BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C06

Length=544
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006358946.1|  PREDICTED: heterogeneous nuclear ribonucleop...    256   4e-80   Solanum tuberosum [potatoes]
ref|XP_004251889.1|  PREDICTED: UBP1-associated protein 2C-like         250   7e-78   Solanum lycopersicum
ref|XP_009605426.1|  PREDICTED: UBP1-associated protein 2C-like         244   4e-75   Nicotiana tomentosiformis
ref|XP_009760192.1|  PREDICTED: UBP1-associated protein 2C-like         243   5e-75   Nicotiana sylvestris
ref|XP_008226506.1|  PREDICTED: UBP1-associated protein 2C              239   1e-73   Prunus mume [ume]
ref|XP_007211635.1|  hypothetical protein PRUPE_ppa005857mg             239   1e-73   Prunus persica
ref|XP_010277758.1|  PREDICTED: UBP1-associated protein 2C              239   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_002285377.1|  PREDICTED: UBP1-associated protein 2C              239   2e-73   Vitis vinifera
gb|KJB61641.1|  hypothetical protein B456_009G372200                    238   3e-73   Gossypium raimondii
ref|XP_008345124.1|  PREDICTED: LOW QUALITY PROTEIN: UBP1-associa...    237   7e-73   
gb|KJB13225.1|  hypothetical protein B456_002G063400                    237   9e-73   Gossypium raimondii
gb|KHG05172.1|  Heterogeneous nuclear ribonucleoprotein D0              237   1e-72   Gossypium arboreum [tree cotton]
gb|KHG22515.1|  Heterogeneous nuclear ribonucleoprotein A3              237   1e-72   Gossypium arboreum [tree cotton]
ref|XP_003541062.1|  PREDICTED: heterogeneous nuclear ribonucleop...    237   1e-72   Glycine max [soybeans]
ref|XP_008367946.1|  PREDICTED: UBP1-associated protein 2C-like         236   2e-72   
ref|XP_009335191.1|  PREDICTED: UBP1-associated protein 2C-like         236   2e-72   Pyrus x bretschneideri [bai li]
ref|XP_007021676.1|  RNA-binding family protein                         236   3e-72   
ref|XP_009340211.1|  PREDICTED: UBP1-associated protein 2C-like         235   7e-72   
ref|XP_002300424.2|  hypothetical protein POPTR_0001s38640g             232   2e-71   
ref|XP_010108262.1|  Uncharacterized RNA-binding protein                230   3e-70   Morus notabilis
emb|CDP05991.1|  unnamed protein product                                230   5e-70   Coffea canephora [robusta coffee]
ref|XP_010108263.1|  Heterogeneous nuclear ribonucleoprotein A0         230   5e-70   Morus notabilis
ref|XP_011006711.1|  PREDICTED: UBP1-associated protein 2C              230   7e-70   Populus euphratica
ref|XP_004294103.1|  PREDICTED: UBP1-associated protein 2C              229   1e-69   Fragaria vesca subsp. vesca
ref|XP_006485663.1|  PREDICTED: heterogeneous nuclear ribonucleop...    229   1e-69   Citrus sinensis [apfelsine]
ref|XP_006451727.1|  hypothetical protein CICLE_v10008394mg             228   2e-69   
ref|XP_008383632.1|  PREDICTED: UBP1-associated protein 2C-like         225   1e-68   
ref|XP_004137219.1|  PREDICTED: uncharacterized protein LOC101207569    226   1e-68   Cucumis sativus [cucumbers]
ref|XP_006582133.1|  PREDICTED: heterogeneous nuclear ribonucleop...    226   2e-68   Glycine max [soybeans]
ref|XP_008451717.1|  PREDICTED: UBP1-associated protein 2C              225   5e-68   Cucumis melo [Oriental melon]
ref|XP_006852453.1|  hypothetical protein AMTR_s00021p00110500          224   7e-68   Amborella trichopoda
ref|XP_007133193.1|  hypothetical protein PHAVU_011G159400g             224   1e-67   Phaseolus vulgaris [French bean]
emb|CDO96777.1|  unnamed protein product                                222   4e-67   Coffea canephora [robusta coffee]
emb|CDY55846.1|  BnaCnng29340D                                          221   4e-67   Brassica napus [oilseed rape]
gb|KEH19556.1|  RNA-binding (RRM/RBD/RNP motif) family protein          223   5e-67   Medicago truncatula
ref|XP_010535053.1|  PREDICTED: UBP1-associated protein 2C              222   6e-67   Tarenaya hassleriana [spider flower]
gb|EYU26340.1|  hypothetical protein MIMGU_mgv1a024658mg                220   1e-66   Erythranthe guttata [common monkey flower]
ref|XP_010527509.1|  PREDICTED: UBP1-associated protein 2C-like         221   1e-66   Tarenaya hassleriana [spider flower]
ref|XP_006307615.1|  hypothetical protein CARUB_v10009243mg             221   2e-66   
ref|XP_008791396.1|  PREDICTED: UBP1-associated protein 2C-like         221   2e-66   Phoenix dactylifera
ref|XP_009352781.1|  PREDICTED: UBP1-associated protein 2C-like         219   3e-66   Pyrus x bretschneideri [bai li]
ref|XP_010479881.1|  PREDICTED: UBP1-associated protein 2C-like         219   4e-66   
ref|XP_006392809.1|  hypothetical protein EUTSA_v10011518mg             219   9e-66   Eutrema salsugineum [saltwater cress]
ref|XP_008775614.1|  PREDICTED: UBP1-associated protein 2C-like         219   9e-66   Phoenix dactylifera
ref|XP_010462203.1|  PREDICTED: UBP1-associated protein 2C-like         219   9e-66   
ref|XP_010500962.1|  PREDICTED: UBP1-associated protein 2C-like         218   3e-65   Camelina sativa [gold-of-pleasure]
ref|XP_007211523.1|  hypothetical protein PRUPE_ppa008108mg             214   9e-65   
ref|XP_010913172.1|  PREDICTED: UBP1-associated protein 2C-like         215   2e-64   Elaeis guineensis
ref|XP_009144782.1|  PREDICTED: UBP1-associated protein 2C-like         215   2e-64   Brassica rapa
ref|XP_008225274.1|  PREDICTED: UBP1-associated protein 2C-like         214   2e-64   Prunus mume [ume]
ref|XP_010924885.1|  PREDICTED: UBP1-associated protein 2C-like         216   2e-64   Elaeis guineensis
ref|XP_009147615.1|  PREDICTED: UBP1-associated protein 2C-like         214   4e-64   Brassica rapa
emb|CDY25867.1|  BnaA05g14580D                                          213   7e-64   Brassica napus [oilseed rape]
gb|AGV54510.1|  polyadenylate-binding protein, cytoplasmic and nu...    213   2e-63   Phaseolus vulgaris [French bean]
gb|AGV54416.1|  polyadenylate-binding protein                           213   2e-63   Phaseolus vulgaris [French bean]
ref|XP_004510069.1|  PREDICTED: heterogeneous nuclear ribonucleop...    213   2e-63   
ref|XP_002882908.1|  hypothetical protein ARALYDRAFT_478927             212   2e-63   
emb|CDY24106.1|  BnaA06g01040D                                          212   2e-63   Brassica napus [oilseed rape]
ref|XP_009795836.1|  PREDICTED: UBP1-associated protein 2C-like         213   2e-63   Nicotiana sylvestris
ref|XP_002894431.1|  hypothetical protein ARALYDRAFT_892356             212   3e-63   Arabidopsis lyrata subsp. lyrata
gb|EPS74427.1|  hypothetical protein M569_00327                         211   5e-63   Genlisea aurea
ref|NP_188119.1|  RNA recognition motif-containing protein              211   8e-63   Arabidopsis thaliana [mouse-ear cress]
gb|ACN41154.1|  unknown                                                 211   9e-63   Picea sitchensis
ref|XP_009616692.1|  PREDICTED: UBP1-associated protein 2C-like         209   5e-62   Nicotiana tomentosiformis
emb|CDY26001.1|  BnaC06g06230D                                          208   7e-62   Brassica napus [oilseed rape]
gb|EYU28074.1|  hypothetical protein MIMGU_mgv1a007599mg                208   7e-62   Erythranthe guttata [common monkey flower]
ref|XP_010062800.1|  PREDICTED: UBP1-associated protein 2C-like         208   1e-61   Eucalyptus grandis [rose gum]
ref|XP_011096428.1|  PREDICTED: UBP1-associated protein 2C              207   1e-61   Sesamum indicum [beniseed]
gb|AES90335.2|  heterogeneous nuclear ribonucleoprotein                 205   3e-61   Medicago truncatula
ref|XP_009400549.1|  PREDICTED: UBP1-associated protein 2C-like         207   5e-61   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003608138.1|  Heterogeneous nuclear ribonucleoprotein A3-l...    205   9e-61   
ref|XP_009400552.1|  PREDICTED: UBP1-associated protein 2C-like         206   1e-60   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002305079.1|  hypothetical protein POPTR_0004s05450g             202   5e-60   
gb|KDP21080.1|  hypothetical protein JCGZ_21551                         202   9e-60   Jatropha curcas
ref|XP_011005481.1|  PREDICTED: UBP1-associated protein 2C-like         201   3e-59   Populus euphratica
