    212   2e-66   
ref|NP_001275611.1|  eukaryotic translation initiation factor 1A-...    211   2e-66   Solanum tuberosum [potatoes]
gb|KHG13840.1|  Eukaryotic translation initiation factor 1A             211   3e-66   Gossypium arboreum [tree cotton]
ref|XP_007147260.1|  hypothetical protein PHAVU_006G109500g             210   6e-66   Phaseolus vulgaris [French bean]
ref|XP_003528819.1|  PREDICTED: eukaryotic translation initiation...    210   6e-66   Glycine max [soybeans]
ref|XP_003521792.1|  PREDICTED: eukaryotic translation initiation...    210   7e-66   Glycine max [soybeans]
ref|XP_007135187.1|  hypothetical protein PHAVU_010G108300g             210   7e-66   Phaseolus vulgaris [French bean]
gb|KJB42818.1|  hypothetical protein B456_007G168900                    210   7e-66   Gossypium raimondii
ref|XP_009395770.1|  PREDICTED: eukaryotic translation initiation...    210   8e-66   Musa acuminata subsp. malaccensis [pisang utan]
gb|AFY13532.1|  eukaryotic translation initiation factor 1A             209   9e-66   Aeschynomene evenia
gb|KJB07159.1|  hypothetical protein B456_001G218400                    209   9e-66   Gossypium raimondii
ref|XP_007049245.1|  Nucleic acid-binding, OB-fold-like protein         209   1e-65   
gb|AFK48031.1|  unknown                                                 209   1e-65   Lotus japonicus
ref|XP_003548603.1|  PREDICTED: eukaryotic translation initiation...    209   1e-65   Glycine max [soybeans]
gb|EPS72436.1|  hypothetical protein M569_02322                         209   2e-65   Genlisea aurea
gb|AEW08191.1|  hypothetical protein 2_2685_01                          208   2e-65   Pinus radiata
gb|AAK55703.1|AF378900_1  At2g04520/T1O3.7                              208   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_178531.1|  OB-fold nucleic acid binding domain-containing ...    208   2e-65   Arabidopsis thaliana [mouse-ear cress]
gb|KHG10018.1|  Eukaryotic translation initiation factor 1A             208   3e-65   Gossypium arboreum [tree cotton]
gb|KHN27268.1|  Eukaryotic translation initiation factor 1A             208   4e-65   Glycine soja [wild soybean]
ref|XP_009124264.1|  PREDICTED: eukaryotic translation initiation...    208   5e-65   Brassica rapa
gb|ABK27099.1|  unknown                                                 207   5e-65   Picea sitchensis
gb|KHN15977.1|  Eukaryotic translation initiation factor 1A             207   5e-65   Glycine soja [wild soybean]
ref|XP_006418569.1|  hypothetical protein EUTSA_v10002706mg             207   6e-65   Eutrema salsugineum [saltwater cress]
ref|XP_011039356.1|  PREDICTED: eukaryotic translation initiation...    207   8e-65   Populus euphratica
ref|XP_006298759.1|  hypothetical protein CARUB_v10014860mg             207   8e-65   Capsella rubella
ref|XP_006444904.1|  hypothetical protein CICLE_v10022729mg             207   1e-64   Citrus clementina [clementine]
ref|XP_010557684.1|  PREDICTED: eukaryotic translation initiation...    207   1e-64   Tarenaya hassleriana [spider flower]
sp|P56331.2|IF1A_ONOVI  RecName: Full=Eukaryotic translation init...    207   1e-64   Onobrychis viciifolia
ref|XP_009386642.1|  PREDICTED: eukaryotic translation initiation...    206   1e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010435457.1|  PREDICTED: eukaryotic translation initiation...    206   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_010450406.1|  PREDICTED: eukaryotic translation initiation...    206   2e-64   Camelina sativa [gold-of-pleasure]
gb|KJB49471.1|  hypothetical protein B456_008G123000                    206   2e-64   Gossypium raimondii
ref|XP_009136137.1|  PREDICTED: eukaryotic translation initiation...    206   2e-64   Brassica rapa
gb|EYU32199.1|  hypothetical protein MIMGU_mgv1a015795mg                206   2e-64   Erythranthe guttata [common monkey flower]
ref|XP_006395950.1|  hypothetical protein EUTSA_v10005086mg             206   2e-64   Eutrema salsugineum [saltwater cress]
emb|CDY15065.1|  BnaC03g44260D                                          206   2e-64   Brassica napus [oilseed rape]
emb|CDY15062.1|  BnaC03g44230D                                          206   2e-64   Brassica napus [oilseed rape]
ref|XP_010556581.1|  PREDICTED: eukaryotic translation initiation...    206   3e-64   Tarenaya hassleriana [spider flower]
ref|XP_002885759.1|  hypothetical protein ARALYDRAFT_899257             206   3e-64   Arabidopsis lyrata subsp. lyrata
ref|XP_009394126.1|  PREDICTED: eukaryotic translation initiation...    206   3e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009410820.1|  PREDICTED: eukaryotic translation initiation...    206   4e-64   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010440750.1|  PREDICTED: eukaryotic translation initiation...    206   4e-64   Camelina sativa [gold-of-pleasure]
emb|CDY00869.1|  BnaCnng00690D                                          205   5e-64   
ref|XP_010533003.1|  PREDICTED: eukaryotic translation initiation...    205   5e-64   Tarenaya hassleriana [spider flower]
ref|XP_009102383.1|  PREDICTED: eukaryotic translation initiation...    205   6e-64   Brassica rapa
ref|XP_010488695.1|  PREDICTED: eukaryotic translation initiation...    205   7e-64   Camelina sativa [gold-of-pleasure]
ref|XP_009614367.1|  PREDICTED: eukaryotic translation initiation...    204   8e-64   Nicotiana tomentosiformis
ref|XP_010514569.1|  PREDICTED: eukaryotic translation initiation...    204   1e-63   Camelina sativa [gold-of-pleasure]
ref|XP_010542007.1|  PREDICTED: eukaryotic translation initiation...    204   1e-63   Tarenaya hassleriana [spider flower]
gb|EYU38916.1|  hypothetical protein MIMGU_mgv1a015832mg                204   2e-63   Erythranthe guttata [common monkey flower]
gb|KJB22692.1|  hypothetical protein B456_004G061900                    204   2e-63   Gossypium raimondii
ref|XP_002870440.1|  hypothetical protein ARALYDRAFT_915692             204   2e-63   Arabidopsis lyrata subsp. lyrata
ref|XP_010382934.1|  PREDICTED: eukaryotic translation initiation...    203   2e-63   Rhinopithecus roxellana
ref|XP_006282752.1|  hypothetical protein CARUB_v10005971mg             204   2e-63   
gb|ACH63231.1|  translation initiation factor                           203   2e-63   Rheum australe [Himalayan rhubarb]
gb|AHF21586.1|  translation initiation factor 1A                        203   2e-63   Tamarix hispida
gb|KFK35344.1|  hypothetical protein AALP_AA5G272400                    203   3e-63   Arabis alpina [alpine rockcress]
ref|XP_010467002.1|  PREDICTED: eukaryotic translation initiation...    203   3e-63   Camelina sativa [gold-of-pleasure]
emb|CDP13774.1|  unnamed protein product                                202   6e-63   Coffea canephora [robusta coffee]
ref|NP_001190425.1|  Nucleic acid-binding, OB-fold-like protein         202   7e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001752588.1|  predicted protein                                  201   1e-62   
ref|XP_001781809.1|  predicted protein                                  201   1e-62   
gb|KDP28534.1|  hypothetical protein JCGZ_14305                         201   2e-62   Jatropha curcas
ref|XP_004302969.1|  PREDICTED: eukaryotic translation initiation...    201   3e-62   Fragaria vesca subsp. vesca
ref|XP_010669534.1|  PREDICTED: eukaryotic translation initiation...    200   6e-62   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002451991.1|  hypothetical protein SORBIDRAFT_04g012700          198   2e-61   Sorghum bicolor [broomcorn]
gb|AFW70845.1|  hypothetical protein ZEAMMB73_520716                    198   2e-61   
ref|XP_004952302.1|  PREDICTED: eukaryotic translation initiation...    198   2e-61   Setaria italica
ref|XP_002961688.1|  hypothetical protein SELMODRAFT_165058             198   2e-61   Selaginella moellendorffii
emb|CAC80989.1|  translation initiation factor (eIF-1A)                 198   3e-61   Beta vulgaris [beet]
ref|NP_198418.1|  Nucleic acid-binding, OB-fold-like protein            197   8e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009789091.1|  PREDICTED: eukaryotic translation initiation...    196   2e-60   Nicotiana sylvestris
gb|AFK38613.1|  unknown                                                 196   2e-60   Medicago truncatula
ref|XP_006358649.1|  PREDICTED: eukaryotic translation initiation...    196   2e-60   Solanum tuberosum [potatoes]
ref|XP_006647192.1|  PREDICTED: eukaryotic translation initiation...    195   4e-60   Oryza brachyantha
ref|XP_009625046.1|  PREDICTED: eukaryotic translation initiation...    195   5e-60   Nicotiana tomentosiformis
ref|NP_001046619.1|  Os02g0300700                                       195   6e-60   
sp|P47815.2|IF1A_WHEAT  RecName: Full=Eukaryotic translation init...    194   8e-60   Triticum aestivum [Canadian hard winter wheat]
pir||A53045  translation initiation factor eIF-1A - wheat (fragment)    194   1e-59
ref|XP_002437817.1|  hypothetical protein SORBIDRAFT_10g003120          194   1e-59   Sorghum bicolor [broomcorn]
ref|NP_001057571.1|  Os06g0342200                                       194   1e-59   
ref|XP_003637206.1|  Eukaryotic translation initiation factor 1A        194   1e-59   
ref|XP_003563824.1|  PREDICTED: eukaryotic translation initiation...    194   1e-59   Brachypodium distachyon [annual false brome]
gb|ADI47121.1|  eukaryotic translation initiation factor 1A             194   1e-59   Leymus chinensis
ref|NP_001141230.1|  uncharacterized protein LOC100273317               194   2e-59   Zea mays [maize]
gb|ACR36727.1|  unknown                                                 192   4e-59   Zea mays [maize]
gb|EYU32198.1|  hypothetical protein MIMGU_mgv11b013259mg               192   5e-59   Erythranthe guttata [common monkey flower]
ref|XP_006656063.1|  PREDICTED: eukaryotic translation initiation...    191   1e-58   Oryza brachyantha
ref|NP_001148997.1|  eukaryotic translation initiation factor 1A        191   6e-58   
emb|CDP09625.1|  unnamed protein product                                186   2e-56   Coffea canephora [robusta coffee]
ref|XP_010051713.1|  PREDICTED: eukaryotic translation initiation...    183   7e-56   Eucalyptus grandis [rose gum]
ref|XP_003598034.1|  Eukaryotic translation initiation factor 1A        181   2e-54   Medicago truncatula
ref|XP_002300749.2|  hypothetical protein POPTR_0002s03310g             177   6e-53   Populus trichocarpa [western balsam poplar]
gb|AFX67033.1|  translation initiation factor 1A                        173   7e-52   Solanum tuberosum [potatoes]
ref|XP_005651075.1|  nucleic acid-binding protein                       173   1e-51   Coccomyxa subellipsoidea C-169
gb|KDP28098.1|  hypothetical protein JCGZ_13869                         173   2e-51   Jatropha curcas
ref|XP_003744731.1|  PREDICTED: eukaryotic translation initiation...    173   2e-51   Galendromus occidentalis
emb|CDP08730.1|  unnamed protein product                                171   1e-50   Coffea canephora [robusta coffee]
gb|KIZ01615.1|  Eukaryotic translation initiation factor 1A,X-chr...    170   2e-50   Monoraphidium neglectum
ref|XP_002502870.1|  predicted protein                                  170   2e-50   Micromonas commoda
gb|KCW45092.1|  hypothetical protein EUGRSUZ_L01307                     169   3e-50   Eucalyptus grandis [rose gum]
ref|XP_011100153.1|  PREDICTED: eukaryotic translation initiation...    169   4e-50   Sesamum indicum [beniseed]
ref|XP_003968238.1|  PREDICTED: eukaryotic translation initiation...    169   9e-50   Takifugu rubripes [tiger puffer]
ref|XP_002424524.1|  eukaryotic translation initiation factor 1A,...    169   9e-50   Pediculus humanus corporis [human body lice]
ref|XP_008476517.1|  PREDICTED: eukaryotic translation initiation...    169   1e-49   
ref|XP_004080846.1|  PREDICTED: eukaryotic translation initiation...    168   1e-49   Oryzias latipes [Japanese rice fish]
ref|XP_003060983.1|  predicted protein                                  168   1e-49   Micromonas pusilla CCMP1545
ref|XP_010784482.1|  PREDICTED: eukaryotic translation initiation...    168   1e-49   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_010752914.1|  PREDICTED: eukaryotic translation initiation...    168   1e-49   
ref|XP_005813689.1|  PREDICTED: eukaryotic translation initiation...    168   1e-49   Xiphophorus maculatus
ref|XP_003456291.1|  PREDICTED: eukaryotic translation initiation...    168   1e-49   Oreochromis niloticus
ref|XP_967161.1|  PREDICTED: eukaryotic translation initiation fa...    168   2e-49   Tribolium castaneum [rust-red flour beetle]
gb|EPQ10197.1|  Eukaryotic translation initiation factor 1A, X-ch...    168   2e-49   Myotis brandtii
gb|ACI68357.1|  Eukaryotic translation initiation factor 1A, X-ch...    167   2e-49   Salmo salar
ref|XP_009064347.1|  hypothetical protein LOTGIDRAFT_131336             167   2e-49   Lottia gigantea
ref|XP_003470245.1|  PREDICTED: eukaryotic translation initiation...    167   2e-49   Cavia porcellus [guinea pig]
ref|XP_005364836.1|  PREDICTED: eukaryotic translation initiation...    167   3e-49   Microtus ochrogaster [prairie voles]
ref|NP_001093083.1|  eukaryotic translation initiation factor 1A        167   3e-49   Bombyx mori [silk moth]
ref|XP_004306683.1|  PREDICTED: eukaryotic translation initiation...    167   3e-49   Fragaria vesca subsp. vesca
gb|EHJ63869.1|  eukaryotic translation initiation factor 1A             167   3e-49   
ref|XP_002405906.1|  translation initiation factor 1A                   167   4e-49   Ixodes scapularis [blacklegged tick]
ref|XP_011448033.1|  PREDICTED: eukaryotic translation initiation...    167   4e-49   Crassostrea gigas
ref|XP_004836829.1|  PREDICTED: eukaryotic translation initiation...    168   4e-49   
ref|XP_001421100.1|  predicted protein                                  167   6e-49   Ostreococcus lucimarinus CCE9901
emb|CEG00119.1|  Translation initiation factor 1A (eIF-1A)              167   6e-49   Ostreococcus tauri
gb|KFM83040.1|  Eukaryotic translation initiation factor 1A, X-ch...    167   6e-49   Stegodyphus mimosarum
gb|KFM83039.1|  Eukaryotic translation initiation factor 1A, X-ch...    167   6e-49   Stegodyphus mimosarum
ref|XP_008306064.1|  PREDICTED: eukaryotic translation initiation...    166   6e-49   Cynoglossus semilaevis [half-smooth tongue sole]
emb|CAF92608.1|  unnamed protein product                                166   6e-49   Tetraodon nigroviridis
ref|XP_005641247.1|  PREDICTED: eukaryotic translation initiation...    167   6e-49   
ref|XP_007186228.1|  PREDICTED: eukaryotic translation initiation...    166   7e-49   Balaenoptera acutorostrata scammoni
gb|ACO08711.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   7e-49   Oncorhynchus mykiss
ref|XP_001623821.1|  predicted protein                                  166   7e-49   Nematostella vectensis
ref|XP_005718744.1|  Translation initiation factor eIF1A                166   7e-49   Chondrus crispus [carageen]
gb|ACE87337.1|  eukaryotic translation initiation factor 1A, X-li...    166   7e-49   synthetic construct
ref|XP_004897491.1|  PREDICTED: eukaryotic translation initiation...    169   8e-49   
gb|ELR54972.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   8e-49   Bos mutus
gb|KDR18925.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   8e-49   Zootermopsis nevadensis
ref|XP_004886349.1|  PREDICTED: eukaryotic translation initiation...    166   9e-49   
gb|EHH30582.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   9e-49   Macaca mulatta [rhesus macaque]
gb|EKC40109.1|  Eukaryotic translation initiation factor 1A, X-ch...    167   9e-49   Crassostrea gigas
gb|ACQ58123.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   9e-49   Anoplopoma fimbria
gb|AGM32664.1|  eukaryotic translation initiation factor 1A             166   9e-49   Coptotermes formosanus
ref|XP_003763565.1|  PREDICTED: eukaryotic translation initiation...    166   9e-49   
ref|XP_001624519.1|  predicted protein                                  166   9e-49   Nematostella vectensis
ref|XP_010636115.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Fukomys damarensis [Damara mole rat]
ref|XP_004598164.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   
ref|XP_312806.2|  AGAP003119-PA                                         166   1e-48   Anopheles gambiae str. PEST
ref|XP_010888382.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   
ref|NP_001403.1|  eukaryotic translation initiation factor 1A, X-...    166   1e-48   Homo sapiens [man]
dbj|BAC27130.1|  unnamed protein product                                166   1e-48   Mus musculus [mouse]
ref|XP_003781272.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   
gb|ACO13811.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-48   Esox lucius
gb|ACO08159.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-48   Oncorhynchus mykiss
ref|XP_009545548.1|  hypothetical protein HETIRDRAFT_126155             166   1e-48   Heterobasidion irregulare TC 32-1
gb|ACI68111.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-48   Salmo salar
gb|AAP36772.1|  Homo sapiens eukaryotic translation initiation fa...    166   1e-48   synthetic construct
ref|XP_007249022.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Astyanax mexicanus [blind cave fish]
pdb|1D7Q|A  Chain A, Human Translation Initiation Factor Eif1a          166   1e-48   Homo sapiens [man]
ref|XP_008998608.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Callithrix jacchus [common marmoset]
ref|XP_004759022.1|  PREDICTED: eukaryotic translation initiation...    167   1e-48   
ref|XP_010145773.1|  PREDICTED: eukaryotic translation initiation...    167   1e-48   Eurypyga helias
gb|ETN59410.1|  eukaryotic translation initiation factor 1A             166   1e-48   Anopheles darlingi [American malaria mosquito]
ref|NP_524728.2|  eukaryotic initiation factor 1A, isoform A            166   1e-48   Drosophila melanogaster
ref|XP_001492778.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Equus caballus [domestic horse]
gb|ACI66529.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-48   Salmo salar
ref|XP_004435240.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_008506689.1|  PREDICTED: eukaryotic translation initiation...    166   1e-48   Equus przewalskii [Przewalski horse]
gb|ACI66646.1|  Eukaryotic translation initiation factor 1A, X-ch...    165   1e-48   Salmo salar
gb|AIC54325.1|  EIF1AX                                                  166   2e-48   synthetic construct
ref|NP_001020624.1|  eukaryotic translation initiation factor 1A,...    166   2e-48   Danio rerio [leopard danio]
ref|XP_006146742.1|  PREDICTED: eukaryotic translation initiation...    166   2e-48   Tupaia chinensis
ref|XP_006628069.1|  PREDICTED: eukaryotic translation initiation...    166   2e-48   
ref|XP_008252380.1|  PREDICTED: eukaryotic translation initiation...    165   2e-48   Oryctolagus cuniculus [domestic rabbit]
ref|XP_009944630.1|  PREDICTED: eukaryotic translation initiation...    166   2e-48   Leptosomus discolor
emb|CCQ18621.1|  Translation initiation factor 1A                       166   2e-48   Sycon ciliatum
ref|XP_008709060.1|  PREDICTED: eukaryotic translation initiation...    165   2e-48   Ursus maritimus [white bear]
ref|XP_005705342.1|  translation initiation factor eIF-1A               165   2e-48   Galdieria sulphuraria
ref|XP_009705073.1|  PREDICTED: eukaryotic translation initiation...    166   2e-48   Cariama cristata
ref|XP_008580999.1|  PREDICTED: eukaryotic translation initiation...    165   2e-48   Galeopterus variegatus [Malayan flying lemur]
ref|XP_010184319.1|  PREDICTED: eukaryotic translation initiation...    165   2e-48   Mesitornis unicolor
ref|NP_001290808.1|  eukaryotic translation initiation factor 1A,...    165   2e-48   Esox lucius
ref|XP_011235056.1|  PREDICTED: eukaryotic translation initiation...    166   2e-48   Ailuropoda melanoleuca
ref|XP_004670712.1|  PREDICTED: eukaryotic translation initiation...    165   2e-48   Jaculus jaculus
dbj|BAN20284.1|  eukaryotic translation initiation factor 1A            165   2e-48   Riptortus pedestris
ref|NP_001020500.1|  eukaryotic translation initiation factor 1A,...    165   2e-48   Bos taurus [bovine]
ref|XP_009507568.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Phalacrocorax carbo [common cormorant]
ref|XP_007070577.1|  PREDICTED: eukaryotic translation initiation...    167   3e-48   
ref|XP_004651621.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Jaculus jaculus
gb|EOA93362.1|  Eukaryotic translation initiation factor 1A, Y-ch...    165   3e-48   Anas platyrhynchos [duck]
ref|XP_010165581.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Antrostomus carolinensis
ref|XP_010117853.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Chlamydotis macqueenii
ref|XP_005002994.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   
ref|XP_001649007.1|  AAEL004378-PA                                      165   3e-48   Aedes aegypti
ref|XP_007659527.1|  PREDICTED: eukaryotic translation initiation...    166   3e-48   
ref|XP_009275210.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Aptenodytes forsteri
ref|XP_003725831.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Strongylocentrotus purpuratus [purple urchin]
ref|XP_001836196.2|  eukaryotic translation initiation factor 1A        164   3e-48   Coprinopsis cinerea okayama7#130
ref|XP_004710054.1|  PREDICTED: eukaryotic translation initiation...    166   3e-48   Echinops telfairi [lesser hedgehog tenrec]
ref|XP_009973416.1|  PREDICTED: eukaryotic translation initiation...    165   3e-48   Tyto alba [Schleiereule]
ref|XP_009563874.1|  PREDICTED: eukaryotic translation initiation...    165   4e-48   Cuculus canorus
gb|AAP36660.1|  Homo sapiens eukaryotic translation initiation fa...    164   4e-48   synthetic construct
ref|NP_001008977.1|  eukaryotic translation initiation factor 1A,...    164   4e-48   Pan troglodytes
ref|XP_010022321.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   Nestor notabilis