ref|XP_004293936.1|  PREDICTED: UBP1-associated protein 2C-like         199   4e-59   Fragaria vesca subsp. vesca
ref|XP_002522563.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    200   6e-59   Ricinus communis
ref|XP_010060672.1|  PREDICTED: UBP1-associated protein 2C              201   9e-59   Eucalyptus grandis [rose gum]
ref|XP_004505137.1|  PREDICTED: heterogeneous nuclear ribonucleop...    197   7e-58   Cicer arietinum [garbanzo]
ref|XP_010677513.1|  PREDICTED: UBP1-associated protein 2C-like         197   8e-58   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010677512.1|  PREDICTED: UBP1-associated protein 2C-like         197   1e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003529367.1|  PREDICTED: heterogeneous nuclear ribonucleop...    193   2e-56   Glycine max [soybeans]
ref|XP_002316830.2|  hypothetical protein POPTR_0011s07480g             192   3e-56   Populus trichocarpa [western balsam poplar]
ref|XP_011045924.1|  PREDICTED: UBP1-associated protein 2C-like         192   5e-56   Populus euphratica
ref|XP_004231546.1|  PREDICTED: UBP1-associated protein 2C              192   1e-55   
ref|XP_003520185.1|  PREDICTED: heterogeneous nuclear ribonucleop...    191   3e-55   Glycine max [soybeans]
ref|XP_007153712.1|  hypothetical protein PHAVU_003G058600g             189   7e-55   Phaseolus vulgaris [French bean]
ref|XP_006359092.1|  PREDICTED: heterogeneous nuclear ribonucleop...    190   1e-54   Solanum tuberosum [potatoes]
ref|NP_001168409.1|  hypothetical protein                               183   5e-52   Zea mays [maize]
ref|XP_001764798.1|  predicted protein                                  176   4e-51   
ref|NP_001150933.1|  heterogeneous nuclear ribonucleoprotein A3-l...    168   3e-46   Zea mays [maize]
ref|XP_008672966.1|  PREDICTED: heterogeneous nuclear ribonucleop...    168   3e-46   Zea mays [maize]
ref|XP_002458152.1|  hypothetical protein SORBIDRAFT_03g027820          167   7e-46   Sorghum bicolor [broomcorn]
ref|XP_004969158.1|  PREDICTED: heterogeneous nuclear ribonucleop...    167   1e-45   Setaria italica
gb|ABK24718.1|  unknown                                                 160   3e-43   Picea sitchensis
dbj|BAJ89845.1|  predicted protein                                      157   5e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACN39907.1|  unknown                                                 157   7e-42   Picea sitchensis
ref|XP_002983841.1|  hypothetical protein SELMODRAFT_45421              150   3e-41   
ref|XP_002960787.1|  hypothetical protein SELMODRAFT_163608             152   8e-41   Selaginella moellendorffii
ref|NP_001043567.1|  Os01g0614500                                       154   9e-41   
ref|XP_003569353.1|  PREDICTED: UBP1-associated protein 2C              153   1e-40   Brachypodium distachyon [annual false brome]
ref|XP_002960828.1|  hypothetical protein SELMODRAFT_70937              148   2e-40   
ref|XP_010943535.1|  PREDICTED: UBP1-associated protein 2C-like         150   2e-40   Elaeis guineensis
emb|CDM83390.1|  unnamed protein product                                149   3e-39   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002976199.1|  hypothetical protein SELMODRAFT_151090             147   5e-39   Selaginella moellendorffii
ref|XP_009417297.1|  PREDICTED: UBP1-associated protein 2C-like         145   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004136575.1|  PREDICTED: uncharacterized RNA-binding prote...    144   5e-38   Cucumis sativus [cucumbers]
ref|XP_008777247.1|  PREDICTED: UBP1-associated protein 2C-like         144   6e-38   Phoenix dactylifera
ref|XP_006827046.1|  hypothetical protein AMTR_s00010p00228950          145   1e-37   Amborella trichopoda
ref|XP_010261151.1|  PREDICTED: UBP1-associated protein 2A-like         145   1e-37   
ref|XP_008443071.1|  PREDICTED: UBP1-associated protein 2C-like         143   1e-37   Cucumis melo [Oriental melon]
ref|XP_010943670.1|  PREDICTED: UBP1-associated protein 2A-like         144   5e-37   Elaeis guineensis
ref|XP_009369730.1|  PREDICTED: UBP1-associated protein 2A-like i...    140   6e-37   Pyrus x bretschneideri [bai li]
ref|XP_004493569.1|  PREDICTED: heterogeneous nuclear ribonucleop...    141   7e-37   Cicer arietinum [garbanzo]
gb|ABR18205.1|  unknown                                                 142   9e-37   Picea sitchensis
gb|KJB34463.1|  hypothetical protein B456_006G067200                    140   1e-36   Gossypium raimondii
ref|XP_007028959.1|  RNA-binding family protein isoform 1               140   1e-36   
gb|EYU35971.1|  hypothetical protein MIMGU_mgv1a004343mg                142   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_007028960.1|  RNA-binding family protein isoform 2               140   2e-36   
ref|XP_011078840.1|  PREDICTED: UBP1-associated protein 2C-like i...    140   2e-36   Sesamum indicum [beniseed]
ref|XP_004304376.1|  PREDICTED: UBP1-associated protein 2C-like         139   3e-36   Fragaria vesca subsp. vesca
gb|ABK24360.1|  unknown                                                 139   4e-36   Picea sitchensis
ref|XP_008365599.1|  PREDICTED: UBP1-associated protein 2C-like i...    138   4e-36   
gb|EYU46155.1|  hypothetical protein MIMGU_mgv1a006683mg                140   5e-36   Erythranthe guttata [common monkey flower]
ref|XP_008804059.1|  PREDICTED: UBP1-associated protein 2A-like         141   5e-36   Phoenix dactylifera
ref|XP_010943275.1|  PREDICTED: UBP1-associated protein 2A-like         141   5e-36   Elaeis guineensis
gb|KDP24609.1|  hypothetical protein JCGZ_25525                         138   7e-36   Jatropha curcas
ref|XP_010673248.1|  PREDICTED: UBP1-associated protein 2A-like         140   8e-36   Beta vulgaris subsp. vulgaris [field beet]
emb|CBI30033.3|  unnamed protein product                                138   9e-36   Vitis vinifera
ref|XP_002278602.1|  PREDICTED: UBP1-associated protein 2C-like i...    138   1e-35   Vitis vinifera
ref|NP_001241058.1|  uncharacterized protein LOC100776344               138   1e-35   Glycine max [soybeans]
ref|XP_010102557.1|  Uncharacterized RNA-binding protein                137   1e-35   Morus notabilis
ref|XP_003554202.1|  PREDICTED: DAZ-associated protein 1                137   1e-35   Glycine max [soybeans]
ref|XP_010067463.1|  PREDICTED: UBP1-associated protein 2C-like         137   2e-35   Eucalyptus grandis [rose gum]
ref|XP_010653903.1|  PREDICTED: UBP1-associated protein 2A-like i...    135   2e-35   Vitis vinifera
gb|ABK21372.1|  unknown                                                 135   2e-35   Picea sitchensis
ref|XP_001763161.1|  predicted protein                                  134   3e-35   
ref|XP_006836153.1|  hypothetical protein AMTR_s00101p00033020          139   3e-35   Amborella trichopoda
gb|KHG11284.1|  Heterogeneous nuclear ribonucleoprotein D-like pr...    137   3e-35   Gossypium arboreum [tree cotton]
gb|AGT16098.1|  RNA binding protein                                     138   5e-35   Saccharum hybrid cultivar R570
ref|XP_006362738.1|  PREDICTED: heterogeneous nuclear ribonucleop...    138   5e-35   
ref|XP_011080479.1|  PREDICTED: UBP1-associated protein 2A-like         138   7e-35   Sesamum indicum [beniseed]
ref|NP_001274776.1|  heterogeneous nuclear ribonucleoprotein A2 h...    137   8e-35   Solanum tuberosum [potatoes]
ref|XP_009404688.1|  PREDICTED: UBP1-associated protein 2B-like         137   8e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_007162310.1|  hypothetical protein PHAVU_001G141300g             135   8e-35   Phaseolus vulgaris [French bean]
ref|XP_010031654.1|  PREDICTED: UBP1-associated protein 2B-like         137   9e-35   Eucalyptus grandis [rose gum]
ref|XP_006492883.1|  PREDICTED: RNA-binding protein Musashi homol...    135   1e-34   Citrus sinensis [apfelsine]
ref|XP_004228485.1|  PREDICTED: UBP1-associated protein 2A              137   1e-34   
gb|ACF83094.1|  unknown                                                 136   1e-34   Zea mays [maize]
tpg|DAA54065.1|  TPA: hypothetical protein ZEAMMB73_489429              136   1e-34   
ref|XP_002457616.1|  hypothetical protein SORBIDRAFT_03g010380          136   2e-34   Sorghum bicolor [broomcorn]
ref|XP_008805340.1|  PREDICTED: UBP1-associated protein 2A-like         137   2e-34   Phoenix dactylifera
gb|ACF84316.1|  unknown                                                 136   2e-34   Zea mays [maize]
ref|XP_008453765.1|  PREDICTED: UBP1-associated protein 2B-like         135   2e-34   Cucumis melo [Oriental melon]
ref|XP_008672918.1|  PREDICTED: RNA binding protein isoform X1          136   2e-34   Zea mays [maize]
ref|NP_001149939.1|  RNA binding protein                                136   2e-34   Zea mays [maize]
ref|XP_010251683.1|  PREDICTED: UBP1-associated protein 2A              135   4e-34   Nelumbo nucifera [Indian lotus]
ref|XP_008240947.1|  PREDICTED: UBP1-associated protein 2C-like         133   4e-34   Prunus mume [ume]
gb|EYU20704.1|  hypothetical protein MIMGU_mgv1a0010912mg               132   6e-34   Erythranthe guttata [common monkey flower]
ref|XP_003632233.2|  PREDICTED: UBP1-associated protein 2A              135   6e-34   Vitis vinifera
ref|XP_006850028.1|  hypothetical protein AMTR_s00022p00189710          133   7e-34   Amborella trichopoda
emb|CAN80681.1|  hypothetical protein VITISV_037734                     135   7e-34   Vitis vinifera
ref|XP_004149162.1|  PREDICTED: uncharacterized protein LOC101213550    134   9e-34   Cucumis sativus [cucumbers]
emb|CBI24384.3|  unnamed protein product                                134   9e-34   Vitis vinifera
ref|XP_004163497.1|  PREDICTED: uncharacterized protein LOC101228639    134   9e-34   
ref|XP_004967762.1|  PREDICTED: nuclear localization sequence-bin...    134   1e-33   Setaria italica
ref|XP_007141558.1|  hypothetical protein PHAVU_008G206200g             134   1e-33   Phaseolus vulgaris [French bean]
gb|KGN53237.1|  hypothetical protein Csa_4G031080                       133   2e-33   Cucumis sativus [cucumbers]
gb|EPS65588.1|  hypothetical protein M569_09190                         133   3e-33   Genlisea aurea
ref|XP_010261157.1|  PREDICTED: UBP1-associated protein 2A-like         132   3e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004148449.1|  PREDICTED: uncharacterized protein LOC101211535    133   3e-33   Cucumis sativus [cucumbers]
ref|XP_006429841.1|  hypothetical protein CICLE_v10013551mg             135   4e-33   
gb|KDO50156.1|  hypothetical protein CISIN_1g045707mg                   135   4e-33   Citrus sinensis [apfelsine]
ref|XP_010525452.1|  PREDICTED: UBP1-associated protein 2A-like         132   7e-33   Tarenaya hassleriana [spider flower]
gb|KJB56079.1|  hypothetical protein B456_009G105900                    132   7e-33   Gossypium raimondii
ref|XP_006645744.1|  PREDICTED: heterogeneous nuclear ribonucleop...    131   8e-33   
ref|XP_010534355.1|  PREDICTED: UBP1-associated protein 2C-like         130   8e-33   Tarenaya hassleriana [spider flower]
ref|XP_010230747.1|  PREDICTED: UBP1-associated protein 2B-like         132   9e-33   Brachypodium distachyon [annual false brome]
ref|XP_002968180.1|  hypothetical protein SELMODRAFT_169811             129   9e-33   
ref|XP_010939599.1|  PREDICTED: UBP1-associated protein 2B-like         132   1e-32   
ref|XP_007016698.1|  RNA-binding family protein, putative isoform 1     131   1e-32   
ref|XP_008457902.1|  PREDICTED: UBP1-associated protein 2A-like         131   2e-32   Cucumis melo [Oriental melon]
ref|XP_011004820.1|  PREDICTED: UBP1-associated protein 2A-like         129   2e-32   Populus euphratica
ref|XP_002270568.1|  PREDICTED: UBP1-associated protein 2A              130   2e-32   Vitis vinifera
emb|CAN72884.1|  hypothetical protein VITISV_028589                     130   2e-32   Vitis vinifera
ref|XP_007204289.1|  hypothetical protein PRUPE_ppa001255mg             133   2e-32   
ref|XP_010108565.1|  Heterogeneous nuclear ribonucleoprotein            128   3e-32   
ref|XP_002322576.1|  RNA recognition motif-containing family protein    130   3e-32   
ref|XP_004493289.1|  PREDICTED: heterogeneous nuclear ribonucleop...    130   3e-32   Cicer arietinum [garbanzo]
emb|CDP10118.1|  unnamed protein product                                129   4e-32   Coffea canephora [robusta coffee]
emb|CDP05989.1|  unnamed protein product                                129   4e-32   Coffea canephora [robusta coffee]
ref|XP_009611222.1|  PREDICTED: UBP1-associated protein 2C-like         129   4e-32   Nicotiana tomentosiformis
gb|AET00091.2|  RNA recognition motif                                   130   4e-32   Medicago truncatula
ref|XP_009773671.1|  PREDICTED: UBP1-associated protein 2B-like         130   5e-32   Nicotiana sylvestris
ref|XP_003617132.1|  Heterogeneous nuclear ribonucleoprotein D0         130   5e-32   
ref|XP_009622309.1|  PREDICTED: UBP1-associated protein 2B-like         129   7e-32   Nicotiana tomentosiformis
gb|KJB20258.1|  hypothetical protein B456_003G140900                    129   7e-32   Gossypium raimondii
ref|XP_011041306.1|  PREDICTED: UBP1-associated protein 2A-like         129   8e-32   Populus euphratica
gb|KHG29236.1|  Heterogeneous nuclear ribonucleoprotein D0              129   9e-32   Gossypium arboreum [tree cotton]
ref|XP_002878114.1|  hypothetical protein ARALYDRAFT_486125             129   1e-31   
ref|XP_008801015.1|  PREDICTED: UBP1-associated protein 2B-like         128   1e-31   Phoenix dactylifera
dbj|BAE71253.1|  hypothetical protein                                   128   2e-31   Trifolium pratense [peavine clover]
gb|KJB26171.1|  hypothetical protein B456_004G228200                    128   2e-31   Gossypium raimondii
gb|ABD28657.1|  RNA-binding region RNP-1 (RNA recognition motif)        128   2e-31   Medicago truncatula
ref|XP_010108566.1|  Uncharacterized RNA-binding protein                128   2e-31   Morus notabilis
gb|AEW09371.1|  hypothetical protein UMN_7377_01                        122   2e-31   Pinus radiata
gb|AAM73765.1|AF403292_1  RNA-binding protein AKIP1                     128   2e-31   Vicia faba [broad bean]
dbj|BAE71267.1|  hypothetical protein                                   128   2e-31   Trifolium pratense [peavine clover]
gb|KHG10711.1|  Heterogeneous nuclear ribonucleoprotein A/B             128   2e-31   Gossypium arboreum [tree cotton]
gb|AFG51193.1|  hypothetical protein UMN_7377_01                        121   2e-31   Pinus taeda
ref|XP_003624837.1|  RNA-binding protein                                128   2e-31   
ref|XP_011033238.1|  PREDICTED: UBP1-associated protein 2C-like         126   2e-31   Populus euphratica
ref|XP_003624838.1|  RNA-binding protein                                128   2e-31   
ref|XP_001782704.1|  predicted protein                                  120   2e-31   
ref|XP_004289264.1|  PREDICTED: UBP1-associated protein 2B-like         128   2e-31   Fragaria vesca subsp. vesca
gb|KHG16393.1|  Heterogeneous nuclear ribonucleoprotein D0              127   2e-31   Gossypium arboreum [tree cotton]
ref|XP_002307930.1|  RNA recognition motif-containing family protein    127   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_010554751.1|  PREDICTED: UBP1-associated protein 2A-like         127   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_009419696.1|  PREDICTED: UBP1-associated protein 2A-like         127   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN38428.1|  Putative RNA-binding protein                            127   4e-31   Glycine soja [wild soybean]
ref|XP_006575610.1|  PREDICTED: nuclear polyadenylated RNA-bindin...    127   4e-31   
ref|XP_007205101.1|  hypothetical protein PRUPE_ppa004648mg             127   5e-31   Prunus persica
gb|KDO57339.1|  hypothetical protein CISIN_1g011975mg                   126   5e-31   Citrus sinensis [apfelsine]
ref|XP_006836157.1|  hypothetical protein AMTR_s00101p00040700          127   5e-31   Amborella trichopoda
ref|XP_010542227.1|  PREDICTED: UBP1-associated protein 2A-like         127   5e-31   Tarenaya hassleriana [spider flower]
ref|XP_011040665.1|  PREDICTED: UBP1-associated protein 2B-like         127   5e-31   Populus euphratica
ref|XP_003545465.1|  PREDICTED: nuclear polyadenylated RNA-bindin...    126   7e-31   Glycine max [soybeans]
ref|XP_008245997.1|  PREDICTED: UBP1-associated protein 2A-like         126   7e-31   