ref|XP_005030911.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   
ref|NP_004672.2|  eukaryotic translation initiation factor 1A, Y-...    164   4e-48   Homo sapiens [man]
dbj|BAE29738.1|  unnamed protein product                                164   4e-48   Mus musculus [mouse]
ref|XP_004328995.1|  PREDICTED: eukaryotic translation initiation...    167   4e-48   
ref|XP_004828067.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   
ref|XP_006525689.1|  PREDICTED: eukaryotic translation initiation...    168   4e-48   Mus musculus [mouse]
ref|XP_009323779.1|  PREDICTED: eukaryotic translation initiation...    166   4e-48   Pygoscelis adeliae
ref|XP_009667559.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   Struthio camelus australis
ref|XP_009490397.1|  PREDICTED: eukaryotic translation initiation...    165   4e-48   Pelecanus crispus
ref|XP_008627521.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   
ref|XP_005392800.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   
ref|XP_009985949.1|  PREDICTED: eukaryotic translation initiation...    164   4e-48   Tauraco erythrolophus
ref|XP_001866276.1|  eukaryotic translation initiation factor 1A        164   4e-48   Culex quinquefasciatus
ref|XP_004450413.1|  PREDICTED: eukaryotic translation initiation...    165   4e-48   
ref|NP_034250.3|  eukaryotic translation initiation factor 1A           164   4e-48   Mus musculus [mouse]
gb|ACI69267.1|  Eukaryotic translation initiation factor 1A, X-ch...    164   5e-48   Salmo salar
ref|XP_007796803.1|  putative eukaryotic translation initiation f...    165   5e-48   
ref|XP_007240482.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   Astyanax mexicanus [blind cave fish]
ref|XP_005102118.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   
ref|XP_005862170.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   
ref|XP_010297855.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   Balearica regulorum gibbericeps
ref|XP_010724459.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   
gb|ACI67186.1|  Eukaryotic translation initiation factor 1A, X-ch...    164   5e-48   Salmo salar
ref|XP_005862169.1|  PREDICTED: eukaryotic translation initiation...    164   5e-48   
ref|XP_005102119.1|  PREDICTED: eukaryotic translation initiation...    164   6e-48   Aplysia californica
ref|XP_005484402.1|  PREDICTED: eukaryotic translation initiation...    164   6e-48   Zonotrichia albicollis
gb|ABR27985.1|  eukaryotic initiation factor 1A                         164   6e-48   Triatoma infestans
gb|AAF44294.1|AF169359_1  eukaryotic translation initiation facto...    164   6e-48   Drosophila melanogaster
gb|EFZ09339.1|  hypothetical protein SINV_16158                         164   6e-48   
ref|XP_008945308.1|  PREDICTED: eukaryotic translation initiation...    164   6e-48   Merops nubicus
ref|XP_005503803.1|  PREDICTED: eukaryotic translation initiation...    164   6e-48   
gb|ACI69866.1|  Eukaryotic translation initiation factor 1A, X-ch...    164   7e-48   
ref|XP_009647105.1|  PREDICTED: eukaryotic translation initiation...    164   7e-48   
gb|KIK34952.1|  hypothetical protein CY34DRAFT_812547                   164   7e-48   
ref|XP_010216186.1|  PREDICTED: eukaryotic translation initiation...    164   7e-48   
ref|XP_003928359.1|  PREDICTED: eukaryotic translation initiation...    164   7e-48   
ref|XP_008920621.1|  PREDICTED: eukaryotic translation initiation...    164   8e-48   
ref|XP_009921404.1|  PREDICTED: eukaryotic translation initiation...    164   8e-48   
ref|XP_004612330.1|  PREDICTED: eukaryotic translation initiation...    166   8e-48   
ref|XP_001120011.1|  PREDICTED: eukaryotic translation initiation...    164   8e-48   
gb|ACI67070.1|  Eukaryotic translation initiation factor 1A, X-ch...    164   9e-48   
gb|EFN78082.1|  Eukaryotic translation initiation factor 1A, X-ch...    164   9e-48   
ref|XP_004828066.1|  PREDICTED: eukaryotic translation initiation...    164   9e-48   
ref|XP_005232000.1|  PREDICTED: eukaryotic translation initiation...    164   9e-48   
ref|XP_008250840.1|  PREDICTED: eukaryotic translation initiation...    164   9e-48   
gb|KIY44142.1|  nucleic acid-binding protein                            163   9e-48   
ref|XP_008039204.1|  nucleic acid-binding protein                       163   1e-47   
ref|XP_005426229.1|  PREDICTED: eukaryotic translation initiation...    164   1e-47   
ref|XP_009995575.1|  PREDICTED: eukaryotic translation initiation...    166   1e-47   
gb|EPQ10589.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-47   
ref|XP_007851396.1|  eukaryotic translation initiation factor 1a        163   1e-47   
ref|NP_001008773.2|  eukaryotic translation initiation factor 1A        163   1e-47   
ref|XP_005037490.1|  PREDICTED: eukaryotic translation initiation...    164   1e-47   
ref|XP_011500172.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
ref|XP_008204358.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
ref|XP_006116230.1|  PREDICTED: eukaryotic translation initiation...    164   1e-47   
ref|XP_008551384.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
ref|XP_001606993.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
ref|XP_004364200.1|  translation initiation factor 4C                   164   1e-47   
ref|XP_011252171.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
ref|XP_007383277.1|  nucleic acid-binding protein                       163   1e-47   
emb|CCL98784.1|  predicted protein                                      163   1e-47   
ref|XP_011149176.1|  PREDICTED: eukaryotic translation initiation...    163   1e-47   
gb|ACI66587.1|  Eukaryotic translation initiation factor 1A, X-ch...    163   1e-47   
emb|CDO74476.1|  hypothetical protein BN946_scf184979.g31               163   1e-47   
dbj|BAC27259.1|  unnamed protein product                                163   2e-47   
dbj|BAC36971.1|  unnamed protein product                                163   2e-47   
dbj|BAB23869.1|  unnamed protein product                                163   2e-47   
gb|EJU05085.1|  nucleic acid-binding protein                            162   2e-47   
ref|NP_001006082.1|  eukaryotic translation initiation factor 1A,...    163   2e-47   
gb|KDR76344.1|  hypothetical protein GALMADRAFT_247741                  163   2e-47   
ref|NP_001155534.1|  eukaryotic translation initiation factor 1A-...    163   2e-47   
ref|XP_006038428.1|  PREDICTED: eukaryotic translation initiation...    166   2e-47   
ref|XP_007354370.1|  nucleic acid-binding protein                       162   2e-47   
ref|XP_007678122.1|  hypothetical protein BAUCODRAFT_45808              162   2e-47   
gb|KJA22943.1|  hypothetical protein HYPSUDRAFT_66693                   162   2e-47   
ref|XP_002835557.1|  hypothetical protein                               163   2e-47   
ref|NP_001155546.1|  eukaryotic translation initiation factor 1A-...    163   2e-47   
ref|XP_002117021.1|  hypothetical protein TRIADDRAFT_50975              163   2e-47   
gb|ACI66063.1|  Eukaryotic translation initiation factor 1A, X-ch...    162   2e-47   
gb|EWC48516.1|  eukaryotic translation initiation factor 1A             162   2e-47   
ref|XP_002157302.2|  PREDICTED: eukaryotic translation initiation...    162   2e-47   
ref|XP_011125463.1|  hypothetical protein AOL_s00112g131                162   2e-47   
ref|XP_003703907.1|  PREDICTED: eukaryotic translation initiation...    162   2e-47   
ref|XP_007765909.1|  nucleic acid-binding protein                       162   2e-47   
gb|ELU14598.1|  hypothetical protein CAPTEDRAFT_226988                  162   2e-47   
ref|NP_001254693.1|  eukaryotic translation initiation factor 1A,...    162   3e-47   
emb|CCX32798.1|  Similar to Eukaryotic translation initiation fac...    162   3e-47   
ref|XP_009899092.1|  PREDICTED: eukaryotic translation initiation...    166   3e-47   
ref|XP_004537005.1|  PREDICTED: eukaryotic translation initiation...    162   3e-47   
gb|KIK10284.1|  hypothetical protein K443DRAFT_670912                   162   3e-47   
ref|XP_007299932.1|  nucleic acid-binding protein                       162   3e-47   
gb|KIY66753.1|  nucleic acid-binding protein                            162   3e-47   
ref|XP_007263395.1|  nucleic acid-binding protein                       162   3e-47   
gb|KIJ66728.1|  hypothetical protein HYDPIDRAFT_85083                   162   3e-47   
ref|XP_009892791.1|  PREDICTED: eukaryotic translation initiation...    164   3e-47   
ref|XP_002193060.2|  PREDICTED: eukaryotic translation initiation...    165   3e-47   
ref|XP_009088031.1|  PREDICTED: eukaryotic translation initiation...    163   4e-47   
ref|XP_008694701.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    163   4e-47   
ref|XP_002470537.1|  eukaryotic translation initiation factor 1A        162   4e-47   
dbj|GAA93780.1|  hypothetical protein E5Q_00426                         162   4e-47   
ref|XP_008589032.1|  PREDICTED: eukaryotic translation initiation...    162   4e-47   
ref|XP_007393724.1|  hypothetical protein PHACADRAFT_252709             162   4e-47   
ref|XP_011115032.1|  hypothetical protein H072_9467                     162   4e-47   
ref|NP_001230147.1|  eukaryotic translation initiation factor 1A,...    162   4e-47   
gb|AAC51834.1|  eIF-1A, Y isoform                                       162   4e-47   
ref|XP_003388478.1|  PREDICTED: eukaryotic translation initiation...    162   4e-47   
pdb|3ZJY|C  Chain C, Crystal Structure Of Importin 13 - Rangtp - ...    160   4e-47   
emb|CDR95986.1|  translation initiation factor eIF-1A, putative         162   5e-47   
gb|KIK62377.1|  hypothetical protein GYMLUDRAFT_72615                   161   5e-47   
ref|XP_008505199.1|  PREDICTED: eukaryotic translation initiation...    162   5e-47   
ref|XP_001880968.1|  predicted protein                                  161   5e-47   
gb|EMD33914.1|  hypothetical protein CERSUDRAFT_86691                   162   5e-47   
gb|EFB28533.1|  hypothetical protein PANDA_001825                       160   5e-47   
gb|AEE61631.1|  unknown                                                 162   5e-47   
ref|XP_006168939.1|  PREDICTED: eukaryotic translation initiation...    163   5e-47   
ref|XP_003032336.1|  hypothetical protein SCHCODRAFT_68157              161   6e-47   
ref|XP_005592626.1|  PREDICTED: eukaryotic translation initiation...    161   6e-47   
gb|KFY69847.1|  hypothetical protein V499_09695                         162   6e-47   
ref|XP_004829491.1|  translation initiation factor eIF-1A, putative     162   6e-47   
gb|KFY60196.1|  hypothetical protein V496_05424                         162   6e-47   
ref|XP_011402252.1|  Eukaryotic translation initiation factor 1A,...    161   6e-47   
dbj|GAM89627.1|  hypothetical protein ANO11243_076660                   161   7e-47   
ref|XP_002479818.1|  eukaryotic translation initiation factor eIF...    161   7e-47   
gb|KFY84075.1|  hypothetical protein V500_09630                         162   7e-47   
gb|KFM82898.1|  Eukaryotic translation initiation factor 1A, X-ch...    161   8e-47   
ref|XP_009777691.1|  PREDICTED: eukaryotic translation initiation...    160   8e-47   
gb|KIM84114.1|  hypothetical protein PILCRDRAFT_818423                  161   8e-47   
ref|XP_005183655.1|  PREDICTED: eukaryotic translation initiation...    161   8e-47   
emb|CDW60214.1|  eIF-1a domain containing protein                       161   9e-47   
gb|KDQ57004.1|  hypothetical protein JAAARDRAFT_131116                  160   9e-47   
gb|ELR04552.1|  hypothetical protein GMDG_06842                         161   9e-47   
gb|KDQ24622.1|  hypothetical protein PLEOSDRAFT_1078690                 160   1e-46   
ref|XP_007869111.1|  nucleic acid-binding protein                       161   1e-46   
ref|XP_002143498.1|  eukaryotic translation initiation factor eIF...    161   1e-46   
ref|XP_007508441.1|  Eukaryotic translation initiation factor 1A,...    160   1e-46   
gb|AGH70145.1|  eukaryotic translation initiation factor 1A             161   1e-46   
ref|XP_009262952.1|  hypothetical protein FPSE_11560                    161   1e-46   
gb|KGQ06664.1|  Eukaryotic translation initiation factor 1A, Y-ch...    162   1e-46   
ref|XP_008601072.1|  eukaryotic translation initiation factor eIF-1A    162   1e-46   
ref|XP_011320087.1|  eukaryotic translation initiation factor 1A        161   1e-46   
gb|KIK90463.1|  hypothetical protein PAXRUDRAFT_831698                  160   1e-46   
ref|XP_010393019.1|  PREDICTED: eukaryotic translation initiation...    162   1e-46   
gb|EGU76111.1|  hypothetical protein FOXB_13357                         161   1e-46   
gb|KHN84950.1|  Eukaryotic translation initiation factor 1A, Y-ch...    162   1e-46   
ref|XP_007781793.1|  hypothetical protein W97_05574                     161   1e-46   
ref|XP_003852012.1|  hypothetical protein MYCGRDRAFT_58554              161   1e-46   
gb|EPY79170.1|  eukaryotic translation initiation factor 1A, Y-ch...    161   1e-46   
gb|KIJ14230.1|  hypothetical protein PAXINDRAFT_163418                  160   1e-46   
gb|KEZ39289.1|  hypothetical protein SAPIO_CDS9967                      161   1e-46   
gb|EWG38977.1|  translation initiation factor 1A                        161   1e-46   
gb|KDQ16192.1|  hypothetical protein BOTBODRAFT_107390                  160   1e-46   
emb|CDX84314.1|  BnaC04g10760D                                          160   1e-46   
gb|EHB01817.1|  Eukaryotic translation initiation factor 1A, X-ch...    160   2e-46   
gb|ERE65852.1|  ribosomal protein S6 kinase alpha-3                     173   2e-46   
gb|EPS28443.1|  hypothetical protein PDE_03389                          160   2e-46   
gb|KIK25052.1|  hypothetical protein PISMIDRAFT_677598                  160   2e-46   
ref|XP_002894268.1|  hypothetical protein ARALYDRAFT_892005             160   2e-46   
ref|XP_005374457.1|  PREDICTED: eukaryotic translation initiation...    160   2e-46   
gb|EMC89229.1|  Eukaryotic translation initiation factor 1A, Y-ch...    159   2e-46   
ref|XP_003053195.1|  predicted protein                                  160   2e-46   
gb|KIV85083.1|  eukaryotic translation initiation factor 1A, Y-ch...    160   2e-46   
gb|ACO14998.1|  Eukaryotic translation initiation factor 1A, X-ch...    160   2e-46   
dbj|BAB31727.1|  unnamed protein product                                160   2e-46   
gb|KFY12917.1|  hypothetical protein V492_03583                         160   2e-46   
gb|EDL02959.1|  mCG1027823                                              159   2e-46   
gb|KIW57538.1|  eukaryotic translation initiation factor 1A, Y-ch...    160   2e-46   
ref|XP_007318574.1|  hypothetical protein SERLADRAFT_369808             160   2e-46   
gb|KFH43315.1|  Eukaryotic translation initiation factor 1A, X-ch...    160   2e-46   
gb|KIM22967.1|  hypothetical protein M408DRAFT_332635                   160   2e-46   
gb|KFX99844.1|  hypothetical protein V490_01621                         160   2e-46   
emb|CEJ91242.1|  Putative Translation initiation factor 1A (EIF-1A)     160   2e-46   
ref|XP_001257440.1|  eukaryotic translation initiation factor eIF...    160   2e-46   
gb|KIN01495.1|  hypothetical protein OIDMADRAFT_123146                  160   3e-46   
ref|XP_006415301.1|  hypothetical protein EUTSA_v10009359mg             159   3e-46   
ref|XP_008085857.1|  Nucleic acid-binding protein                       160   3e-46   
gb|KIJ52359.1|  hypothetical protein M422DRAFT_25976                    160   3e-46   
ref|XP_005151620.1|  PREDICTED: uncharacterized protein LOC101872088    165   3e-46   
gb|KFO55750.1|  Eukaryotic translation initiation factor 1A, Y-ch...    158   3e-46   
ref|XP_001270279.1|  eukaryotic translation initiation factor eIF...    160   3e-46   
gb|ACO10897.1|  Eukaryotic translation initiation factor 1A, X-ch...    160   3e-46   
gb|ESZ91473.1|  eukaryotic translation initiation factor 1A             160   4e-46   
gb|KFA64033.1|  hypothetical protein S40285_04207                       160   4e-46   
ref|XP_010971037.1|  PREDICTED: eukaryotic translation initiation...    159   4e-46   
gb|KEY68643.1|  hypothetical protein S7711_00522                        160   4e-46   
ref|XP_003785338.1|  PREDICTED: eukaryotic translation initiation...    159   4e-46   
gb|ACO12376.1|  Eukaryotic translation initiation factor 1A, X-ch...    159   4e-46   
ref|XP_009143772.1|  PREDICTED: eukaryotic translation initiation...    159   4e-46   
ref|XP_005850007.1|  hypothetical protein CHLNCDRAFT_141952             160   4e-46   
ref|XP_007755882.1|  translation initiation factor 1A                   159   4e-46   
gb|ELK12899.1|  MAP7 domain-containing protein 2                        171   4e-46   
ref|XP_001936044.1|  eukaryotic translation initiation factor 1A        160   4e-46   
ref|XP_008021422.1|  hypothetical protein SETTUDRAFT_166591             159   5e-46   
ref|XP_007700089.1|  hypothetical protein COCSADRAFT_160466             159   5e-46   
gb|KIL67507.1|  hypothetical protein M378DRAFT_159323                   159   5e-46   
ref|XP_010992968.1|  PREDICTED: eukaryotic translation initiation...    159   5e-46   
ref|XP_007840901.1|  Eukaryotic translation initiation factor 1A        159   5e-46   
ref|XP_003329582.1|  eukaryotic translation initiation factor 1A,...    159   5e-46   
ref|NP_001116134.1|  uncharacterized protein LOC100039042               159   5e-46   
ref|XP_007731623.1|  translation initiation factor 1A                   159   5e-46   
gb|KIP08249.1|  hypothetical protein PHLGIDRAFT_23662                   159   6e-46   
gb|KIL89694.1|  translation initiation factor 1a                        159   6e-46   
ref|XP_001546375.1|  eukaryotic translation initiation factor eIF-1A    159   6e-46   
gb|EYE96947.1|  eukaryotic translation initiation factor 1A             159   6e-46   
ref|XP_007738833.1|  translation initiation factor 1A                   159   6e-46   
ref|XP_007727338.1|  translation initiation factor 1A                   159   6e-46   
gb|KIW71734.1|  eukaryotic translation initiation factor 1A, Y-ch...    159   6e-46   
ref|XP_009157776.1|  translation initiation factor eIF-1A               159   6e-46   
dbj|GAM39753.1|  eukaryotic translation initiation factor               159   6e-46   
ref|NP_001171036.1|  eukaryotic translation initiation factor 1A-...    159   6e-46   
gb|KDN52566.1|  nucleic acid-binding protein                            159   6e-46   
ref|XP_007806177.1|  Eukaryotic translation initiation factor 1A        159   7e-46   
gb|KFO24991.1|  Ribosomal protein S6 kinase alpha-3                     171   7e-46   
gb|KFY29456.1|  hypothetical protein V493_02348                         159   7e-46   
gb|EDL02958.1|  mCG118780                                               159   7e-46   
ref|XP_001594171.1|  translation initiation factor 1A                   159   8e-46   
gb|EFX73236.1|  hypothetical protein DAPPUDRAFT_307936                  159   8e-46   
gb|EHA25495.1|  hypothetical protein ASPNIDRAFT_127827                  158   8e-46   
ref|XP_001823893.1|  eukaryotic translation initiation factor 1A,...    159   8e-46   
ref|XP_001545154.1|  hypothetical protein BC1G_16340                    158   9e-46   
ref|XP_001395841.1|  eukaryotic translation initiation factor 1A,...    159   9e-46   
ref|XP_744943.1|  translation initiation factor eIF-1A                  159   9e-46   
ref|XP_001209887.1|  eukaryotic translation initiation factor 1A        159   9e-46   
ref|NP_001013846.1|  Eif1a-like                                         158   9e-46   
gb|KEY76456.1|  eukaryotic translation initiation factor eIF 1A s...    159   9e-46   
ref|XP_747826.1|  eukaryotic translation initiation factor eIF-1A...    159   1e-45   
gb|EMP25664.1|  Ribosomal protein S6 kinase alpha-3                     170   1e-45   
gb|EKV10045.1|  Eukaryotic translation initiation factor eIF-1A s...    158   1e-45   
gb|KGO68136.1|  Translation initiation factor 1A (eIF-1A)               158   1e-45   
tpe|CBF78183.1|  TPA: eukaryotic translation initiation factor eI...    158   1e-45   
ref|XP_002566277.1|  Pc22g23860                                         158   1e-45   
gb|KID89452.1|  Translation initiation factor 1A (eIF-1A)               159   1e-45   
gb|EGI62645.1|  Eukaryotic translation initiation factor 1A, X-ch...    166   1e-45   
sp|P47814.2|IF1A_RABIT  RecName: Full=Eukaryotic translation init...    158   1e-45   
emb|CDR11953.1|  translation initiation factor eIF-1A, putative         159   1e-45   
gb|KHJ36206.1|  putative eukaryotic translation initiation factor 1a    159   1e-45   
gb|EME48436.1|  hypothetical protein DOTSEDRAFT_67474                   158   1e-45   
gb|KIV90866.1|  eukaryotic translation initiation factor 1A, Y-ch...    158   1e-45   
ref|XP_009195139.1|  PREDICTED: LOW QUALITY PROTEIN: eukaryotic t...    158   1e-45   
gb|KIO14958.1|  hypothetical protein M404DRAFT_11738                    158   1e-45   
gb|ACO12041.1|  Eukaryotic translation initiation factor 1A, X-ch...    158   1e-45   
ref|XP_006544793.1|  PREDICTED: eukaryotic translation initiation...    158   1e-45   
gb|ESA21367.1|  hypothetical protein GLOINDRAFT_121583                  157   1e-45   
emb|CDQ08234.1|  Protein Bm12573                                        157   1e-45   
ref|XP_002545003.1|  eukaryotic translation initiation factor 1A        158   1e-45   
ref|XP_003177271.1|  hypothetical protein MGYG_01352                    158   1e-45   
ref|XP_009143773.1|  PREDICTED: eukaryotic translation initiation...    158   1e-45   
gb|EMS21711.1|  translation initiation factor eIF-1A                    158   1e-45   
gb|KHN98769.1|  Translation initiation factor 1A (eIF-1A)               158   1e-45   
emb|CDY28133.1|  BnaC06g03140D                                          158   1e-45   
ref|XP_006459115.1|  hypothetical protein AGABI2DRAFT_141737            158   1e-45   