ref|XP_009116386.1|  PREDICTED: UBP1-associated protein 2A              126   7e-31   Brassica rapa
emb|CDX72106.1|  BnaC08g27680D                                          126   8e-31   
ref|XP_009800639.1|  PREDICTED: UBP1-associated protein 2C-like         125   8e-31   Nicotiana sylvestris
ref|XP_009386889.1|  PREDICTED: UBP1-associated protein 2B-like         126   8e-31   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010906042.1|  PREDICTED: UBP1-associated protein 2A-like         126   9e-31   
ref|XP_008805349.1|  PREDICTED: UBP1-associated protein 2A-like         125   1e-30   Phoenix dactylifera
emb|CDY27186.1|  BnaA09g36160D                                          125   1e-30   Brassica napus [oilseed rape]
gb|KDO57341.1|  hypothetical protein CISIN_1g011975mg                   125   1e-30   Citrus sinensis [apfelsine]
ref|XP_001775204.1|  predicted protein                                  120   1e-30   
ref|XP_008376122.1|  PREDICTED: UBP1-associated protein 2A-like         125   1e-30   
ref|XP_008376121.1|  PREDICTED: UBP1-associated protein 2A-like         125   2e-30   
ref|XP_008362432.1|  PREDICTED: UBP1-associated protein 2A-like         125   2e-30   
ref|XP_010108564.1|  Heterogeneous nuclear ribonucleoprotein            125   2e-30   Morus notabilis
gb|KDP21974.1|  hypothetical protein JCGZ_03187                         125   2e-30   Jatropha curcas
ref|XP_006481969.1|  PREDICTED: protein gar2-like isoform X1            125   2e-30   Citrus sinensis [apfelsine]
gb|KDO57340.1|  hypothetical protein CISIN_1g011975mg                   125   2e-30   Citrus sinensis [apfelsine]
ref|XP_006430420.1|  hypothetical protein CICLE_v10011637mg             125   2e-30   Citrus clementina [clementine]
emb|CDM80736.1|  unnamed protein product                                125   2e-30   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010505869.1|  PREDICTED: UBP1-associated protein 2B-like         124   3e-30   Camelina sativa [gold-of-pleasure]
ref|XP_010060843.1|  PREDICTED: UBP1-associated protein 2B-like         125   3e-30   Eucalyptus grandis [rose gum]
ref|NP_001042672.2|  Os01g0265800                                       125   3e-30   
ref|XP_006402940.1|  hypothetical protein EUTSA_v10005930mg             124   4e-30   Eutrema salsugineum [saltwater cress]
dbj|BAA90354.1|  putative UBP1 interacting protein 1a                   124   4e-30   Oryza sativa Japonica Group [Japonica rice]
gb|EMS57325.1|  Nuclear polyadenylated RNA-binding protein 4            124   4e-30   Triticum urartu
gb|KDP37881.1|  hypothetical protein JCGZ_05763                         124   4e-30   Jatropha curcas
ref|XP_006294216.1|  hypothetical protein CARUB_v10023213mg             122   5e-30   
ref|XP_002529501.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    124   6e-30   Ricinus communis
ref|XP_008779432.1|  PREDICTED: UBP1-associated protein 2B-like         123   8e-30   Phoenix dactylifera
ref|XP_002276040.1|  PREDICTED: UBP1-associated protein 2A-like         123   1e-29   
ref|NP_181639.1|  RNA recognition motif-containing protein              122   1e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010526638.1|  PREDICTED: UBP1-associated proteins 1A isofo...    121   1e-29   
ref|XP_003554083.1|  PREDICTED: heterogeneous nuclear ribonucleop...    123   1e-29   Glycine max [soybeans]
ref|XP_002879905.1|  RNA recognition motif-containing protein           122   1e-29   Arabidopsis lyrata subsp. lyrata
gb|EMT04032.1|  Nuclear polyadenylated RNA-binding protein 4            122   2e-29   
ref|NP_567042.1|  UBP1-associated protein 2A                            122   2e-29   Arabidopsis thaliana [mouse-ear cress]
gb|AAK68825.1|  putative protein                                        122   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002522097.1|  Heterogeneous nuclear ribonucleoprotein A1, ...    122   2e-29   
ref|XP_010526637.1|  PREDICTED: UBP1-associated proteins 1A isofo...    121   2e-29   
dbj|BAH56834.1|  AT3G56860                                              122   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006576753.1|  PREDICTED: heterogeneous nuclear ribonucleop...    122   2e-29   Glycine max [soybeans]
ref|XP_010905945.1|  PREDICTED: UBP1-associated protein 2B-like         122   2e-29   Elaeis guineensis
ref|XP_006294217.1|  hypothetical protein CARUB_v10023213mg             122   3e-29   Capsella rubella
ref|XP_010027787.1|  PREDICTED: UBP1-associated proteins 1A-like        120   3e-29   Eucalyptus grandis [rose gum]
ref|XP_010251672.1|  PREDICTED: UBP1-associated protein 2A-like         121   3e-29   Nelumbo nucifera [Indian lotus]
dbj|BAK01483.1|  predicted protein                                      121   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ91407.1|  predicted protein                                      121   4e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006290978.1|  hypothetical protein CARUB_v10017092mg             121   4e-29   Capsella rubella
ref|XP_006339215.1|  PREDICTED: protein gar2-like                       121   5e-29   Solanum tuberosum [potatoes]
ref|XP_010516290.1|  PREDICTED: UBP1-associated protein 2A-like         121   5e-29   
ref|XP_009795399.1|  PREDICTED: UBP1-associated proteins 1A-like        120   5e-29   Nicotiana sylvestris
ref|XP_010427537.1|  PREDICTED: UBP1-associated protein 2A-like         121   5e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010504596.1|  PREDICTED: UBP1-associated protein 2A-like         121   6e-29   
emb|CDY06947.1|  BnaA04g23680D                                          120   8e-29   
ref|XP_009336360.1|  PREDICTED: UBP1-associated protein 2A-like         120   8e-29   
emb|CBI21479.3|  unnamed protein product                                120   8e-29   
ref|XP_009381524.1|  PREDICTED: UBP1-associated protein 2B-like         120   8e-29   
ref|XP_009368420.1|  PREDICTED: UBP1-associated protein 2A              120   8e-29   
ref|XP_002276585.1|  PREDICTED: UBP1-associated protein 2B-like         120   1e-28   
ref|XP_009141969.1|  PREDICTED: UBP1-associated protein 2B              120   1e-28   
ref|XP_008234537.1|  PREDICTED: UBP1-associated protein 2B-like         120   2e-28   
ref|XP_002306336.1|  hypothetical protein POPTR_0005s08340g             119   2e-28   
emb|CBI24383.3|  unnamed protein product                                120   2e-28   
emb|CDX76950.1|  BnaC08g35360D                                          118   2e-28   
ref|XP_007161819.1|  hypothetical protein PHAVU_001G100900g             119   2e-28   
ref|XP_008612831.1|  hypothetical protein SDRG_08714                    119   2e-28   
emb|CDY57580.1|  BnaC04g56830D                                          119   2e-28   
emb|CAN83373.1|  hypothetical protein VITISV_028295                     119   2e-28   
ref|XP_004249359.1|  PREDICTED: UBP1-associated protein 2A-like         119   3e-28   
ref|XP_007205173.1|  hypothetical protein PRUPE_ppa005550mg             119   3e-28   
ref|XP_006411373.1|  hypothetical protein EUTSA_v10016684mg             119   3e-28   
ref|XP_010531407.1|  PREDICTED: LOW QUALITY PROTEIN: UBP1-associa...    118   3e-28   
ref|XP_009587331.1|  PREDICTED: UBP1-associated proteins 1A-like        118   4e-28   
gb|KDP35205.1|  hypothetical protein JCGZ_09364                         118   4e-28   
ref|XP_011021890.1|  PREDICTED: UBP1-associated protein 2B-like         117   6e-28   
ref|XP_007048070.1|  RNA-binding (RRM/RBD/RNP motifs) family protein    117   6e-28   
ref|NP_565525.1|  UBP1 interacting protein 1a                           117   7e-28   
gb|AAM66107.1|  putative RNA-binding protein                            117   7e-28   
ref|NP_850021.1|  UBP1 interacting protein 1a                           117   8e-28   
ref|XP_008780851.1|  PREDICTED: UBP1-associated protein 2B-like i...    117   8e-28   
ref|XP_008780845.1|  PREDICTED: UBP1-associated protein 2B-like i...    117   9e-28   
emb|CAD28134.1|  UBP1 interacting protein 1a                            116   1e-27   
ref|XP_002880416.1|  hypothetical protein ARALYDRAFT_481072             116   1e-27   
ref|XP_010517587.1|  PREDICTED: UBP1-associated protein 2B-like         117   1e-27   