>ref|XP_008229835.1| PREDICTED: eukaryotic translation initiation factor 1A [Prunus 
mume]
Length=145

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_002279938.1| PREDICTED: eukaryotic translation initiation factor 1A [Vitis 
vinifera]
 ref|XP_002285844.1| PREDICTED: eukaryotic translation initiation factor 1A [Vitis 
vinifera]
 emb|CAN73005.1| hypothetical protein VITISV_021007 [Vitis vinifera]
 emb|CAN70425.1| hypothetical protein VITISV_033730 [Vitis vinifera]
Length=145

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_010046096.1| PREDICTED: eukaryotic translation initiation factor 1A [Eucalyptus 
grandis]
 ref|XP_010046102.1| PREDICTED: eukaryotic translation initiation factor 1A [Eucalyptus 
grandis]
 gb|KCW88726.1| hypothetical protein EUGRSUZ_A01082 [Eucalyptus grandis]
Length=145

 Score =   217 bits (552),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_010050042.1| PREDICTED: eukaryotic translation initiation factor 1A [Eucalyptus 
grandis]
 gb|KCW82877.1| hypothetical protein EUGRSUZ_C04245 [Eucalyptus grandis]
Length=145

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 123/123 (100%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|KDP30840.1| hypothetical protein JCGZ_13783 [Jatropha curcas]
Length=145

 Score =   216 bits (551),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_008342155.1| PREDICTED: eukaryotic translation initiation factor 1A [Malus 
domestica]
 ref|XP_008342156.1| PREDICTED: eukaryotic translation initiation factor 1A [Malus 
domestica]
 ref|XP_008353593.1| PREDICTED: eukaryotic translation initiation factor 1A [Malus 
domestica]
 ref|XP_009365161.1| PREDICTED: eukaryotic translation initiation factor 1A [Pyrus 
x bretschneideri]
Length=146

 Score =   216 bits (550),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_002320498.1| translation initiation factor eIF-1A family protein [Populus 
trichocarpa]
 gb|ABK94036.1| unknown [Populus trichocarpa]
 gb|EEE98813.1| translation initiation factor eIF-1A family protein [Populus 
trichocarpa]
Length=145

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|AFK39830.1| unknown [Lotus japonicus]
Length=145

 Score =   216 bits (550),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_008783155.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Phoenix 
dactylifera]
Length=145

 Score =   216 bits (549),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_009788620.1| PREDICTED: eukaryotic translation initiation factor 1A [Nicotiana 
sylvestris]
Length=145

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIT  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004304062.1| PREDICTED: eukaryotic translation initiation factor 1A [Fragaria 
vesca subsp. vesca]
Length=145

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIT  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|AJA79061.1| eukaryotic translation initiation factor 1Aa [Mangifera indica]
Length=145

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPK KGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKKKGKGGKNRKRGKNEADDEKRELLFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_007051647.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao]
 gb|EOX95804.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao]
Length=145

 Score =   216 bits (549),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_010261458.1| PREDICTED: eukaryotic translation initiation factor 1A [Nelumbo 
nucifera]
Length=145

 Score =   215 bits (547),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_006447686.1| hypothetical protein CICLE_v10017092mg [Citrus clementina]
 ref|XP_006447687.1| hypothetical protein CICLE_v10017092mg [Citrus clementina]
 ref|XP_006469569.1| PREDICTED: eukaryotic translation initiation factor 1A-like isoform 
X1 [Citrus sinensis]
 ref|XP_006469570.1| PREDICTED: eukaryotic translation initiation factor 1A-like isoform 
X2 [Citrus sinensis]
 ref|XP_006469571.1| PREDICTED: eukaryotic translation initiation factor 1A-like isoform 
X3 [Citrus sinensis]
 gb|ESR60926.1| hypothetical protein CICLE_v10017092mg [Citrus clementina]
 gb|ESR60927.1| hypothetical protein CICLE_v10017092mg [Citrus clementina]
 gb|KDO59614.1| hypothetical protein CISIN_1g032195mg [Citrus sinensis]
 gb|KDO59615.1| hypothetical protein CISIN_1g032195mg [Citrus sinensis]
 gb|KDO59616.1| hypothetical protein CISIN_1g032195mg [Citrus sinensis]
 gb|KDO59617.1| hypothetical protein CISIN_1g032195mg [Citrus sinensis]
Length=145

 Score =   215 bits (547),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004240089.1| PREDICTED: eukaryotic translation initiation factor 1A [Solanum 
lycopersicum]
Length=145

 Score =   215 bits (547),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  NGL  123



>ref|XP_010252626.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Nelumbo 
nucifera]
Length=145

 Score =   215 bits (547),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_006856118.1| hypothetical protein AMTR_s00059p00147020 [Amborella trichopoda]
 gb|ERN17585.1| hypothetical protein AMTR_s00059p00147020 [Amborella trichopoda]
Length=145

 Score =   215 bits (547),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_006843145.1| hypothetical protein AMTR_s00146p00027250 [Amborella trichopoda]
 gb|ERN04820.1| hypothetical protein AMTR_s00146p00027250 [Amborella trichopoda]
Length=145

 Score =   215 bits (547),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_010912398.1| PREDICTED: eukaryotic translation initiation factor 1A [Elaeis 
guineensis]
Length=145

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004487629.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cicer 
arietinum]
 ref|XP_004510712.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cicer 
arietinum]
Length=145

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDNTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_002528946.1| eif-1a, putative [Ricinus communis]
 gb|EEF33420.1| eif-1a, putative [Ricinus communis]
Length=145

 Score =   214 bits (546),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_002302848.1| translation initiation factor eIF-1A family protein [Populus 
trichocarpa]
 gb|ABK94631.1| unknown [Populus trichocarpa]
 gb|EEE82121.1| translation initiation factor eIF-1A family protein [Populus 
trichocarpa]
Length=145

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEATCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_009631127.1| PREDICTED: eukaryotic translation initiation factor 1A [Nicotiana 
tomentosiformis]
Length=145

 Score =   214 bits (545),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA GDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIATGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIT  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004144524.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cucumis 
sativus]
 ref|XP_004170918.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cucumis 
sativus]
 ref|XP_008455498.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cucumis 
melo]
 gb|KGN43463.1| hypothetical protein Csa_7G037660 [Cucumis sativus]
Length=145

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            GG+
Sbjct  121  GGM  123



>ref|XP_010915988.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Elaeis 
guineensis]
Length=145

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004147021.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cucumis 
sativus]
 ref|XP_004171800.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Cucumis 
sativus]
 gb|KGN61900.1| hypothetical protein Csa_2G263950 [Cucumis sativus]
Length=145

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_008457652.1| PREDICTED: eukaryotic translation initiation factor 1A [Cucumis 
melo]
 ref|XP_008457653.1| PREDICTED: eukaryotic translation initiation factor 1A [Cucumis 
melo]
Length=145

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_010040579.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Eucalyptus 
grandis]
Length=145

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 122/123 (99%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN GIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNGGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|KJB24602.1| hypothetical protein B456_004G153400 [Gossypium raimondii]
Length=145

 Score =   214 bits (544),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVSRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_010099476.1| Eukaryotic translation initiation factor 1A [Morus notabilis]
 gb|EXB78677.1| Eukaryotic translation initiation factor 1A [Morus notabilis]
Length=145

 Score =   213 bits (543),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEATCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|ADV04051.1| eukaryotic translation initiation factor 1Aa [Hevea brasiliensis]
 gb|ADV04052.1| eukaryotic translation initiation factor 1Ab [Hevea brasiliensis]
Length=145

 Score =   213 bits (542),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 123/123 (100%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_010924898.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Elaeis 
guineensis]
Length=145

 Score =   213 bits (542),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_008808570.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Phoenix 
dactylifera]
Length=145

 Score =   213 bits (542),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|ABK21455.1| unknown [Picea sitchensis]
 gb|ABK21865.1| unknown [Picea sitchensis]
 gb|ABK23660.1| unknown [Picea sitchensis]
 gb|ABK25161.1| unknown [Picea sitchensis]
 gb|ABR17510.1| unknown [Picea sitchensis]
 gb|ABR18388.1| unknown [Picea sitchensis]
 gb|ACN40011.1| unknown [Picea sitchensis]
Length=145

 Score =   213 bits (542),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPENVRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_010925962.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Elaeis 
guineensis]
Length=145

 Score =   213 bits (541),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_011093064.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Sesamum 
indicum]
Length=145

 Score =   212 bits (540),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKG K RKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGVKKRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>emb|CAN77264.1| hypothetical protein VITISV_041156 [Vitis vinifera]
Length=126

 Score =   211 bits (538),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEK+ELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKQELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILV L DYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVSLHDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_006345573.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Solanum 
tuberosum]
Length=145

 Score =   212 bits (540),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLSH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  NGL  123



>ref|XP_010650771.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Vitis 
vinifera]
Length=162

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEK+ELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKQELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILV L DYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVSLHDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_011093318.1| PREDICTED: eukaryotic translation initiation factor 1A [Sesamum 
indicum]
Length=145

 Score =   212 bits (539),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 121/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_004229971.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Solanum 
lycopersicum]
Length=144

 Score =   211 bits (538),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 120/120 (100%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120



>ref|XP_008806275.1| PREDICTED: eukaryotic translation initiation factor 1A [Phoenix 
dactylifera]
Length=145

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELP++TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPDSTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_010270106.1| PREDICTED: eukaryotic translation initiation factor 1A [Nelumbo 
nucifera]
Length=145

 Score =   211 bits (538),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP++TRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDSTRLNEGIA  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_008362314.1| PREDICTED: LOW QUALITY PROTEIN: eukaryotic translation initiation 
factor 1A-like [Malus domestica]
Length=176

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 105/108 (97%), Positives = 106/108 (98%), Gaps = 2/108 (2%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII
Sbjct  46   EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  105

Query  390  LVGLRDY--QDDKADVILKYMPDEARLLKAYGELPENTRLNEGIAGGL  527
            LVGLRDY  QDDKADVILKYMPDEARLLKAYGELPENTRLNEGIAGG+
Sbjct  106  LVGLRDYRSQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIAGGI  153



>ref|NP_001275611.1| eukaryotic translation initiation factor 1A-like [Solanum tuberosum]
 gb|ABB55392.1| putative translation initiation factor eIF-1A-like [Solanum tuberosum]
Length=144

 Score =   211 bits (537),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 119/120 (99%), Positives = 120/120 (100%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120



>gb|KHG13840.1| Eukaryotic translation initiation factor 1A [Gossypium arboreum]
Length=150

 Score =   211 bits (537),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +3

Query  135  VLLASSVIMPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCI  314
            +L      MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCI
Sbjct  1    MLAEQEETMPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCI  60

Query  315  DGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN  494
            DGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN
Sbjct  61   DGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN  120

Query  495  TRLNEGI  515
            TRLNEGI
Sbjct  121  TRLNEGI  127



>ref|XP_007147260.1| hypothetical protein PHAVU_006G109500g [Phaseolus vulgaris]
 gb|ESW19254.1| hypothetical protein PHAVU_006G109500g [Phaseolus vulgaris]
Length=145

 Score =   210 bits (534),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+ TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDTTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_003528819.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Glycine 
max]
Length=145

 Score =   210 bits (534),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP++TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDSTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_003521792.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Glycine 
max]
 ref|XP_003554744.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Glycine 
max]
 gb|KHN35352.1| Eukaryotic translation initiation factor 1A [Glycine soja]
 gb|KHN43128.1| Eukaryotic translation initiation factor 1A [Glycine soja]
Length=145

 Score =   210 bits (534),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+ TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDTTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_007135187.1| hypothetical protein PHAVU_010G108300g [Phaseolus vulgaris]
 gb|ESW07181.1| hypothetical protein PHAVU_010G108300g [Phaseolus vulgaris]
Length=145

 Score =   210 bits (534),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP++TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDSTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>gb|KJB42818.1| hypothetical protein B456_007G168900 [Gossypium raimondii]
 gb|KJB42819.1| hypothetical protein B456_007G168900 [Gossypium raimondii]
 gb|KJB42820.1| hypothetical protein B456_007G168900 [Gossypium raimondii]
Length=142

 Score =   210 bits (534),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  119



>ref|XP_009395770.1| PREDICTED: eukaryotic translation initiation factor 1A [Musa 
acuminata subsp. malaccensis]
Length=144

 Score =   210 bits (534),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVI KYMPDEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVIFKYMPDEARLLKAYGELPENTRLNEGIG  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|AFY13532.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13533.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13534.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13535.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13536.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13537.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13538.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13539.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13540.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13541.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13542.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13543.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AFY13544.1| eukaryotic translation initiation factor 1A [Aeschynomene denticulata]
 gb|AGC95054.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AGC95055.1| eukaryotic translation initiation factor 1A [Aeschynomene evenia]
 gb|AGC95056.1| eukaryotic translation initiation factor 1A [Aeschynomene ciliata]
 gb|AGS78054.1| eukaryotic translation initiation factor 1A [Aeschynomene indica]
 gb|AGS78055.1| eukaryotic translation initiation factor 1A [Aeschynomene indica]
 gb|AGS78056.1| eukaryotic translation initiation factor 1A [Aeschynomene indica]
 gb|AGS78057.1| eukaryotic translation initiation factor 1A [Aeschynomene indica]
 gb|AGS78058.1| eukaryotic translation initiation factor 1A [Aeschynomene indica]
 gb|AGS78059.1| eukaryotic translation initiation factor 1A [Aeschynomene scabra]
 gb|AGS78060.1| eukaryotic translation initiation factor 1A [Aeschynomene rudis]
 gb|AGS78061.1| eukaryotic translation initiation factor 1A [Aeschynomene sensitiva]
 gb|AGS78062.1| eukaryotic translation initiation factor 1A [Aeschynomene sp. 
CPI104040]
 gb|AGS78063.1| eukaryotic translation initiation factor 1A [Aeschynomene filosa]
 gb|AGS78064.1| eukaryotic translation initiation factor 1A [Aeschynomene tambacoundensis]
 gb|AGS78065.1| eukaryotic translation initiation factor 1A [Aeschynomene deamii]
 gb|AGS78066.1| eukaryotic translation initiation factor 1A [Aeschynomene pratensis]
 gb|AGS78067.1| eukaryotic translation initiation factor 1A [Aeschynomene pratensis]
 gb|AGS78068.1| eukaryotic translation initiation factor 1A [Aeschynomene virginica]
 gb|AGS78069.1| eukaryotic translation initiation factor 1A [Aeschynomene virginica]
Length=145

 Score =   209 bits (533),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+ TRLNEG+ 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDTTRLNEGVV  120

Query  519  GGL  527
            G L
Sbjct  121  GAL  123



>gb|KJB07159.1| hypothetical protein B456_001G218400 [Gossypium raimondii]
 gb|KJB07160.1| hypothetical protein B456_001G218400 [Gossypium raimondii]
 gb|KJB07161.1| hypothetical protein B456_001G218400 [Gossypium raimondii]
 gb|KJB07162.1| hypothetical protein B456_001G218400 [Gossypium raimondii]
Length=142

 Score =   209 bits (533),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  119



>ref|XP_007049245.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao]
 gb|EOX93402.1| Nucleic acid-binding, OB-fold-like protein [Theobroma cacao]
Length=142

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  119



>gb|AFK48031.1| unknown [Lotus japonicus]
Length=145

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEATCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELP++TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPDSTRLNEGIG  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_003548603.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Glycine 
max]
Length=145

 Score =   209 bits (532),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+ TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDTTRLNEGID  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>gb|EPS72436.1| hypothetical protein M569_02322 [Genlisea aurea]
Length=145

 Score =   209 bits (531),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAACIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYMPDEARLLKAY ELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYQELPENIRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|AEW08191.1| hypothetical protein 2_2685_01, partial [Pinus radiata]
 gb|AFG43677.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43678.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43679.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43680.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43681.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43682.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43683.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43684.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43685.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43686.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43687.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43688.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43689.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43690.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43691.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43692.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43693.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
 gb|AFG43694.1| hypothetical protein 2_2685_01, partial [Pinus taeda]
Length=128

 Score =   208 bits (529),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+CIDGTKRL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVQRMLGNGRCEALCIDGTKRLGH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENVRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|AAK55703.1|AF378900_1 At2g04520/T1O3.7 [Arabidopsis thaliana]
 gb|AAK96458.1| At2g04520/T1O3.7 [Arabidopsis thaliana]
Length=145

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|NP_178531.1| OB-fold nucleic acid binding domain-containing protein [Arabidopsis 
thaliana]
 gb|AAD25828.1| putative translation initiation factor eIF-1A [Arabidopsis thaliana]
 gb|AAM67230.1| putative translation initiation factor eIF-1A [Arabidopsis thaliana]
 gb|AEC05842.1| OB-fold nucleic acid binding domain-containing protein [Arabidopsis 
thaliana]
Length=145

 Score =   208 bits (530),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>gb|KHG10018.1| Eukaryotic translation initiation factor 1A [Gossypium arboreum]
Length=142

 Score =   208 bits (530),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 118/119 (99%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  119



>gb|KHN27268.1| Eukaryotic translation initiation factor 1A [Glycine soja]
Length=145

 Score =   208 bits (529),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEA LLKAYGELP++TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEASLLKAYGELPDSTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_009124264.1| PREDICTED: eukaryotic translation initiation factor 1A [Brassica 
rapa]
 ref|XP_009124265.1| PREDICTED: eukaryotic translation initiation factor 1A [Brassica 
rapa]
 emb|CDY33683.1| BnaC04g29680D [Brassica napus]
Length=145

 Score =   208 bits (529),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|ABK27099.1| unknown [Picea sitchensis]
Length=145

 Score =   207 bits (528),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+CIDGTKRL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVQRMLGNGRCEALCIDGTKRLGH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENVRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>gb|KHN15977.1| Eukaryotic translation initiation factor 1A [Glycine soja]
Length=145

 Score =   207 bits (528),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 118/123 (96%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEA LLKAYGELP+ TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEASLLKAYGELPDTTRLNEGIG  120

Query  519  GGL  527
             GL
Sbjct  121  AGL  123



>ref|XP_006418569.1| hypothetical protein EUTSA_v10002706mg [Eutrema salsugineum]
 gb|ESQ37005.1| hypothetical protein EUTSA_v10002706mg [Eutrema salsugineum]
Length=145

 Score =   207 bits (528),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE+MCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCESMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_011039356.1| PREDICTED: eukaryotic translation initiation factor 1A [Populus 
euphratica]
 ref|XP_011039357.1| PREDICTED: eukaryotic translation initiation factor 1A [Populus 
euphratica]
 ref|XP_011003496.1| PREDICTED: eukaryotic translation initiation factor 1A [Populus 
euphratica]
 ref|XP_011003497.1| PREDICTED: eukaryotic translation initiation factor 1A [Populus 
euphratica]
Length=145

 Score =   207 bits (527),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEA  EKREL+FKE+GQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEAVVEKRELIFKEEGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_006298759.1| hypothetical protein CARUB_v10014860mg [Capsella rubella]
 gb|EOA31657.1| hypothetical protein CARUB_v10014860mg [Capsella rubella]
Length=145

 Score =   207 bits (527),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|XP_006444904.1| hypothetical protein CICLE_v10022729mg [Citrus clementina]
 ref|XP_006491219.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Citrus 
sinensis]
 gb|ESR58144.1| hypothetical protein CICLE_v10022729mg [Citrus clementina]
 gb|KDO86376.1| hypothetical protein CISIN_1g032228mg [Citrus sinensis]
Length=145

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGAKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWI AGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE TRLNEGIA
Sbjct  61   IRGKMHKKVWIGAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPETTRLNEGIA  120

Query  519  GGL  527
             G+
Sbjct  121  AGI  123



>ref|XP_010557684.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
 ref|XP_010557685.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
 ref|XP_010557687.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
 ref|XP_010557688.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
 ref|XP_010557689.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
Length=145

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 118/121 (98%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>sp|P56331.2|IF1A_ONOVI RecName: Full=Eukaryotic translation initiation factor 1A; Short=eIF-1A; 
AltName: Full=Eukaryotic translation initiation 
factor 4C; Short=eIF-4C [Onobrychis viciifolia]
 gb|AAB81996.1| eukaryotic translation initiation factor eIF-1A [Onobrychis viciifolia]
Length=145

 Score =   207 bits (526),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 120/124 (97%), Positives = 122/124 (98%), Gaps = 1/124 (1%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI-  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILK MPDEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKLMPDEARLLKAYGELPDNTRLNEGIG  120

Query  516  AGGL  527
            AGGL
Sbjct  121  AGGL  124



>ref|XP_009386642.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Musa 
acuminata subsp. malaccensis]
 gb|AEV89262.1| translation initiation factor 1A [Musa acuminata AAA Group]
Length=144

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCE MCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCETMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVI KYMPDEARLLKAYGELPEN RLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVIFKYMPDEARLLKAYGELPENIRLNEGIG  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_010435457.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Camelina 
sativa]
Length=145

 Score =   206 bits (525),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA+GDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIASGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|XP_010450406.1| PREDICTED: eukaryotic translation initiation factor 1A [Camelina 
sativa]
Length=145

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 119/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|KJB49471.1| hypothetical protein B456_008G123000 [Gossypium raimondii]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV+RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVIRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVI+KYMPDEARLLKAYGELPE TRLNEG+A
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVIMKYMPDEARLLKAYGELPETTRLNEGVA  120



>ref|XP_009136137.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Brassica 
rapa]
 emb|CDX93052.1| BnaA03g37740D [Brassica napus]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE MCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCECMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|EYU32199.1| hypothetical protein MIMGU_mgv1a015795mg [Erythranthe guttata]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCE MCIDG KRL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCETMCIDGVKRLGH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA+GDI+LVGLRDYQDDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKKVWIASGDIVLVGLRDYQDDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  120

Query  519  GGL  527
            GGL
Sbjct  121  GGL  123



>ref|XP_006395950.1| hypothetical protein EUTSA_v10005086mg [Eutrema salsugineum]
 gb|ESQ33236.1| hypothetical protein EUTSA_v10005086mg [Eutrema salsugineum]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>emb|CDY15065.1| BnaC03g44260D [Brassica napus]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE MCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCECMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>emb|CDY15062.1| BnaC03g44230D [Brassica napus]
Length=145

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE MCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCECMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_010556581.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
Length=151

 Score =   206 bits (524),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 99/103 (96%), Positives = 102/103 (99%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII
Sbjct  24   EADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  83

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            LVGLRD+QDDKADVILKYMPDEARLLKAYGELP+N RLNEGIA
Sbjct  84   LVGLRDFQDDKADVILKYMPDEARLLKAYGELPDNVRLNEGIA  126



>ref|XP_002885759.1| hypothetical protein ARALYDRAFT_899257 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH62018.1| hypothetical protein ARALYDRAFT_899257 [Arabidopsis lyrata subsp. 
lyrata]
Length=145