emb|CDP01398.1|  unnamed protein product                                117   1e-27   
gb|KDO29201.1|  hypothetical protein SPRG_05436                         116   1e-27   
ref|XP_007151509.1|  hypothetical protein PHAVU_004G052900g             117   1e-27   
ref|NP_001148086.1|  LOC100281694                                       117   2e-27   
ref|XP_010926240.1|  PREDICTED: UBP1-associated protein 2B-like i...    117   2e-27   
ref|XP_010926239.1|  PREDICTED: UBP1-associated protein 2B-like i...    117   2e-27   
ref|XP_006827043.1|  hypothetical protein AMTR_s00010p00228130          116   2e-27   
ref|XP_008365601.1|  PREDICTED: UBP1-associated protein 2C-like i...    114   2e-27   
ref|XP_010474412.1|  PREDICTED: UBP1-associated proteins 1A-like        113   2e-27   
ref|XP_010429123.1|  PREDICTED: UBP1-associated proteins 1A-like ...    115   3e-27   
ref|XP_010429124.1|  PREDICTED: UBP1-associated proteins 1A-like ...    115   3e-27   
dbj|BAJ90049.1|  predicted protein                                      116   3e-27   
ref|XP_010429122.1|  PREDICTED: UBP1-associated proteins 1A-like ...    115   3e-27   
ref|XP_011006046.1|  PREDICTED: UBP1-associated protein 2A-like         115   4e-27   
ref|XP_006404660.1|  hypothetical protein EUTSA_v10000207mg             115   4e-27   
ref|XP_002298288.1|  hypothetical protein POPTR_0001s22780g             115   4e-27   
gb|EYU35639.1|  hypothetical protein MIMGU_mgv1a006264mg                115   5e-27   
ref|XP_010045124.1|  PREDICTED: UBP1-associated protein 2B-like         115   8e-27   
ref|XP_006296446.1|  hypothetical protein CARUB_v10025628mg             114   8e-27   
ref|XP_010416965.1|  PREDICTED: UBP1-associated proteins 1A-like ...    114   1e-26   
ref|XP_010416966.1|  PREDICTED: UBP1-associated proteins 1A-like ...    114   1e-26   
ref|XP_002448611.1|  hypothetical protein SORBIDRAFT_06g030090          114   2e-26   
ref|XP_002880417.1|  hypothetical protein ARALYDRAFT_481073             113   2e-26   
ref|XP_009117352.1|  PREDICTED: UBP1-associated proteins 1A isofo...    112   3e-26   
ref|XP_009117351.1|  PREDICTED: UBP1-associated proteins 1A isofo...    112   3e-26   
emb|CDY13782.1|  BnaA09g42840D                                          112   3e-26   
ref|XP_006404661.1|  hypothetical protein EUTSA_v10000197mg             112   4e-26   
ref|XP_009607897.1|  PREDICTED: UBP1-associated protein 2C-like         112   4e-26   
ref|XP_011069983.1|  PREDICTED: UBP1-associated protein 2A-like         112   5e-26   
ref|XP_010472205.1|  PREDICTED: UBP1-associated proteins 1A-like ...    112   6e-26   
ref|XP_010472204.1|  PREDICTED: UBP1-associated proteins 1A-like ...    112   6e-26   
ref|XP_010472203.1|  PREDICTED: UBP1-associated proteins 1A-like ...    112   6e-26   
ref|XP_010240494.1|  PREDICTED: UBP1-associated protein 2B-like         113   6e-26   
ref|XP_008667033.1|  PREDICTED: uncharacterized protein LOC100191...    112   7e-26   
ref|XP_010472201.1|  PREDICTED: UBP1-associated proteins 1A-like ...    112   8e-26   
emb|CBJ30102.1|  Uncharacterized protein                                112   9e-26   
ref|XP_010416967.1|  PREDICTED: UBP1-associated proteins 1B-like        110   2e-25   
ref|XP_006295754.1|  hypothetical protein CARUB_v10024874mg             110   2e-25   
ref|XP_009413612.1|  PREDICTED: UBP1-associated protein 2B-like         110   2e-25   
ref|XP_009393537.1|  PREDICTED: UBP1-associated protein 2B-like         110   2e-25   
ref|XP_010472199.1|  PREDICTED: UBP1-associated proteins 1B-like        110   2e-25   
ref|XP_002886045.1|  hypothetical protein ARALYDRAFT_480534             112   3e-25   
ref|XP_008869796.1|  hypothetical protein H310_06482                    110   3e-25   
ref|NP_565526.1|  RNA-binding (RRM/RBD/RNP motifs) family protein       110   3e-25   
gb|AAM65774.1|  putative RNA-binding protein                            110   3e-25   
ref|NP_565450.1|  RNA recognition motif (RRM)-containing protein        112   3e-25   
ref|XP_006428097.1|  hypothetical protein CICLE_v10025608mg             109   4e-25   
emb|CCA20310.1|  hypothetical protein SELMODRAFT_151090                 108   5e-25   
ref|XP_004976971.1|  PREDICTED: RNA-binding protein Musashi homol...    110   5e-25   
gb|KDO43930.1|  hypothetical protein CISIN_1g013270mg                   109   6e-25   
ref|XP_006428098.1|  hypothetical protein CICLE_v10025608mg             109   7e-25   
ref|XP_004304845.1|  PREDICTED: UBP1-associated protein 2A isofor...    108   1e-24   
ref|XP_011466107.1|  PREDICTED: UBP1-associated protein 2A isofor...    108   1e-24   
gb|KFK32844.1|  hypothetical protein AALP_AA6G294100                    108   1e-24   
gb|EPS68766.1|  hypothetical protein M569_05999                         108   2e-24   
ref|XP_010467882.1|  PREDICTED: UBP1-associated proteins 1C-like        110   2e-24   
ref|XP_009836728.1|  hypothetical protein, variant 1                    108   2e-24   
ref|XP_009795994.1|  PREDICTED: UBP1-associated protein 2A-like         107   2e-24   
ref|XP_010099921.1|  Heterogeneous nuclear ribonucleoprotein D0         107   3e-24   
ref|XP_010489488.1|  PREDICTED: UBP1-associated proteins 1C-like        108   4e-24   
ref|XP_010415292.1|  PREDICTED: UBP1-associated proteins 1C-like        108   4e-24   
ref|XP_010463448.1|  PREDICTED: UBP1-associated protein 2C-like         106   6e-24   
ref|XP_010429127.1|  PREDICTED: UBP1-associated proteins 1B-like        106   6e-24   
ref|NP_001054022.1|  Os04g0636900                                       107   1e-23   
ref|XP_006297288.1|  hypothetical protein CARUB_v10013303mg             107   1e-23   
ref|XP_009395825.1|  PREDICTED: UBP1-associated protein 2B-like         106   1e-23   
ref|XP_006346705.1|  PREDICTED: RNA-binding protein squid-like          105   1e-23   
ref|XP_002983882.1|  hypothetical protein SELMODRAFT_27842              101   1e-23   
ref|XP_011097631.1|  PREDICTED: UBP1-associated protein 2A-like         105   2e-23   
emb|CDY15850.1|  BnaA04g12610D                                          105   2e-23   
ref|XP_009592999.1|  PREDICTED: UBP1-associated protein 2A-like         105   2e-23   
ref|XP_009140321.1|  PREDICTED: UBP1-associated proteins 1B             104   2e-23   
gb|KJB61633.1|  hypothetical protein B456_009G371500                  99.4    3e-23   
gb|KFK40302.1|  hypothetical protein AALP_AA3G357400                    106   4e-23   
emb|CCI10272.1|  unnamed protein product                                103   7e-23   
gb|ABF94944.1|  RNA-binding region containing protein 1, putative     97.4    3e-22   
emb|CDO98672.1|  unnamed protein product                                102   4e-22   
gb|KHN26020.1|  Putative RNA-binding protein                            101   6e-22   
ref|XP_002267504.2|  PREDICTED: RNA-binding protein 38 isoform X2     98.6    2e-21   
ref|XP_010661490.1|  PREDICTED: RNA-binding protein 38 isoform X1     98.6    2e-21   
gb|AAM65641.1|  unknown                                               95.9    2e-21   
gb|KHN15883.1|  RNA-binding protein 24                                98.2    2e-21   
ref|XP_006599765.1|  PREDICTED: RNA-binding protein 24-like           97.8    3e-21   
gb|KJB24006.1|  hypothetical protein B456_004G124700                  97.8    3e-21   
gb|KJB24005.1|  hypothetical protein B456_004G124700                  97.8    3e-21   
gb|EEE58687.1|  hypothetical protein OsJ_10122                        97.4    4e-21   
ref|XP_010526639.1|  PREDICTED: LOW QUALITY PROTEIN: UBP1-associa...  98.2    4e-21   
gb|KHG09039.1|  RNA-binding 38                                        97.4    4e-21   
ref|XP_004236739.1|  PREDICTED: UBP1-associated protein 2B-like       99.4    4e-21   
ref|XP_007208571.1|  hypothetical protein PRUPE_ppa023522mg           98.2    5e-21   
ref|NP_564168.2|  RNA recognition motif-containing protein            97.8    5e-21   
ref|XP_010498704.1|  PREDICTED: RNA-binding protein 24-like           94.7    5e-21   
ref|XP_010252040.1|  PREDICTED: RNA-binding protein 24-B-like iso...  97.4    5e-21   
ref|XP_010252048.1|  PREDICTED: RNA-binding protein 38-like isofo...  97.4    5e-21   
ref|XP_010252031.1|  PREDICTED: RNA-binding protein 24-like isofo...  97.4    6e-21   
ref|XP_010252022.1|  PREDICTED: RNA-binding protein 24-like isofo...  97.4    6e-21   
ref|XP_011025379.1|  PREDICTED: RNA-binding protein 24-B isoform X2   97.1    6e-21   
ref|XP_006651214.1|  PREDICTED: RNA-binding protein 24-like           97.1    6e-21   
ref|XP_010917972.1|  PREDICTED: RNA-binding protein 24-like           97.1    8e-21   
ref|XP_010477493.1|  PREDICTED: RNA-binding protein 24                96.7    1e-20   
ref|XP_010267393.1|  PREDICTED: RNA-binding protein 38-like isofo...  96.3    1e-20   
ref|XP_011025377.1|  PREDICTED: RNA-binding protein 24-B isoform X1   96.7    1e-20   
ref|XP_004502740.1|  PREDICTED: RNA-binding protein 24-like           95.9    1e-20   
gb|AFW84411.1|  hypothetical protein ZEAMMB73_895673                  92.8    1e-20   
ref|XP_002890509.1|  hypothetical protein ARALYDRAFT_313119           96.7    1e-20   
ref|XP_010267392.1|  PREDICTED: RNA-binding protein 38-like isofo...  96.3    1e-20   
ref|XP_010267394.1|  PREDICTED: RNA-binding protein 38-like isofo...  96.3    1e-20   
ref|XP_010267391.1|  PREDICTED: RNA-binding protein 38-like isofo...  96.3    1e-20   
ref|XP_002979581.1|  hypothetical protein SELMODRAFT_38604            92.0    2e-20   
ref|XP_010091178.1|  RNA-binding protein 24                           95.1    2e-20   
ref|XP_002301439.2|  hypothetical protein POPTR_0002s17990g           95.9    2e-20   
ref|XP_010459986.1|  PREDICTED: RNA-binding protein 24-like           95.5    2e-20   
gb|KHG03974.1|  RNA-binding 38                                        95.9    2e-20   
ref|XP_006304067.1|  hypothetical protein CARUB_v10009918mg           95.5    2e-20   
gb|KJB09577.1|  hypothetical protein B456_001G150700                  95.9    3e-20   
ref|XP_010689715.1|  PREDICTED: RNA-binding protein 24                95.5    3e-20   
gb|KJB09578.1|  hypothetical protein B456_001G150700                  95.5    3e-20   
ref|XP_010107154.1|  RNA-binding protein 38                           95.1    3e-20   
ref|NP_001130367.1|  uncharacterized protein LOC100191462             96.3    3e-20   
ref|XP_006833255.1|  hypothetical protein AMTR_s00113p00116350        95.5    3e-20   
gb|ABK93394.1|  unknown                                               95.5    3e-20   
ref|XP_007135317.1|  hypothetical protein PHAVU_010G119200g           95.1    3e-20   
emb|CDX88432.1|  BnaC06g38760D                                        95.1    3e-20   
ref|XP_002320228.2|  hypothetical protein POPTR_0014s10090g           95.1    3e-20   
gb|KJB09579.1|  hypothetical protein B456_001G150700                  95.5    3e-20   
ref|NP_001058102.1|  Os06g0622900                                     94.7    4e-20   
ref|XP_011043703.1|  PREDICTED: RNA-binding protein 24-B-like iso...  94.7    4e-20   
gb|KFK44330.1|  hypothetical protein AALP_AA1G244200                  95.1    4e-20   
ref|XP_011043702.1|  PREDICTED: RNA-binding protein 24-B-like iso...  94.7    4e-20   
ref|XP_011043704.1|  PREDICTED: RNA-binding protein 38-like isofo...  94.7    4e-20   
ref|XP_009106533.1|  PREDICTED: RNA-binding protein 24 isoform X1     94.7    5e-20   
ref|XP_004953965.1|  PREDICTED: RNA-binding protein 38-like           95.1    5e-20   
ref|XP_008791369.1|  PREDICTED: RNA-binding protein 24-B-like iso...  94.4    5e-20   
ref|XP_008791368.1|  PREDICTED: RNA-binding protein 24-like isofo...  94.7    5e-20   
ref|XP_009106537.1|  PREDICTED: RNA-binding protein 24 isoform X4     94.7    5e-20   
ref|XP_002887731.1|  hypothetical protein ARALYDRAFT_476993           94.4    6e-20   
gb|KEH35485.1|  RNA-binding (RRM/RBD/RNP motif) family protein        92.8    6e-20   
emb|CDP01753.1|  unnamed protein product                              94.4    7e-20   
gb|EEC80998.1|  hypothetical protein OsI_23744                        94.7    7e-20   
ref|NP_565175.1|  RNA recognition motif-containing protein            94.4    7e-20   
gb|AAF71806.1|AC013430_15  F3F9.20                                    94.4    7e-20   
ref|XP_007051436.1|  RNA-binding family protein isoform 1             94.4    8e-20   
ref|XP_007051437.1|  RNA-binding family protein isoform 2             94.4    8e-20   
gb|EEE66037.1|  hypothetical protein OsJ_22014                        94.4    8e-20   
gb|KHG05586.1|  RNA-binding 38                                        93.2    9e-20   
gb|KDP24217.1|  hypothetical protein JCGZ_25874                       93.6    9e-20   
gb|KHN39756.1|  RNA-binding protein 24                                91.3    9e-20   
gb|KDP28419.1|  hypothetical protein JCGZ_14190                       94.0    1e-19   
ref|XP_010906054.1|  PREDICTED: RNA-binding protein 24-B-like         93.6    1e-19   
ref|XP_008779610.1|  PREDICTED: RNA-binding protein 24-like           90.5    1e-19   
ref|XP_002452408.1|  hypothetical protein SORBIDRAFT_04g025205        94.4    1e-19   
ref|XP_009392020.1|  PREDICTED: RNA-binding protein 38-like           91.7    1e-19   
ref|XP_010269321.1|  PREDICTED: RNA-binding protein 38-like isofo...  93.6    1e-19   
ref|NP_974169.1|  RNA recognition motif-containing protein            93.6    1e-19   
ref|XP_010269319.1|  PREDICTED: RNA-binding protein 38-like isofo...  93.6    1e-19   
gb|EMT32381.1|  RNA-binding protein 24-B                              91.7    1e-19   
gb|KHN06357.1|  RNA-binding protein 38                                93.6    1e-19   
ref|XP_006598881.1|  PREDICTED: RNA-binding protein 24-A-like iso...  93.6    1e-19   
ref|XP_003529876.1|  PREDICTED: RNA-binding protein 24-B-like         93.6    2e-19   
ref|XP_004306619.1|  PREDICTED: RNA-binding protein 38                93.2    2e-19   
ref|XP_011044727.1|  PREDICTED: RNA-binding protein 38-like isofo...  92.8    2e-19   
dbj|BAK07258.1|  predicted protein                                    93.2    2e-19   
gb|KJB41621.1|  hypothetical protein B456_007G112700                  93.2    2e-19   
ref|XP_010542619.1|  PREDICTED: RNA-binding protein 38 isoform X1     92.4    2e-19   
ref|XP_006390004.1|  hypothetical protein EUTSA_v10018959mg           93.2    2e-19   
ref|XP_008233052.1|  PREDICTED: RNA-binding protein 24-B              93.2    2e-19   
ref|XP_007221059.1|  hypothetical protein PRUPE_ppa016222mg           93.2    2e-19   
dbj|BAD43512.1|  putative RNA-binding protein                         92.8    2e-19   
ref|XP_006598880.1|  PREDICTED: RNA-binding protein 24-A-like iso...  93.2    2e-19   
ref|XP_010542626.1|  PREDICTED: RNA-binding protein 38 isoform X2     92.4    2e-19   
ref|XP_006598882.1|  PREDICTED: RNA-binding protein 24-A-like iso...  93.2    2e-19   
ref|XP_008363641.1|  PREDICTED: LOW QUALITY PROTEIN: UBP1-associa...  93.6    2e-19   
ref|XP_010416805.1|  PREDICTED: RNA-binding protein 24-like isofo...  93.2    2e-19   
ref|XP_010416803.1|  PREDICTED: RNA-binding protein 24-like isofo...  93.2    2e-19   
ref|XP_007039188.1|  RNA-binding family protein, putative             93.2    2e-19   
ref|XP_003534424.1|  PREDICTED: RNA-binding protein 24-like isofo...  92.8    2e-19   
gb|KJB11534.1|  hypothetical protein B456_001G263900                  90.1    2e-19   
ref|XP_010428947.1|  PREDICTED: RNA-binding protein 24 isoform X1     92.8    2e-19   
ref|XP_007135310.1|  hypothetical protein PHAVU_010G118600g           93.2    2e-19   
ref|XP_011039250.1|  PREDICTED: RNA-binding protein 24-B-like iso...  93.2    2e-19   
ref|XP_011039241.1|  PREDICTED: RNA-binding protein 24-B-like iso...  93.2    2e-19   
ref|XP_003602355.1|  RNA-binding protein 24-B                         92.4    2e-19   
ref|XP_010472037.1|  PREDICTED: RNA-binding protein 24-like isofo...  92.8    2e-19   
ref|XP_010472035.1|  PREDICTED: RNA-binding protein 24-like isofo...  92.8    2e-19   
ref|XP_006657147.1|  PREDICTED: RNA-binding protein 24-A-like         92.8    2e-19   
ref|XP_007135311.1|  hypothetical protein PHAVU_010G118600g           92.8    2e-19   
gb|KEH35484.1|  RNA-binding (RRM/RBD/RNP motif) family protein        92.4    2e-19   
ref|XP_006302644.1|  hypothetical protein CARUB_v10020748mg           92.8    2e-19   
ref|XP_010428948.1|  PREDICTED: RNA-binding protein 24 isoform X2     92.8    2e-19   