 Score =   206 bits (523),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 118/119 (99%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGI  119



>ref|XP_009394126.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Musa 
acuminata subsp. malaccensis]
Length=144

 Score =   206 bits (523),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 117/121 (97%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCE MCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCETMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVI KYMPDEARLLKAYGELPEN RLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVIFKYMPDEARLLKAYGELPENIRLNEGIG  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_009410820.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Musa 
acuminata subsp. malaccensis]
Length=144

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIIL+GLRDYQDDKADVI KYMPDEARLLKAYGELPEN RLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILLGLRDYQDDKADVIFKYMPDEARLLKAYGELPENIRLNEGIG  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_010440750.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Camelina 
sativa]
Length=145

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVQRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>emb|CDY00869.1| BnaCnng00690D [Brassica napus]
Length=145

 Score =   205 bits (522),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/123 (95%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE MCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCECMCIDGNKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|XP_010533003.1| PREDICTED: eukaryotic translation initiation factor 1A [Tarenaya 
hassleriana]
Length=145

 Score =   205 bits (522),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 117/121 (97%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_009102383.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Brassica 
rapa]
 emb|CDY27865.1| BnaA07g04550D [Brassica napus]
Length=145

 Score =   205 bits (521),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCE MCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCECMCIDGNKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|XP_010488695.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Camelina 
sativa]
 ref|XP_010488697.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Camelina 
sativa]
Length=145

 Score =   205 bits (521),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVQRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  GGL  527
            G  
Sbjct  121  GDF  123



>ref|XP_009614367.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Nicotiana 
tomentosiformis]
 ref|XP_009772584.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Nicotiana 
sylvestris]
Length=143

 Score =   204 bits (520),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 116/117 (99%), Positives = 117/117 (100%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILK+MPDEARLLKAYGELPENTRLNE
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKFMPDEARLLKAYGELPENTRLNE  117



>ref|XP_010514569.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Camelina 
sativa]
Length=145

 Score =   204 bits (520),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVQRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_010542007.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
 ref|XP_010542008.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Tarenaya 
hassleriana]
Length=145

 Score =   204 bits (519),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 118/121 (98%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRD+QDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDFQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|EYU38916.1| hypothetical protein MIMGU_mgv1a015832mg [Erythranthe guttata]
Length=144

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/121 (96%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA CIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVTRMLGNGRCEATCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPE TRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPETTRLNEGIG  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|KJB22692.1| hypothetical protein B456_004G061900 [Gossypium raimondii]
Length=142

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/119 (97%), Positives = 117/119 (98%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELV KEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVLKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            +RGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGI
Sbjct  61   VRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENIRLNEGI  119



>ref|XP_002870440.1| hypothetical protein ARALYDRAFT_915692 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46699.1| hypothetical protein ARALYDRAFT_915692 [Arabidopsis lyrata subsp. 
lyrata]
Length=145

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRC+ MCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCDVMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>ref|XP_010382934.1| PREDICTED: eukaryotic translation initiation factor 1A [Rhinopithecus 
roxellana]
Length=143

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/120 (97%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAQCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENVRLNEGIT  120



>ref|XP_006282752.1| hypothetical protein CARUB_v10005971mg [Capsella rubella]
 gb|EOA15650.1| hypothetical protein CARUB_v10005971mg [Capsella rubella]
Length=145

 Score =   204 bits (518),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 116/123 (94%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRC+ MCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCDVMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGIV  120

Query  519  GGL  527
            G L
Sbjct  121  GDL  123



>gb|ACH63231.1| translation initiation factor [Rheum australe]
Length=144

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 99/103 (96%), Positives = 100/103 (97%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CID TKRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVFKEDGQEYAQVLRMLGNGRCEATCIDNTKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            LVGLRDYQDDKADVILKYMPDEARLLKAYGELP+N RLNEGIA
Sbjct  78   LVGLRDYQDDKADVILKYMPDEARLLKAYGELPDNIRLNEGIA  120



>gb|AHF21586.1| translation initiation factor 1A [Tamarix hispida]
Length=143

 Score =   203 bits (517),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/120 (96%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEA CIDG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAQCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPEN RLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENVRLNEGIT  120



>gb|KFK35344.1| hypothetical protein AALP_AA5G272400 [Arabis alpina]
Length=146

 Score =   203 bits (517),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 112/123 (91%), Positives = 120/123 (98%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRCEAMCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCEAMCIDGIKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWI+ GDI+LVGLRD+QDDKAD+ILK+MPDEARLLKAYGELP+N RLNEGIA
Sbjct  61   IRGKMHKKVWISGGDIVLVGLRDFQDDKADIILKFMPDEARLLKAYGELPDNVRLNEGIA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGV  123



>ref|XP_010467002.1| PREDICTED: eukaryotic translation initiation factor 1A [Camelina 
sativa]
Length=145

 Score =   203 bits (516),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/123 (93%), Positives = 118/123 (96%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDE+REL+FKEDGQEYAQV RMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEERELIFKEDGQEYAQVQRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTRLNEGI 
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMSDEARLLKAYGELPDNTRLNEGIV  120

Query  519  GGL  527
            G  
Sbjct  121  GDF  123



>emb|CDP13774.1| unnamed protein product [Coffea canephora]
Length=146

 Score =   202 bits (515),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 115/121 (95%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCID  KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDQNKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWI  GDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+N RLNEGIA
Sbjct  61   IRGKMHKKVWITTGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDNVRLNEGIA  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|NP_001190425.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 gb|AED94002.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
Length=150

 Score =   202 bits (515),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKREL+FKEDGQEYAQVLRMLGNGRC+ MCIDG KRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELIFKEDGQEYAQVLRMLGNGRCDVMCIDGVKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEGI
Sbjct  78   LVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGI  119



>ref|XP_001752588.1| predicted protein [Physcomitrella patens]
 ref|XP_001752667.1| predicted protein [Physcomitrella patens]
 gb|EDQ82459.1| predicted protein [Physcomitrella patens]
 gb|EDQ82538.1| predicted protein [Physcomitrella patens]
Length=145

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEA+DEKRELVFKEDGQEYAQVLRMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEAEDEKRELVFKEDGQEYAQVLRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA+GDIILVGLRDYQDDKADVILKY PDEARLLKAY ELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIASGDIILVGLRDYQDDKADVILKYQPDEARLLKAYSELPENVRLNEGIA  120



>ref|XP_001781809.1| predicted protein [Physcomitrella patens]
 ref|XP_001781837.1| predicted protein [Physcomitrella patens]
 gb|EDQ53363.1| predicted protein [Physcomitrella patens]
 gb|EDQ53391.1| predicted protein [Physcomitrella patens]
Length=145

 Score =   201 bits (512),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 114/120 (95%), Positives = 117/120 (98%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEA+DEKRELVFKEDGQEYAQVLRMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEAEDEKRELVFKEDGQEYAQVLRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA+GDIILVGLRDYQDDKADVILKY PDEARLLKAY ELPEN RLNEGIA
Sbjct  61   IRGKMHKKVWIASGDIILVGLRDYQDDKADVILKYQPDEARLLKAYSELPENVRLNEGIA  120



>gb|KDP28534.1| hypothetical protein JCGZ_14305 [Jatropha curcas]
Length=145

 Score =   201 bits (512),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 115/123 (93%), Positives = 119/123 (97%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDG+KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGSKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAY ELP+N RLNE +A
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMADEARLLKAYSELPDNMRLNEVMA  120

Query  519  GGL  527
            GG+
Sbjct  121  GGI  123



>ref|XP_004302969.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Fragaria 
vesca subsp. vesca]
Length=143

 Score =   201 bits (510),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/102 (95%), Positives = 99/102 (97%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMC+D  KRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCMDAIKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNEG+
Sbjct  78   LVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNEGV  119



>ref|XP_010669534.1| PREDICTED: eukaryotic translation initiation factor 1A [Beta 
vulgaris subsp. vulgaris]
Length=144

 Score =   200 bits (508),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 113/121 (93%), Positives = 116/121 (96%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV+RMLGNGRCEA CID  KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVVRMLGNGRCEATCIDNVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELP+N RLNEG+A
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPDNIRLNEGVA  120

Query  519  G  521
             
Sbjct  121  N  121



>ref|XP_002451991.1| hypothetical protein SORBIDRAFT_04g012700 [Sorghum bicolor]
 gb|EES04967.1| hypothetical protein SORBIDRAFT_04g012700 [Sorghum bicolor]
Length=142

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVTRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGE+P+N RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGEIPDNVRLNEGV  119



>gb|AFW70845.1| hypothetical protein ZEAMMB73_520716 [Zea mays]
Length=142

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVTRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGE+P+N RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGEIPDNVRLNEGV  119



>ref|XP_004952302.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Setaria 
italica]
Length=142

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 111/119 (93%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVTRMLGNGRCEALCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGE+P+N RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGEIPDNVRLNEGV  119



>ref|XP_002961688.1| hypothetical protein SELMODRAFT_165058 [Selaginella moellendorffii]
 ref|XP_002964754.1| hypothetical protein SELMODRAFT_266826 [Selaginella moellendorffii]
 gb|EFJ33592.1| hypothetical protein SELMODRAFT_266826 [Selaginella moellendorffii]
 gb|EFJ36948.1| hypothetical protein SELMODRAFT_165058 [Selaginella moellendorffii]
Length=144

 Score =   198 bits (504),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 112/120 (93%), Positives = 116/120 (97%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV+RMLGNGRCE+MCIDG KR+CH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVIRMLGNGRCESMCIDGIKRMCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKY PDEARLLKAY ELP+N RLNEGIA
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYQPDEARLLKAYNELPDNIRLNEGIA  120



>emb|CAC80989.1| translation initiation factor (eIF-1A) [Beta vulgaris]
Length=144

 Score =   198 bits (503),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/103 (93%), Positives = 99/103 (96%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQV+RMLGNGRCEA CID  KRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVFKEDGQEYAQVVRMLGNGRCEATCIDYVKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            LVGLRDYQDDKADVILKYMPDEARLLKAYGELP+N RLNEG+A
Sbjct  78   LVGLRDYQDDKADVILKYMPDEARLLKAYGELPDNIRLNEGVA  120



>ref|NP_198418.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 ref|NP_851095.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 dbj|BAB09265.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAK68729.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM10261.1| unknown protein [Arabidopsis thaliana]
 gb|AAM61169.1| putative translation initiation factor eIF-1A [Arabidopsis thaliana]
 gb|AED94000.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
 gb|AED94001.1| Nucleic acid-binding, OB-fold-like protein [Arabidopsis thaliana]
Length=145

 Score =   197 bits (500),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 112/117 (96%), Positives = 114/117 (97%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQVLRMLGNGRC+ MCIDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVLRMLGNGRCDVMCIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELPENTRLNE
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMSDEARLLKAYGELPENTRLNE  117



>ref|XP_009789091.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Nicotiana 
sylvestris]
Length=144

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 111/123 (90%), Positives = 115/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KREL+FKEDGQEYAQV RMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELIFKEDGQEYAQVQRMLGNGRCEAQCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKKVWIA  DIILVGLRDYQDDKADVILKYMPDEARLLKAY ELP+N RLNEG+ 
Sbjct  61   IRGKMHKKVWIAVDDIILVGLRDYQDDKADVILKYMPDEARLLKAYKELPDNIRLNEGLG  120

Query  519  GGL  527
            GG 
Sbjct  121  GGF  123



>gb|AFK38613.1| unknown [Medicago truncatula]
Length=147

 Score =   196 bits (498),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 95/99 (96%), Positives = 97/99 (98%), Gaps = 0/99 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN  506
            LVGLRDYQDDKADVILKYMPDEARLLKAY ELP++ RLN
Sbjct  78   LVGLRDYQDDKADVILKYMPDEARLLKAYSELPDSVRLN  116



>ref|XP_006358649.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Solanum 
tuberosum]
Length=144

 Score =   196 bits (497),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDE+REL+FKEDGQEYAQ+ RMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDERRELIFKEDGQEYAQIQRMLGNGRCEAACIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWI+AGDI+L+GLRD+QDDKADVILKYMPDEARLLKAYGELPEN RLNEG+
Sbjct  61   IRGKMHKKVWISAGDIVLLGLRDFQDDKADVILKYMPDEARLLKAYGELPENIRLNEGV  119



>ref|XP_006647192.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Oryza 
brachyantha]
Length=142

 Score =   195 bits (495),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 116/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGE+P++ RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGEIPDHVRLNEGV  119



>ref|XP_009625046.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Nicotiana 
tomentosiformis]
Length=144

 Score =   195 bits (495),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/106 (89%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKREL+FKEDGQEYAQV RMLGNGRCEA CIDGTKRLCHIRGKMHKKVWIA  DII
Sbjct  18   EADDEKRELIFKEDGQEYAQVQRMLGNGRCEAQCIDGTKRLCHIRGKMHKKVWIAVDDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIAGGL  527
            LVGLRDYQDDKADVILKYMPDEARLLKAY ELP+N RLNEG+  G 
Sbjct  78   LVGLRDYQDDKADVILKYMPDEARLLKAYKELPDNIRLNEGLGAGF  123



>ref|NP_001046619.1| Os02g0300700 [Oryza sativa Japonica Group]
 emb|CAD91550.1| eukaryotic translation initiation factor 1A [Oryza sativa Japonica 
Group]
 dbj|BAD23366.1| eukaryotic translation initiation factor 1A [Oryza sativa Japonica 
Group]
 dbj|BAD23331.1| eukaryotic translation initiation factor 1A [Oryza sativa Japonica 
Group]
 dbj|BAF08533.1| Os02g0300700 [Oryza sativa Japonica Group]
 gb|EAY85480.1| hypothetical protein OsI_06857 [Oryza sativa Indica Group]
 gb|EAZ22697.1| hypothetical protein OsJ_06368 [Oryza sativa Japonica Group]
 dbj|BAG91393.1| unnamed protein product [Oryza sativa Japonica Group]
Length=142

 Score =   195 bits (495),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQV RMLGNGRCEA CIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVARMLGNGRCEAQCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGE+P++ RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGEIPDHVRLNEGV  119



>sp|P47815.2|IF1A_WHEAT RecName: Full=Eukaryotic translation initiation factor 1A; Short=eIF-1A; 
AltName: Full=Eukaryotic translation initiation 
factor 4C; Short=eIF-4C [Triticum aestivum]
Length=144

 Score =   194 bits (494),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTVRLNEGV  119



>pir||A53045 translation initiation factor eIF-1A - wheat (fragment)
Length=143

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 92/102 (90%), Positives = 98/102 (96%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCHIRGKMHKKVWIAAGDI+
Sbjct  17   EADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCHIRGKMHKKVWIAAGDIV  76

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  77   LVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTVRLNEGV  118



>ref|XP_002437817.1| hypothetical protein SORBIDRAFT_10g003120 [Sorghum bicolor]
 ref|XP_004965447.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Setaria 
italica]
 gb|EER89184.1| hypothetical protein SORBIDRAFT_10g003120 [Sorghum bicolor]
 gb|AGT16689.1| hypothetical protein SHCRBa_013_P09_R_180 [Saccharum hybrid cultivar 
R570]
Length=144

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGT+RLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTRRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPE  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPETLRLNEGV  119



>ref|NP_001057571.1| Os06g0342200 [Oryza sativa Japonica Group]
 emb|CAD91551.1| eukaryotic translation initiation factor 1A [Oryza sativa Japonica 
Group]
 dbj|BAD61630.1| putative eukaryotic translation initiation factor 1A [Oryza sativa 
Japonica Group]
 dbj|BAF19485.1| Os06g0342200 [Oryza sativa Japonica Group]
 gb|EAZ00825.1| hypothetical protein OsI_22855 [Oryza sativa Indica Group]
 gb|EAZ36902.1| hypothetical protein OsJ_21246 [Oryza sativa Japonica Group]
 dbj|BAG94130.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG99745.1| unnamed protein product [Oryza sativa Japonica Group]
Length=144

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 110/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTLRLNEGV  119



>ref|XP_003637206.1| Eukaryotic translation initiation factor 1A [Medicago truncatula]
 gb|KEH18739.1| eukaryotic translation initiation factor 1A-like protein [Medicago 
truncatula]
Length=146

 Score =   194 bits (492),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 94/98 (96%), Positives = 96/98 (98%), Gaps = 0/98 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRL  503
            LVGLRDYQDDKADVILKYMPDEARLLKAY ELP++ RL
Sbjct  78   LVGLRDYQDDKADVILKYMPDEARLLKAYSELPDSVRL  115



>ref|XP_003563824.1| PREDICTED: eukaryotic translation initiation factor 1A [Brachypodium 
distachyon]
Length=144

 Score =   194 bits (492),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTLRLNEGV  119



>gb|ADI47121.1| eukaryotic translation initiation factor 1A [Leymus chinensis]
 dbj|BAJ94425.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88288.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04646.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS65893.1| Eukaryotic translation initiation factor 1A [Triticum urartu]
Length=144

 Score =   194 bits (492),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTLRLNEGV  119



>ref|NP_001141230.1| uncharacterized protein LOC100273317 [Zea mays]
 gb|ACF85784.1| unknown [Zea mays]
 gb|AFW58275.1| eukaryotic translation initiation factor 1A [Zea mays]
Length=146