>ref|XP_006358946.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like [Solanum tuberosum]
Length=446

 Score =   256 bits (655),  Expect = 4e-80, Method: Compositional matrix adjust.
 Identities = 135/171 (79%), Positives = 154/171 (90%), Gaps = 0/171 (0%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD MKKRKLEDNGVV+D     RLS+EDARKILES T +Q+ EI+QNAVVRHPDVL  VR
Sbjct  1    MDSMKKRKLEDNGVVTDVPVASRLSIEDARKILESVTPEQMLEILQNAVVRHPDVLDQVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             I D+D T+RKLF+RGLGWETTT+K+RS+F T+GELEEAVVILDK TGKSKGYGF+TFKH
Sbjct  61   EIVDRDATKRKLFVRGLGWETTTEKIRSIFGTFGELEEAVVILDKNTGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALK+PSK IDGR+TVTQLA+AG+QGGPGGGSSNNPVD+SLRKIYV
Sbjct  121  VDGALLALKQPSKHIDGRVTVTQLASAGIQGGPGGGSSNNPVDVSLRKIYV  171


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  ++++   F  YGE+EE  +  DKATGKSKGY    +K  + A 
Sbjct  163  DVSLRKIYVSNVPYDMQSERILQHFLMYGEIEEGPLGFDKATGKSKGYALFVYKTAEAAQ  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG     +LA
Sbjct  223  SSLVDPVKNIDGHQLNCKLA  242



>ref|XP_004251889.1| PREDICTED: UBP1-associated protein 2C-like [Solanum lycopersicum]
Length=440

 Score =   250 bits (639),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 132/171 (77%), Positives = 152/171 (89%), Gaps = 0/171 (0%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD MKKRKLEDNGV +D     RLS+ED RKILES T +Q+ EI+QNAVVRHPDVL  VR
Sbjct  1    MDQMKKRKLEDNGVGTDVPVANRLSIEDGRKILESVTPEQMVEILQNAVVRHPDVLDQVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             I D+D T+RKLF+RGLGWETTT+K+RS+F T+GELEEAVVILDK TGKSKGYGF+TFKH
Sbjct  61   EIVDRDPTKRKLFVRGLGWETTTEKIRSIFGTFGELEEAVVILDKNTGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALK+PSK +DGR+TVTQLA+AG+QGGPGGGSSNNPVD+SLRKIYV
Sbjct  121  VDGALLALKQPSKHVDGRVTVTQLASAGIQGGPGGGSSNNPVDVSLRKIYV  171


 Score = 61.6 bits (148),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  ++++   F  YGE+EE  +  DKATGKSKGY    +K  + A 
Sbjct  163  DVSLRKIYVSNVPYDMQSERILQHFLMYGEIEEGPLGFDKATGKSKGYALFVYKTAEAAQ  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG     +LA
Sbjct  223  SSLVDPVKNIDGHQLNCKLA  242



>ref|XP_009605426.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
 ref|XP_009605427.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
 ref|XP_009605428.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
 ref|XP_009605429.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
Length=454