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA C+DGT+RLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEATCVDGTRRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELPE  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPETLRLNEGV  119



>gb|ACR36727.1| unknown [Zea mays]
 gb|ACR37185.1| unknown [Zea mays]
 gb|AFW75494.1| eukaryotic translation initiation factor 1A [Zea mays]
Length=144

 Score =   192 bits (489),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/119 (91%), Positives = 115/119 (97%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGT+RLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTRRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTLRLNEGV  119



>gb|EYU32198.1| hypothetical protein MIMGU_mgv11b013259mg [Erythranthe guttata]
Length=143

 Score =   192 bits (488),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQVLRMLGNGRCE MCIDG KRL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVLRMLGNGRCETMCIDGVKRLGH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIA+GDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+NTR+NE I
Sbjct  61   IRGKMHKKVWIASGDIVLVGLRDYQDDKADVILKYMADEARLLKAYGELPDNTRINENI  119



>ref|XP_006656063.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Oryza 
brachyantha]
Length=144

 Score =   191 bits (485),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 109/119 (92%), Positives = 114/119 (96%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICGDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGKMHKKVWIAAGDI+LVGLRDYQDDKADVILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  61   IRGKMHKKVWIAAGDIVLVGLRDYQDDKADVILKYMNDEARLLKAYGELPDTLRLNEGV  119



>ref|NP_001148997.1| eukaryotic translation initiation factor 1A [Zea mays]
 gb|ACG33755.1| eukaryotic translation initiation factor 1A [Zea mays]
Length=188

 Score =   191 bits (485),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 90/102 (88%), Positives = 97/102 (95%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADD+KRELVFKEDGQEYAQV RMLGNGRCEA+C+DGT+RLCHIRGKMHKKVWIAAGDI+
Sbjct  18   EADDDKRELVFKEDGQEYAQVTRMLGNGRCEAICVDGTRRLCHIRGKMHKKVWIAAGDIV  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLRDYQDDKAD ILKYM DEARLLKAYGELP+  RLNEG+
Sbjct  78   LVGLRDYQDDKADFILKYMNDEARLLKAYGELPDTLRLNEGV  119



>emb|CDP09625.1| unnamed protein product [Coffea canephora]
Length=143

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/102 (87%), Positives = 96/102 (94%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            EADDEKRELV+KEDGQEYAQV+RMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII
Sbjct  18   EADDEKRELVYKEDGQEYAQVIRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLR+YQDDKADVILKYM DEAR L+ Y ELPE+ R+NE +
Sbjct  78   LVGLREYQDDKADVILKYMADEARRLQQYEELPESIRVNESV  119



>ref|XP_010051713.1| PREDICTED: eukaryotic translation initiation factor 1A-like, 
partial [Eucalyptus grandis]
Length=113

 Score =   183 bits (465),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/89 (100%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +3

Query  261  YAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILK  440
            YAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILK
Sbjct  3    YAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILK  62

Query  441  YMPDEARLLKAYGELPENTRLNEGIAGGL  527
            YMPDEARLLKAYGELPENTRLNEGIAGGL
Sbjct  63   YMPDEARLLKAYGELPENTRLNEGIAGGL  91



>ref|XP_003598034.1| Eukaryotic translation initiation factor 1A [Medicago truncatula]
 gb|AES68285.1| eukaryotic translation initiation factor 1A-like protein [Medicago 
truncatula]
 gb|AFK42079.1| unknown [Medicago truncatula]
Length=150

 Score =   181 bits (458),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 107/123 (87%), Positives = 111/123 (90%), Gaps = 4/123 (3%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGT----K  326
            MPKNKGKGGKNRKRGKNEADDEKREL+FKEDGQEYAQV RMLGNGR EA CID      K
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELIFKEDGQEYAQVTRMLGNGRLEANCIDNENNIRK  60

Query  327  RLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN  506
            RLCHIRGKMHKKVWIA GDIIL+GLRDYQDDKADVILKYMPDEARLLKAY E+PE+ RLN
Sbjct  61   RLCHIRGKMHKKVWIANGDIILIGLRDYQDDKADVILKYMPDEARLLKAYDEIPESIRLN  120

Query  507  EGI  515
            EGI
Sbjct  121  EGI  123



>ref|XP_002300749.2| hypothetical protein POPTR_0002s03310g [Populus trichocarpa]
 gb|EEE80022.2| hypothetical protein POPTR_0002s03310g [Populus trichocarpa]
Length=149

 Score =   177 bits (448),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 103/120 (86%), Positives = 109/120 (91%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEA   KREL+FKE+GQEYAQVLRMLGNGRC+AMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEAVVGKRELIFKEEGQEYAQVLRMLGNGRCDAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMH+KVWI AGDIILVGLRDYQD KAD+ILKY   EARLLKAYGELP NTR+N GIA
Sbjct  61   IRGKMHRKVWIDAGDIILVGLRDYQDHKADIILKYWTYEARLLKAYGELPANTRINVGIA  120



>gb|AFX67033.1| translation initiation factor 1A, partial [Solanum tuberosum]
Length=113

 Score =   173 bits (438),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 84/87 (97%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  258  EYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVIL  437
            EYAQVLRMLGNGRCEAM IDGTKRLCHIRGKMHKKVWIAAGDI+LVGLRDYQDDKADVIL
Sbjct  3    EYAQVLRMLGNGRCEAMRIDGTKRLCHIRGKMHKKVWIAAGDIVLVGLRDYQDDKADVIL  62

Query  438  KYMPDEARLLKAYGELPENTRLNEGIA  518
            KYMPDEARLLKAYG LPENTRLNEGIA
Sbjct  63   KYMPDEARLLKAYGGLPENTRLNEGIA  89



>ref|XP_005651075.1| nucleic acid-binding protein [Coccomyxa subellipsoidea C-169]
 gb|EIE26531.1| nucleic acid-binding protein [Coccomyxa subellipsoidea C-169]
Length=139

 Score =   173 bits (439),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 82/97 (85%), Positives = 89/97 (92%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  DEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVG  398
            +EKREL+FKEDGQEYAQVLRMLGNGR EAMCID TKRLCHIRGKM KKVW+  GDIILVG
Sbjct  20   EEKRELIFKEDGQEYAQVLRMLGNGRLEAMCIDSTKRLCHIRGKMRKKVWVNTGDIILVG  79

Query  399  LRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LRDYQD+KADVILKYM DEAR LKAYGELP++ R+NE
Sbjct  80   LRDYQDEKADVILKYMADEARSLKAYGELPDSIRVNE  116



>gb|KDP28098.1| hypothetical protein JCGZ_13869 [Jatropha curcas]
Length=147

 Score =   173 bits (439),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/102 (81%), Positives = 92/102 (90%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E  D+KREL+F+EDGQEYAQVLRMLGNGR EA+C DG KRLCHIRGKM+KKVWI A DI+
Sbjct  20   EEKDDKRELIFREDGQEYAQVLRMLGNGRLEAVCDDGIKRLCHIRGKMNKKVWINADDIV  79

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            LVGLRDYQDDKADVILKY+PDEARLLKAYGEL +N +LN GI
Sbjct  80   LVGLRDYQDDKADVILKYLPDEARLLKAYGELSDNVKLNAGI  121



>ref|XP_003744731.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Metaseiulus occidentalis]
Length=144

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 99/122 (81%), Positives = 109/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENEAEKRELVFKEDGQEYAQVVKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIILVGLRDYQD KADVILKY PDEAR LK+YGELPE+ ++NE +A
Sbjct  61   IRGKLRKKVWINQGDIILVGLRDYQDAKADVILKYNPDEARNLKSYGELPEHAKINENVA  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>emb|CDP08730.1| unnamed protein product [Coffea canephora]
Length=128

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 106/123 (86%), Gaps = 17/123 (14%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKK                 DDKADVILKYMPDEARLLKAYGELPE+TRLNEGIA
Sbjct  61   IRGKMHKK-----------------DDKADVILKYMPDEARLLKAYGELPESTRLNEGIA  103

Query  519  GGL  527
            GGL
Sbjct  104  GGL  106



>gb|KIZ01615.1| Eukaryotic translation initiation factor 1A,X-chromosomal [Monoraphidium 
neglectum]
Length=140

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/101 (81%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +3

Query  216  DDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILV  395
            ++EKREL+FKEDGQEYAQVLRMLGNGR EA CIDGTKRLCHIRGKM KKVW+ AGDI+LV
Sbjct  19   NEEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGTKRLCHIRGKMRKKVWVNAGDIVLV  78

Query  396  GLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            GLRDYQD KADVILKYM DEAR LK YGELPE+ R+N+  A
Sbjct  79   GLRDYQDAKADVILKYMADEARSLKQYGELPEHIRVNDTDA  119



>ref|XP_002502870.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO64128.1| predicted protein [Micromonas sp. RCC299]
Length=140

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  DEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVG  398
            DEKREL+FKEDGQEYAQVLRMLGNGR EA CIDG KRLCHIRGKM KKVW+  GDI+L+G
Sbjct  21   DEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIVLLG  80

Query  399  LRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LRDYQD+KADVILKY+ DEAR LKAYGELPE+ R+NE
Sbjct  81   LRDYQDEKADVILKYLADEARSLKAYGELPESIRVNE  117



>gb|KCW45092.1| hypothetical protein EUGRSUZ_L01307 [Eucalyptus grandis]
Length=128

 Score =   169 bits (429),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 105/123 (85%), Positives = 105/123 (85%), Gaps = 17/123 (14%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGKMHKK                 DDKADVILKYMPDEARLLKAYGELPENTRLN GIA
Sbjct  61   IRGKMHKK-----------------DDKADVILKYMPDEARLLKAYGELPENTRLNGGIA  103

Query  519  GGL  527
            GGL
Sbjct  104  GGL  106



>ref|XP_011100153.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Sesamum 
indicum]
Length=140

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 99/102 (97%), Positives = 100/102 (98%), Gaps = 0/102 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLR+LGNGRCEAM IDG KRLCH
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELVFKEDGQEYAQVLRILGNGRCEAMGIDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARL  464
            IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARL
Sbjct  61   IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARL  102



>ref|XP_003968238.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Takifugu rubripes]
Length=143

 Score =   169 bits (427),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 98/121 (81%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQVL+MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVLKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI   DIILVGLRDYQD KADVILKY  DEAR LKAYGELP+N ++NE   
Sbjct  61   IRGKLRKKVWINQSDIILVGLRDYQDTKADVILKYNTDEARSLKAYGELPDNAKINEDNF  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_002424524.1| eukaryotic translation initiation factor 1A, X-chromosomal, putative 
[Pediculus humanus corporis]
 gb|EEB11786.1| eukaryotic translation initiation factor 1A, X-chromosomal, putative 
[Pediculus humanus corporis]
Length=148

 Score =   169 bits (427),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV +MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVILKY PDEAR LK YGE PE  R+N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINDTVT  120



>ref|XP_008476517.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Diaphorina citri]
 ref|XP_008476518.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X2 [Diaphorina citri]
Length=148

 Score =   169 bits (427),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 95/120 (79%), Positives = 103/120 (86%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV +MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVILKY PDEAR LK YGE PE  R+N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINDTVT  120



>ref|XP_004080846.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Oryzias latipes]
Length=144

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_003060983.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54633.1| predicted protein [Micromonas pusilla CCMP1545]
Length=139

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/97 (82%), Positives = 88/97 (91%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  DEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVG  398
            DEKRELVFKEDGQEYAQVLRMLGNGR EA CIDG KRLCHIRGKM KKVW+  GDIIL+G
Sbjct  20   DEKRELVFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVCTGDIILLG  79

Query  399  LRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LRD+QD+KADVILKY+ DEAR LKAYGELP++ R+NE
Sbjct  80   LRDFQDEKADVILKYLADEARSLKAYGELPDSIRVNE  116



>ref|XP_010784482.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Notothenia coriiceps]
Length=144

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_010752914.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Larimichthys crocea]
Length=144

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_005813689.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Xiphophorus maculatus]
 ref|XP_007541608.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Poecilia formosa]
 ref|XP_008277291.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Stegastes partitus]
 ref|XP_008395108.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Poecilia reticulata]
Length=144

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_003456291.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Oreochromis niloticus]
 ref|XP_004574509.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Maylandia zebra]
 ref|XP_005752507.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Pundamilia nyererei]
 ref|XP_005945599.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Haplochromis burtoni]
 ref|XP_006807987.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Neolamprologus brichardi]
Length=144

 Score =   168 bits (426),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_967161.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Tribolium castaneum]
 gb|EFA00932.1| hypothetical protein TcasGA2_TC003838 [Tribolium castaneum]
Length=148

 Score =   168 bits (426),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 86/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            L+GLRDYQD KADVILKY PDEAR LK YGE PE+ R+NE + 
Sbjct  78   LIGLRDYQDAKADVILKYTPDEARNLKTYGEFPESVRINETVT  120



>gb|EPQ10197.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Myotis 
brandtii]
Length=144

 Score =   168 bits (425),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+T++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHTKINE  117



>gb|ACI68357.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
Length=144

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+R KNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRREKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI A DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINASDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_009064347.1| hypothetical protein LOTGIDRAFT_131336, partial [Lottia gigantea]
 gb|ESO84960.1| hypothetical protein LOTGIDRAFT_131336, partial [Lottia gigantea]
Length=144

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 86/99 (87%), Gaps = 0/99 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  13   ENEKEKRELVFKEDGQEYAQVSKMLGNGRLEAMCFDGNKRLCHIRGKLRKKVWINTGDII  72

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN  506
            L+GLRDYQD KADVILKY PDEAR LKAYGELPEN++ +
Sbjct  73   LLGLRDYQDTKADVILKYTPDEARNLKAYGELPENSKFH  111



>ref|XP_003470245.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Cavia porcellus]
Length=144

 Score =   167 bits (424),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 96/117 (82%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE D EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENDSEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_005364836.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Microtus ochrogaster]
Length=145

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 97/123 (79%), Positives = 106/123 (86%), Gaps = 0/123 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE   
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDT  120

Query  519  GGL  527
             GL
Sbjct  121  FGL  123



>ref|NP_001093083.1| eukaryotic translation initiation factor 1A [Bombyx mori]
 gb|ABD36298.1| eukaryotic translation initiation factor 1A [Bombyx mori]
Length=145

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/103 (77%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            L+GLRDYQD KADVILKY PDEAR LK YGE PE  R+NE + 
Sbjct  78   LIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINETVV  120



>ref|XP_004306683.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Fragaria 
vesca subsp. vesca]
Length=144

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 99/121 (82%), Positives = 105/121 (87%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNRKRGKNEADDEKREL+FK DGQEYAQV RMLGNGR EA C DG  RL H
Sbjct  1    MPKNKGKGGKNRKRGKNEADDEKRELLFKTDGQEYAQVTRMLGNGRLEARCHDGVTRLGH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            I GK+HKKVWIAAGDI+L+GLRDYQD KADVI KYMPDEARLLKAYGEL ++ R NEG  
Sbjct  61   ISGKLHKKVWIAAGDIVLIGLRDYQDGKADVIHKYMPDEARLLKAYGELNDSFRPNEGGG  120

Query  519  G  521
            G
Sbjct  121  G  121



>gb|EHJ63869.1| eukaryotic translation initiation factor 1A [Danaus plexippus]
Length=148

 Score =   167 bits (424),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            L+GLRDYQD KADVILKY PDEAR LK YGE PE  R+NE +
Sbjct  78   LIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINETV  119



>ref|XP_002405906.1| translation initiation factor 1A [Ixodes scapularis]
 gb|EEC10197.1| translation initiation factor 1A [Ixodes scapularis]
 tpg|DAA34576.1| TPA_exp: translation initiation factor 1A [Amblyomma variegatum]
Length=144

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 107/122 (88%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGMKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIILVGLRDYQD KADVILKY PDEAR LK+YGELPE+ ++N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILVGLRDYQDAKADVILKYNPDEARNLKSYGELPEHAKINDTVN  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>ref|XP_011448033.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Crassostrea gigas]
Length=143

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE ++EKRELVFKEDGQEYAQV +MLGNGR EA C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENENEKRELVFKEDGQEYAQVTKMLGNGRLEAQCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGK+ KKVWI  GDIIL+GLRD+QD KADVILKY  DEAR LKAYGELPE+TR+NE +
Sbjct  61   IRGKLRKKVWINGGDIILLGLRDFQDTKADVILKYTADEARNLKAYGELPESTRINENV  119



>ref|XP_004836829.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Heterocephalus glaber]
Length=166

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH+RGK+ KKVWI   DII
Sbjct  40   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHVRGKLRKKVWINTSDII  99

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQDDKADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  100  LVGLRDYQDDKADVILKYNADEARSLKAYGELPEHAKINE  139



>ref|XP_001421100.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422854.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO99393.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABP01213.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=142

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/99 (79%), Positives = 88/99 (89%), Gaps = 0/99 (0%)
 Frame = +3

Query  213  ADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIIL  392
             +DEKREL+FKEDGQEYAQVLRMLGNGR EA CIDG KRLCHIRGKM KKVW+  GDIIL
Sbjct  21   GEDEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIIL  80

Query  393  VGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            +GLRD+QD+KADVILKY+ DEAR LKAYGELP+  R+N+
Sbjct  81   LGLRDFQDEKADVILKYLADEARSLKAYGELPDTFRVND  119



>emb|CEG00119.1| Translation initiation factor 1A (eIF-1A) [Ostreococcus tauri]
Length=142

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 78/97 (80%), Positives = 87/97 (90%), Gaps = 0/97 (0%)
 Frame = +3

Query  219  DEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVG  398
            DEKREL+FKEDGQEYAQVLRMLGNGR EA CIDG KRLCHIRGKM KKVW+  GDI+L+G
Sbjct  23   DEKRELIFKEDGQEYAQVLRMLGNGRLEAQCIDGVKRLCHIRGKMRKKVWVNTGDIVLLG  82

Query  399  LRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LRD+QD+KADVILKY+ DEAR LKAYGELPE  R+N+
Sbjct  83   LRDFQDEKADVILKYLADEARSLKAYGELPETFRVND  119



>gb|KFM83040.1| Eukaryotic translation initiation factor 1A, X-chromosomal, partial 
[Stegodyphus mimosarum]
Length=144

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENEAEKRELVFKEDGQEYAQVVKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIILVGLRDYQD KADVILKY PDEAR LK YGELPE+ ++N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILVGLRDYQDAKADVILKYNPDEARNLKTYGELPEHAKINDTVN  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>gb|KFM83039.1| Eukaryotic translation initiation factor 1A, X-chromosomal, partial 
[Stegodyphus mimosarum]
Length=145

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENEAEKRELVFKEDGQEYAQVVKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIILVGLRDYQD KADVILKY PDEAR LK YGELPE+ ++N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILVGLRDYQDAKADVILKYNPDEARNLKTYGELPEHAKINDTVN  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>ref|XP_008306064.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Cynoglossus semilaevis]
Length=144

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/99 (80%), Positives = 87/99 (88%), Gaps = 0/99 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN  506
            LVGLRDYQD+KADVILKY PDEAR LK YGELPE+ +L+
Sbjct  78   LVGLRDYQDNKADVILKYNPDEARSLKVYGELPEHAKLD  116



>emb|CAF92608.1| unnamed protein product [Tetraodon nigroviridis]
 emb|CAF93800.1| unnamed protein product [Tetraodon nigroviridis]
Length=143

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 97/121 (80%), Positives = 106/121 (88%), Gaps = 0/121 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQVL+MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVLKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELP++ ++NE   
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNLDEARSLKAYGELPDHAKINEDNF  120

Query  519  G  521
            G
Sbjct  121  G  121



>ref|XP_005641247.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X1 [Canis lupus familiaris]
Length=147

 Score =   167 bits (422),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  21   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  80

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  81   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  120



>ref|XP_007186228.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Balaenoptera acutorostrata scammoni]
Length=144

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|ACO08711.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Oncorhynchus 
mykiss]
Length=144

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+R KNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRREKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_001623821.1| predicted protein [Nematostella vectensis]
 gb|EDO31721.1| predicted protein, partial [Nematostella vectensis]
Length=133

 Score =   166 bits (420),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 88/100 (88%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI  GDII
Sbjct  14   ENESEKRELVFKEDGQEYAQVVKMLGNGRLEALCFDGMKRLCHIRGKLRKKVWINTGDII  73

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            L+GLRDYQD KADVIL+Y PDEAR LKAYGELPEN ++N+
Sbjct  74   LLGLRDYQDTKADVILRYNPDEARNLKAYGELPENAKIND  113



>ref|XP_005718744.1| Translation initiation factor eIF1A [Chondrus crispus]
 emb|CDF38839.1| Translation initiation factor eIF1A [Chondrus crispus]
Length=141

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 87/103 (84%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            + DD+KREL+FKEDGQEYAQV RMLGNGRCE+ C DGT RLCHIRGK+ KKVW+ A DI+
Sbjct  18   DNDDDKRELIFKEDGQEYAQVNRMLGNGRCESKCFDGTTRLCHIRGKLRKKVWVNAQDIV  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            LVGLRDYQDDKAD+ILKY PDEAR L  YGE+P+ T +NE  A
Sbjct  78   LVGLRDYQDDKADIILKYSPDEARNLMKYGEIPDTTTINENAA  120



>gb|ACE87337.1| eukaryotic translation initiation factor 1A, X-linked protein 
[synthetic construct]
Length=144

 Score =   166 bits (421),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_004897491.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Heterocephalus glaber]
Length=213

 Score =   169 bits (427),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 88/105 (84%), Gaps = 0/105 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH+RGK+ KKVWI   DII
Sbjct  87   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHVRGKLRKKVWINTSDII  146

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIAGG  524
            LVGLRDYQDDKADVILKY  DEAR LKAYGELPE+ ++NE    G
Sbjct  147  LVGLRDYQDDKADVILKYNADEARSLKAYGELPEHAKINETDTFG  191



>gb|ELR54972.1| Eukaryotic translation initiation factor 1A, X-chromosomal, partial 
[Bos mutus]
Length=140

 Score =   166 bits (420),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  13   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  72

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  73   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  112



>gb|KDR18925.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Zootermopsis 
nevadensis]
Length=148

 Score =   166 bits (421),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVILKY PDEAR LK YGE PE  R+N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINDTVT  120



>ref|XP_004886349.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Heterocephalus glaber]
 ref|XP_004866230.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X2 [Heterocephalus glaber]
 gb|EHB03984.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Heterocephalus 
glaber]
Length=149

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  23   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  82

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  83   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  122



>gb|EHH30582.1| Eukaryotic translation initiation factor 1A, X-chromosomal, partial 
[Macaca mulatta]
 gb|EHH60753.1| Eukaryotic translation initiation factor 1A, X-chromosomal, partial 
[Macaca fascicularis]
Length=144

 Score =   166 bits (420),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|EKC40109.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Crassostrea 
gigas]
Length=186

 Score =   167 bits (424),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/119 (80%), Positives = 105/119 (88%), Gaps = 0/119 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE ++EKRELVFKEDGQEYAQV +MLGNGR EA C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENENEKRELVFKEDGQEYAQVTKMLGNGRLEAQCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGI  515
            IRGK+ KKVWI  GDIIL+GLRD+QD KADVILKY  DEAR LKAYGELPE+TR+NE +
Sbjct  61   IRGKLRKKVWINGGDIILLGLRDFQDTKADVILKYTADEARNLKAYGELPESTRINENV  119



>gb|ACQ58123.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Anoplopoma 
fimbria]
Length=144

 Score =   166 bits (420),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EK ELVFKEDGQEYAQV++MLGNGR EAMC DGTKRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKSELVFKEDGQEYAQVIKMLGNGRLEAMCFDGTKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|AGM32664.1| eukaryotic translation initiation factor 1A [Coptotermes formosanus]
Length=148

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 102/120 (85%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVILKY PDEAR LK YGE PE  R+N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDAKADVILKYTPDEARNLKTYGEFPETVRINDTVT  120



>ref|XP_003763565.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal, 
partial [Sarcophilus harrisii]
Length=142

 Score =   166 bits (420),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  16   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  75

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  76   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  115



>ref|XP_001624519.1| predicted protein [Nematostella vectensis]
 gb|EDO32419.1| predicted protein [Nematostella vectensis]
Length=147

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 105/117 (90%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVVKMLGNGRLEALCFDGMKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVIL+Y PDEAR LKAYGELPEN ++N+
Sbjct  61   IRGKLRKKVWINTGDIILLGLRDYQDTKADVILRYNPDEARNLKAYGELPENAKIND  117



>ref|XP_010636115.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Fukomys damarensis]
 gb|KFO27546.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Fukomys 
damarensis]
Length=143

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_004598164.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Ochotona princeps]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGAKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_312806.2| AGAP003119-PA [Anopheles gambiae str. PEST]
 gb|AAD47075.1|AF164151_1 translation initiation factor 4C (1A) [Anopheles gambiae]
 gb|EAA08471.2| AGAP003119-PA [Anopheles gambiae str. PEST]
 gb|KFB45278.1| AGAP003119-PA-like protein [Anopheles sinensis]
Length=148

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKREL+FKED QEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENESEKRELIFKEDEQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            L+GLRDYQD KADVILKY PDEAR LK YGE PE+ R+NE + 
Sbjct  78   LIGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVT  120



>ref|XP_010888382.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Esox lucius]
 gb|ACM08311.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|ACO13877.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Esox 
lucius]
 gb|ACO13972.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Esox 
lucius]
 emb|CDQ93979.1| unnamed protein product [Oncorhynchus mykiss]
 emb|CDQ81003.1| unnamed protein product [Oncorhynchus mykiss]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|NP_001403.1| eukaryotic translation initiation factor 1A, X-chromosomal [Homo 
sapiens]
 ref|NP_079713.2| eukaryotic translation initiation factor 1A, X-chromosomal [Mus 
musculus]
 ref|NP_001004814.1| eukaryotic translation initiation factor 1A, X-linked [Xenopus 
(Silurana) tropicalis]
 ref|NP_001084538.1| uncharacterized protein LOC414485 [Xenopus laevis]
 ref|NP_001086071.1| eukaryotic translation initiation factor 1A, X-linked [Xenopus 
laevis]
 ref|NP_001100433.1| eukaryotic translation initiation factor 1A, X-chromosomal [Rattus 
norvegicus]
 ref|NP_001125807.1| eukaryotic translation initiation factor 1A, X-chromosomal [Pongo 
abelii]
 ref|NP_001138651.1| eukaryotic translation initiation factor 1A, X-chromosomal [Ovis 
aries]
 ref|NP_001231278.1| eukaryotic translation initiation factor 1A, Y-linked [Sus scrofa]
 ref|NP_001248706.1| eukaryotic translation initiation factor 1A, X-chromosomal [Macaca 
mulatta]
 ref|XP_854509.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X2 [Canis lupus familiaris]
 ref|XP_003261186.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform 1 [Nomascus leucogenys]
 ref|XP_003466467.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Cavia porcellus]
 ref|XP_003499532.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Cricetulus griseus]
 ref|XP_003791949.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Otolemur garnettii]
 ref|XP_003819606.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Pan paniscus]
 ref|XP_003917531.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Papio anubis]
 ref|XP_004000382.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Felis catus]
 ref|XP_004063948.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Gorilla gorilla gorilla]
 ref|XP_004283109.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Orcinus orca]
 ref|XP_004382893.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Trichechus manatus latirostris]
 ref|XP_004401577.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Odobenus rosmarus divergens]
 ref|XP_004416955.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Odobenus rosmarus divergens]
 ref|XP_004450414.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform 2 [Dasypus novemcinctus]
 ref|XP_004587999.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Ochotona princeps]
 ref|XP_004588992.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Ochotona princeps]
 ref|XP_004625714.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Octodon degus]
 ref|XP_004689959.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Condylura cristata]
 ref|XP_004759023.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X2 [Mustela putorius furo]
 ref|XP_004813314.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Mustela putorius furo]
 ref|XP_004866231.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X3 [Heterocephalus glaber]
 ref|XP_005074299.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Mesocricetus auratus]
 ref|XP_005358862.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Microtus ochrogaster]
 ref|XP_005334883.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Ictidomys tridecemlineatus]
 ref|XP_005407865.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Chinchilla lanigera]
 ref|XP_005593203.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Macaca fascicularis]
 ref|XP_005701066.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Capra hircus]
 ref|XP_005871021.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Myotis brandtii]
 ref|XP_005897790.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Bos mutus]
 ref|XP_005972944.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Pantholops hodgsonii]
 ref|XP_006088600.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Myotis lucifugus]
 ref|XP_006194363.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Camelus ferus]
 ref|XP_006213052.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Vicugna pacos]
 ref|XP_006765178.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Myotis davidii]
 ref|XP_006759407.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Myotis davidii]
 ref|XP_006741777.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Leptonychotes weddellii]
 ref|XP_006893855.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Elephantulus edwardii]
 ref|XP_006835650.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Chrysochloris asiatica]
 ref|XP_006908015.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Pteropus alecto]
 ref|XP_006911684.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Pteropus alecto]
 ref|XP_006973302.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Peromyscus maniculatus bairdii]
 ref|XP_007085004.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Panthera tigris altaica]
 ref|XP_007090575.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Panthera tigris altaica]
 ref|XP_007103169.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Physeter catodon]
 ref|XP_006045455.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Bubalus bubalis]
 ref|XP_007174730.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Balaenoptera acutorostrata scammoni]
 ref|XP_007469371.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Lipotes vexillifer]
 ref|XP_007493503.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Monodelphis domestica]
 ref|XP_007538939.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Erinaceus europaeus]
 ref|XP_007612156.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Cricetulus griseus]
 ref|XP_007889903.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Callorhinchus milii]
 ref|XP_007951848.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Orycteropus afer afer]
 ref|XP_007989447.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Chlorocebus sabaeus]
 ref|XP_008061541.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Tarsius syrichta]
 ref|XP_008152784.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Eptesicus fuscus]
 ref|XP_008270656.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Oryctolagus cuniculus]
 ref|XP_008571356.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Galeopterus variegatus]
 ref|XP_008833942.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Nannospalax galili]
 ref|XP_008987307.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Callithrix jacchus]
 ref|XP_009437122.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Pan troglodytes]
 ref|XP_010378009.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Rhinopithecus roxellana]
 ref|XP_010333181.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Saimiri boliviensis boliviensis]
 ref|XP_010641979.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Fukomys damarensis]
 ref|XP_010594049.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Loxodonta africana]
 ref|XP_010843184.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Bison bison bison]
 ref|XP_010952831.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Camelus bactrianus]
 ref|XP_010985741.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Camelus dromedarius]
 ref|XP_010995392.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Camelus dromedarius]
 ref|XP_011361333.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Pteropus vampyrus]
 sp|P47813.2|IF1AX_HUMAN RecName: Full=Eukaryotic translation initiation factor 1A, X-chromosomal; 
Short=eIF-1A X isoform; AltName: Full=Eukaryotic 
translation initiation factor 4C; Short=eIF-4C [Homo sapiens]
 sp|Q5RA42.3|IF1AX_PONAB RecName: Full=Eukaryotic translation initiation factor 1A, X-chromosomal; 
Short=eIF-1A X isoform; AltName: Full=Eukaryotic 
translation initiation factor 4C; Short=eIF-4C [Pongo abelii]
 sp|Q8BMJ3.3|IF1AX_MOUSE RecName: Full=Eukaryotic translation initiation factor 1A, X-chromosomal; 
Short=eIF-1A X isoform; AltName: Full=Eukaryotic 
translation initiation factor 4C; Short=eIF-4C [Mus musculus]
 pdb|4KZY|NN Chain n, Rabbit 40s Ribosomal Subunit In Complex With Eif1 And 
Eif1a.
 pdb|4KZZ|NN Chain n, Rabbit 40s Ribosomal Subunit In Complex With Mrna, Initiator 
Trna And Eif1a
 gb|AAA19812.1| protein synthesis factor [Homo sapiens]
 gb|AAH00793.1| Eukaryotic translation initiation factor 1A, X-linked [Homo sapiens]
 dbj|BAB24942.1| unnamed protein product [Mus musculus]
 dbj|BAB28110.1| unnamed protein product [Mus musculus]
 dbj|BAB28428.1| unnamed protein product [Mus musculus]
 dbj|BAB32361.1| unnamed protein product [Mus musculus]
 gb|AAH27284.1| Eukaryotic translation initiation factor 1A, Y-linked [Mus musculus]
 dbj|BAC41069.1| unnamed protein product [Mus musculus]
 gb|AAP35727.1| eukaryotic translation initiation factor 1A [Homo sapiens]
 gb|AAH67851.1| Eukaryotic translation initiation factor 1A, X-linked [Homo sapiens]
 gb|AAH68786.1| MGC81333 protein [Xenopus laevis]
 gb|AAH74155.1| MGC81905 protein [Xenopus laevis]
 gb|AAH74588.1| intracisternal A particle-promoted polypeptide [Xenopus (Silurana) 
tropicalis]
 emb|CAH91368.1| hypothetical protein [Pongo abelii]
 gb|AAX32033.1| eukaryotic translation initiation factor 1A [synthetic construct]
 gb|AAX32034.1| eukaryotic translation initiation factor 1A [synthetic construct]
 dbj|BAE22301.1| unnamed protein product [Mus musculus]
 dbj|BAE22363.1| unnamed protein product [Mus musculus]
 dbj|BAE38904.1| unnamed protein product [Mus musculus]
 dbj|BAE39071.1| unnamed protein product [Mus musculus]
 dbj|BAE38266.1| unnamed protein product [Mus musculus]
 gb|AAI09651.1| Eukaryotic translation initiation factor 1A, X-linked [Bos taurus]
 emb|CAJ82618.1| eukaryotic translation initiaion factor 1a [Xenopus (Silurana) 
tropicalis]
 gb|EDL40820.1| eukaryotic translation initiation factor 1A, Y-linked [Mus musculus]
 gb|EDL96131.1| similar to eukaryotic translation initiation factor 1A, Y-linked 
(predicted) [Rattus norvegicus]
 dbj|BAG35242.1| unnamed protein product [Homo sapiens]
 gb|ACE86655.1| eukaryotic translation initiation factor 1A, X-linked protein 
[synthetic construct]
 gb|AAI68938.1| Eukaryotic translation initiation factor 1A, Y-linked [Rattus 
norvegicus]
 gb|ACM43304.1| X-linked eukaryotic translation initiation factor 1A [Ovis aries]
 tpg|DAA12633.1| TPA: eukaryotic translation initiation factor 1A, X-linked [Bos 
taurus]
 dbj|BAK62391.1| eukaryotic translation initiation factor 1A [Pan troglodytes]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>dbj|BAC27130.1| unnamed protein product [Mus musculus]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_003781272.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Otolemur garnettii]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|ACO13811.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Esox 
lucius]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|ACO08159.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Oncorhynchus 
mykiss]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPK+KGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKSKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI + DIILVGLRDYQD KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINSSDIILVGLRDYQDQKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_009545548.1| hypothetical protein HETIRDRAFT_126155 [Heterobasidion irregulare 
TC 32-1]
 gb|ETW83277.1| hypothetical protein HETIRDRAFT_126155 [Heterobasidion irregulare 
TC 32-1]
Length=139

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E DD+KRELVF+EDGQEYAQV +MLGNGR EAMC DG KRL HIRGKM KKVWI  GDI+
Sbjct  14   ENDDDKRELVFREDGQEYAQVTKMLGNGRLEAMCFDGEKRLAHIRGKMRKKVWINQGDIV  73

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            L+ LR++QDDKADVI+KY PDEAR LKAYGELPEN +LNE
Sbjct  74   LLSLREFQDDKADVIVKYTPDEARNLKAYGELPENAKLNE  113



>gb|ACI68111.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI + DIILVGLRDYQD KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINSSDIILVGLRDYQDQKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|AAP36772.1| Homo sapiens eukaryotic translation initiation factor 1A [synthetic 
construct]
 gb|AAX43676.1| eukaryotic translation initiation factor 1A X-linked, partial 
[synthetic construct]
Length=145

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_007249022.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Astyanax mexicanus]
Length=144

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIIL+GLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>pdb|1D7Q|A Chain A, Human Translation Initiation Factor Eif1a
Length=143

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  17   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  76

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  77   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  116



>ref|XP_008998608.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Callithrix jacchus]
Length=144

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKVNE  117



>ref|XP_004759022.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform X1 [Mustela putorius furo]
Length=170

 Score =   167 bits (422),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_010145773.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Eurypyga helias]
Length=182

 Score =   167 bits (423),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/134 (71%), Positives = 110/134 (82%), Gaps = 3/134 (2%)
 Frame = +3

Query  108  LLISGNWNWVLLASSVIMPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLG  287
            +L+ G+ N     S  ++P N GKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLG
Sbjct  25   MLVEGDSN---TCSFFLLPFNLGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLG  81

Query  288  NGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLL  467
            NGR EA+C DG KRLCHIRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR L
Sbjct  82   NGRLEALCFDGVKRLCHIRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSL  141

Query  468  KAYGELPENTRLNE  509
            KAYGELPE+ ++NE
Sbjct  142  KAYGELPEHAKINE  155



>gb|ETN59410.1| eukaryotic translation initiation factor 1A [Anopheles darlingi]
Length=148

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 77/103 (75%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKREL+FKED QEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENESEKRELIFKEDEQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            L+GLRDYQD KADVILKY PDEAR LK YGE PE+ R+NE + 
Sbjct  78   LIGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVT  120



>ref|NP_524728.2| eukaryotic initiation factor 1A, isoform A [Drosophila melanogaster]
 ref|NP_996231.1| eukaryotic initiation factor 1A, isoform B [Drosophila melanogaster]
 ref|NP_001287386.1| eukaryotic initiation factor 1A, isoform C [Drosophila melanogaster]
 ref|XP_001359311.1| GA20792 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_001964385.1| GF23078 [Drosophila ananassae]
 ref|XP_001979664.1| GG22826 [Drosophila erecta]
 ref|XP_001996271.1| GH22399 [Drosophila grimshawi]
 ref|XP_001999392.1| GI24484 [Drosophila mojavensis]
 ref|XP_002017101.1| GL21704 [Drosophila persimilis]
 ref|XP_002040983.1| GM15296 [Drosophila sechellia]
 ref|XP_002054611.1| GJ24550 [Drosophila virilis]
 ref|XP_002072314.1| GK22392 [Drosophila willistoni]
 ref|XP_002096168.1| eIF-1A [Drosophila yakuba]
 ref|XP_002102964.1| GD19223 [Drosophila simulans]
 gb|AAF55526.1| eukaryotic initiation factor 1A, isoform A [Drosophila melanogaster]
 gb|AAM29503.1| RE54849p [Drosophila melanogaster]
 gb|AAR09900.1| similar to Drosophila melanogaster eIF-1A, partial [Drosophila 
yakuba]
 gb|AAS65169.1| eukaryotic initiation factor 1A, isoform B [Drosophila melanogaster]
 gb|EAL28456.1| GA20792 [Drosophila pseudoobscura pseudoobscura]
 gb|EDV30181.1| GF23078 [Drosophila ananassae]
 gb|EDV48622.1| GG22826 [Drosophila erecta]
 gb|EDV98632.1| GH22399 [Drosophila grimshawi]
 gb|EDW14853.1| GI24484 [Drosophila mojavensis]
 gb|EDW34201.1| GL21704 [Drosophila persimilis]
 gb|EDW44631.1| GM15296 [Drosophila sechellia]
 gb|EDW68131.1| GJ24550 [Drosophila virilis]
 gb|EDW83300.1| GK22392 [Drosophila willistoni]
 gb|EDW95880.1| eIF-1A [Drosophila yakuba]
 gb|EDX12467.1| GD19223 [Drosophila simulans]
 gb|ACL87028.1| eIF-1A-PA, partial [synthetic construct]
 gb|ACL91388.1| eIF-1A-PA [synthetic construct]
 gb|AHN57385.1| eukaryotic initiation factor 1A, isoform C [Drosophila melanogaster]
Length=148

 Score =   166 bits (420),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKREL+FKED QEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENEFEKRELIFKEDQQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            LVGLRDYQD KADVILKY PDEAR LK YGE PE+ R+NE + 
Sbjct  78   LVGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINETVT  120



>ref|XP_001492778.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
isoform 1 [Equus caballus]
Length=144

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGIKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|ACI66529.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|ACI67610.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|ACI68600.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|ACI68974.2| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|AGH92564.1| eukaryotic translation initiation factor 1A [Salmo salar]
 emb|CDQ69064.1| unnamed protein product [Oncorhynchus mykiss]
Length=144

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI + DIILVGLRDYQD KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINSSDIILVGLRDYQDQKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_004435240.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Ceratotherium simum simum]
Length=144

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGMKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_008506689.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal, 
partial [Equus przewalskii]
Length=141

 Score =   166 bits (419),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  15   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINTSDII  74

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  75   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  114



>gb|ACI66646.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
Length=129

 Score =   165 bits (418),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDQKADVILKYNADEARSLKAYGELPEHAKINE  117



>gb|AIC54325.1| EIF1AX, partial [synthetic construct]
Length=144

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|NP_001020624.1| eukaryotic translation initiation factor 1A, X-chromosomal [Danio 
rerio]
 gb|AAH96794.1| Zgc:110087 [Danio rerio]
 gb|AAI55228.1| Zgc:110087 protein [Danio rerio]
Length=144

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIIL+GLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_006146742.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Tupaia chinensis]
Length=156

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_006628069.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Lepisosteus oculatus]
Length=178

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_008252380.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Oryctolagus cuniculus]
Length=144

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVVKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   D+ILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDVILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_009944630.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Leptosomus discolor]
Length=153

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  27   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  86

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  87   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  126



>emb|CCQ18621.1| Translation initiation factor 1A [Sycon ciliatum]
Length=148

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE D++KRELVFKEDGQEYAQV +MLGNGR EA+C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENDNDKRELVFKEDGQEYAQVTKMLGNGRLEALCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVILKY  DEAR LKAYGELPE  ++NE
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDSKADVILKYNSDEARNLKAYGELPETAKINE  117



>ref|XP_008709060.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Ursus maritimus]
Length=144

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC+DG KR CH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCLDGVKRFCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_005705342.1| translation initiation factor eIF-1A [Galdieria sulphuraria]
 gb|EME28822.1| translation initiation factor eIF-1A [Galdieria sulphuraria]
Length=136

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 90/116 (78%), Positives = 106/116 (91%), Gaps = 0/116 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKN+ ++EKRELV KE+GQEYAQV RMLGNGRCEA+C DGT+RLCH
Sbjct  1    MPKNKGKGGKNRRRGKNDNEEEKRELVMKEEGQEYAQVTRMLGNGRCEALCFDGTRRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLN  506
            IRGKM KKVWI +GDI+L+GLRDYQD+KAD+ILKY PDEAR LKA GE+P+ T++N
Sbjct  61   IRGKMRKKVWINSGDIVLIGLRDYQDEKADIILKYNPDEARALKAQGEIPDTTKIN  116



>ref|XP_009705073.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Cariama cristata]
Length=151

 Score =   166 bits (419),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  25   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  84

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  85   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  124



>ref|XP_008580999.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
isoform X1 [Galeopterus variegatus]
Length=144

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_010184319.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Mesitornis unicolor]
Length=152

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  26   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  85

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  86   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  125



>ref|NP_001290808.1| eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Esox lucius]
 gb|ACI67552.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Salmo 
salar]
 gb|ACO13374.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Esox 
lucius]
 gb|ACO14377.1| Eukaryotic translation initiation factor 1A, X-chromosomal [Esox 
lucius]
 emb|CDQ69978.1| unnamed protein product [Oncorhynchus mykiss]
Length=144

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDQKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_011235056.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Ailuropoda melanoleuca]
Length=168

 Score =   166 bits (420),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  42   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  101

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  102  LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  141



>ref|XP_004670712.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Jaculus jaculus]
Length=144

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>dbj|BAN20284.1| eukaryotic translation initiation factor 1A [Riptortus pedestris]
Length=148

 Score =   165 bits (418),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/120 (78%), Positives = 101/120 (84%), Gaps = 0/120 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV +MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENETEKRELVFKEDGQEYAQVTKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD KADVI KY PDEAR LK YGE PE  R+N+ + 
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDTKADVIQKYTPDEARNLKTYGEFPETVRINDTVT  120



>ref|NP_001020500.1| eukaryotic translation initiation factor 1A, X-chromosomal [Bos 
taurus]
 gb|AAW82126.1| X-linked eukaryotic translation initiation factor 1A [Bos taurus]
Length=144

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVIL+Y  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILRYNADEARSLKAYGELPEHAKINE  117



>ref|XP_009507568.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal 
[Phalacrocorax carbo]
Length=149

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  23   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  82

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  83   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  122



>ref|XP_007070577.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal-like 
[Chelonia mydas]
Length=203

 Score =   167 bits (422),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  77   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  136

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  137  LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  176



>ref|XP_004651621.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Jaculus 
jaculus]
 ref|XP_004668610.1| PREDICTED: eukaryotic translation initiation factor 1A-like [Jaculus 
jaculus]
Length=144

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 106/122 (87%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG +RLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVVKMLGNGRLEAMCFDGVRRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI   DIIL+GLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE  A
Sbjct  61   IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINETDA  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>gb|EOA93362.1| Eukaryotic translation initiation factor 1A, Y-chromosomal, partial 
[Anas platyrhynchos]
Length=141

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  15   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  74

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  75   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  114



>ref|XP_010165581.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Caprimulgus carolinensis]
Length=152

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  26   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  85

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  86   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  125



>ref|XP_010117853.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Chlamydotis macqueenii]
Length=150

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  24   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  83

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  84   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  123



>ref|XP_005002994.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal-like 
[Cavia porcellus]
Length=144

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIIL+GLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILIGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_001649007.1| AAEL004378-PA [Aedes aegypti]
 gb|ABF18433.1| translation initiation factor 1A [Aedes aegypti]
 gb|EAT44263.1| AAEL004378-PA [Aedes aegypti]
Length=148

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 85/103 (83%), Gaps = 0/103 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKREL+FKED QEYAQV +MLGNGR EAMC DG KRLCHIRGK+ KKVWI  GDII
Sbjct  18   ENESEKRELIFKEDEQEYAQVTKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINQGDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            L+GLRDYQD KADVILKY PDEAR LK YGE PE+ R+N+ + 
Sbjct  78   LIGLRDYQDSKADVILKYTPDEARNLKTYGEFPESVRINDTVT  120



>ref|XP_007659527.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal, 
partial [Ornithorhynchus anatinus]
Length=182

 Score =   166 bits (420),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  56   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGIKRLCHIRGKLRKKVWINTSDII  115

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  116  LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  155



>ref|XP_009275210.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Aptenodytes forsteri]
Length=155

 Score =   165 bits (418),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  29   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  88

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  89   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  128



>ref|XP_003725831.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal-like 
[Strongylocentrotus purpuratus]
Length=148

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 95/122 (78%), Positives = 105/122 (86%), Gaps = 0/122 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EA+C D  KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDSKKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNEGIA  518
            IRGK+ KKVWI  GDIIL+GLRDYQD+KADVILKY  DEAR LK YGELPEN ++NE  A
Sbjct  61   IRGKLRKKVWINQGDIILIGLRDYQDEKADVILKYNADEARNLKLYGELPENAKINESSA  120

Query  519  GG  524
             G
Sbjct  121  FG  122



>ref|XP_001836196.2| eukaryotic translation initiation factor 1A [Coprinopsis cinerea 
okayama7#130]
 gb|EAU85568.2| eukaryotic translation initiation factor 1A [Coprinopsis cinerea 
okayama7#130]
Length=143

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 103/117 (88%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE DD+KRELVF+EDGQEYAQV +MLGNGR EAMC DG KRL H
Sbjct  1    MPKNKGKGGKNRRRGKNENDDDKRELVFREDGQEYAQVTKMLGNGRLEAMCFDGEKRLAH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGKM KKVWI  GDIIL+ LRD+QDDKADVI+KY  DEAR LKAYGELPEN ++NE
Sbjct  61   IRGKMRKKVWINQGDIILLSLRDFQDDKADVIVKYTADEARNLKAYGELPENAKINE  117



>ref|XP_004710054.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Echinops telfairi]
Length=177

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/100 (79%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EAMC DG KRLCHIRGK+ KKVWI   DII
Sbjct  18   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEAMCFDGVKRLCHIRGKLRKKVWINTSDII  77

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  78   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_009973416.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal 
[Tyto alba]
Length=149

 Score =   165 bits (417),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  23   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  82

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  83   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  122



>ref|XP_009563874.1| PREDICTED: eukaryotic translation initiation factor 1A, X-chromosomal 
[Cuculus canorus]
Length=159

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  33   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  92

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  93   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  132



>gb|AAP36660.1| Homo sapiens eukaryotic translation initiation factor 1A, Y chromosome 
[synthetic construct]
 gb|AAX29490.1| eukaryotic translation initiation factor 1A Y-linked, partial 
[synthetic construct]
Length=145

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|NP_001008977.1| eukaryotic translation initiation factor 1A, Y-chromosomal [Pan 
troglodytes]
 sp|Q6GVM3.3|IF1AY_PANTR RecName: Full=Eukaryotic translation initiation factor 1A, Y-chromosomal; 
Short=eIF-1A Y isoform; AltName: Full=Eukaryotic 
translation initiation factor 4C; Short=eIF-4C [Pan troglodytes]
 gb|AAT46352.1| EIF1AY [Pan troglodytes]
Length=144

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 94/117 (80%), Positives = 104/117 (89%), Gaps = 0/117 (0%)
 Frame = +3

Query  159  MPknkgkggknrkrgknEADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCH  338
            MPKNKGKGGKNR+RGKNE + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCH
Sbjct  1    MPKNKGKGGKNRRRGKNENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCH  60

Query  339  IRGKMHKKVWIAAGDIILVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            IRGK+ KKVWI   DIILVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  61   IRGKLRKKVWINTSDIILVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  117



>ref|XP_010022321.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal, 
partial [Nestor notabilis]
Length=138

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  12   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  71

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  72   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  111



>ref|XP_005030911.1| PREDICTED: eukaryotic translation initiation factor 1A, Y-chromosomal-like, 
partial [Anas platyrhynchos]
Length=141

 Score =   164 bits (416),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 78/100 (78%), Positives = 87/100 (87%), Gaps = 0/100 (0%)
 Frame = +3

Query  210  EADDEKRELVFKEDGQEYAQVLRMLGNGRCEAMCIDGTKRLCHIRGKMHKKVWIAAGDII  389
            E + EKRELVFKEDGQEYAQV++MLGNGR EA+C DG KRLCHIRGK+ KKVWI   DII
Sbjct  15   ENESEKRELVFKEDGQEYAQVIKMLGNGRLEALCFDGVKRLCHIRGKLRKKVWINTSDII  74

Query  390  LVGLRDYQDDKADVILKYMPDEARLLKAYGELPENTRLNE  509
            LVGLRDYQD+KADVILKY  DEAR LKAYGELPE+ ++NE
Sbjct  75   LVGLRDYQDNKADVILKYNADEARSLKAYGELPEHAKINE  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559039970400