 Score =   244 bits (622),  Expect = 4e-75, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD +KKRKLEDNGV++D     RL++EDARKILES T +Q+ EI+Q AVVRH DVL  VR
Sbjct  1    MDLLKKRKLEDNGVITDVPVTSRLTIEDARKILESVTPEQMLEILQTAVVRHADVLDQVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             IAD+DTTQRKLFIRGLGWET T+KL+++F  YGELEEAVVI DKATGKSKGYGF+TFKH
Sbjct  61   VIADRDTTQRKLFIRGLGWETNTEKLKAIFGNYGELEEAVVITDKATGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALKEPSK+IDGRM VTQLA+AG+QGGPGGGS+NNPVD+S RKIYV
Sbjct  121  VDGALLALKEPSKKIDGRMAVTQLASAGIQGGPGGGSTNNPVDVSARKIYV  171


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   +++   F  YGE+EE  +  DKATGKSKGY    +K  + A 
Sbjct  163  DVSARKIYVANVPYDMQAERILQHFCMYGEIEEGPLGFDKATGKSKGYALFVYKTAEAAK  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG     +LA
Sbjct  223  ASLVDPVKNIDGHQLNCKLA  242



>ref|XP_009760192.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
 ref|XP_009760193.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
 ref|XP_009760194.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
 ref|XP_009760195.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
 ref|XP_009760196.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
Length=454

 Score =   243 bits (621),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 131/171 (77%), Positives = 151/171 (88%), Gaps = 0/171 (0%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD +KKRKLEDNGV++D     RL++EDARKILES T +Q+ EI+Q AVVRH DVL  VR
Sbjct  1    MDLLKKRKLEDNGVITDVPVTSRLTIEDARKILESVTPEQMLEILQTAVVRHADVLDQVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             IAD+DTTQRKLFIRGLGWET T+KL+++F  YGELEEAVVI DKATGKSKGYGF+TFKH
Sbjct  61   VIADRDTTQRKLFIRGLGWETNTEKLKAIFGNYGELEEAVVINDKATGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALKEPSK+IDGRM VTQLA+AG+QGGPGGGS+NNPVD+S RKIYV
Sbjct  121  VDGALLALKEPSKKIDGRMAVTQLASAGIQGGPGGGSTNNPVDVSARKIYV  171


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   +++   F  YGE+EE  +  DKATGKSKGY    +K  + A 
Sbjct  163  DVSARKIYVANVPYDMQAERILQHFCMYGEIEEGPLGFDKATGKSKGYALFVYKTAEAAK  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG     +LA
Sbjct  223  ASLVDPVKNIDGHQLNCKLA  242



>ref|XP_008226506.1| PREDICTED: UBP1-associated protein 2C [Prunus mume]
 ref|XP_008226507.1| PREDICTED: UBP1-associated protein 2C [Prunus mume]
 ref|XP_008226508.1| PREDICTED: UBP1-associated protein 2C [Prunus mume]
 ref|XP_008226509.1| PREDICTED: UBP1-associated protein 2C [Prunus mume]
Length=440

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NGVV  +DPS +P+LS EDARK++E F  DQL +I+Q+AV RH DVL A
Sbjct  1    MDPSKKRKLDENGVVLDTDPSSIPKLSPEDARKLIERFNPDQLIDILQDAVTRHVDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LR+LFS YGELEEA+VILDK TGKS+GYGF+TF
Sbjct  61   VRSIADLDASQRKLFIRGLGWDTTTEGLRALFSAYGELEEAIVILDKVTGKSRGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGALLALKEPSK+IDGRMTVTQLAAAG        SSNN  D+SLRKIYV
Sbjct  121  RHVDGALLALKEPSKKIDGRMTVTQLAAAGNS--SSNVSSNNAADVSLRKIYV  171


 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   DKL + FS YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPADKLLAHFSFYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K I+GR    +LA  G
Sbjct  223  AALVDPVKNIEGRQLTCKLAIDG  245



>ref|XP_007211635.1| hypothetical protein PRUPE_ppa005857mg [Prunus persica]
 gb|EMJ12834.1| hypothetical protein PRUPE_ppa005857mg [Prunus persica]
Length=440

 Score =   239 bits (611),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 124/173 (72%), Positives = 145/173 (84%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NGVV  +DPS +P+LS EDARK++E F  DQL +I+Q+AV RH DVL A
Sbjct  1    MDPSKKRKLDENGVVLDTDPSSIPKLSPEDARKLIERFNPDQLIDILQDAVTRHVDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LR+LFS YGELEEA+VILDK TGKS+GYGF+TF
Sbjct  61   VRSIADLDASQRKLFIRGLGWDTTTEGLRALFSAYGELEEAIVILDKVTGKSRGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGALLALKEPSK+IDGRMTVTQLAAAG        SSNN  D+SLRKIYV
Sbjct  121  RHVDGALLALKEPSKKIDGRMTVTQLAAAGNS--SSNVSSNNAADVSLRKIYV  171


 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   DKL + FS YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPADKLLAHFSFYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K I+GR    +LA  G
Sbjct  223  AALVDPVKNIEGRQLTCKLAIDG  245



>ref|XP_010277758.1| PREDICTED: UBP1-associated protein 2C [Nelumbo nucifera]
 ref|XP_010277759.1| PREDICTED: UBP1-associated protein 2C [Nelumbo nucifera]
 ref|XP_010277760.1| PREDICTED: UBP1-associated protein 2C [Nelumbo nucifera]
Length=438

 Score =   239 bits (610),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 147/174 (84%), Gaps = 5/174 (3%)
 Frame = +2

Query  29   MDF-MKKRKLEDNG-VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD   KKRK ++NG V +D +   +L+LEDAR+I+E FT++QL +I+Q+A VRH DVL A
Sbjct  1    MDLSAKKRKADENGTVAADAALGSKLTLEDARRIIEPFTQEQLLDILQDAAVRHLDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+IAD+D TQRKLFIRGLGW+TTT+ LR+LFSTYG+LEEAVVILDKATGKSKGYGF+TF
Sbjct  61   VRAIADRDLTQRKLFIRGLGWDTTTEGLRTLFSTYGDLEEAVVILDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KHIDGALLALKEPSK+IDGRMTVTQLAAAG     G  ++   VD+SLRKIYVG
Sbjct  121  KHIDGALLALKEPSKKIDGRMTVTQLAAAGTS---GPTANAPAVDVSLRKIYVG  171


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + FS+YGE+EE  +  DK TGKS+G+    +K  + A 
Sbjct  162  DVSLRKIYVGNVPFDMPADRLLAHFSSYGEIEEGPLGFDKQTGKSRGFALFVYKTAEAAK  221

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +P+K IDG   V +LA  G
Sbjct  222  ASLVDPTKTIDGHQMVCKLAIEG  244



>ref|XP_002285377.1| PREDICTED: UBP1-associated protein 2C [Vitis vinifera]
 ref|XP_010644134.1| PREDICTED: UBP1-associated protein 2C [Vitis vinifera]
 emb|CAN66609.1| hypothetical protein VITISV_017556 [Vitis vinifera]
Length=449

 Score =   239 bits (611),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 122/172 (71%), Positives = 143/172 (83%), Gaps = 4/172 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS-DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRK+++NG+VS D   L +L+ EDARKI+E F  DQL EI+QNA VRH DVL A+
Sbjct  1    MDATKKRKMDENGLVSTDGDSLTKLAPEDARKIIEPFGHDQLLEILQNAAVRHLDVLDAI  60

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            RSIAD+D TQRKLFIRGLGW+TTT+ LR LFS YGELEEAVVILDK T KSKGYGF+TFK
Sbjct  61   RSIADRDLTQRKLFIRGLGWDTTTEGLRQLFSAYGELEEAVVILDKVTAKSKGYGFVTFK  120

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGALLALKEPSK+IDGRMTVTQLAA+G+    G  S+ + VD+S+RKIYV
Sbjct  121  HVDGALLALKEPSKKIDGRMTVTQLAASGLS---GPASNASAVDVSMRKIYV  169


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 54/92 (59%), Gaps = 0/92 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   + +  D + RK+++  +  +   D+L + FS+YGE+EE  +  DK TGKS+G+   
Sbjct  152  GPASNASAVDVSMRKIYVANVPVDMPADRLLAHFSSYGEIEEGPLGFDKQTGKSRGFALF  211

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +K  + A  AL +P+K IDGR  V +LA  G
Sbjct  212  VYKTAEAAQAALVDPTKMIDGRQLVCKLAIEG  243



>gb|KJB61641.1| hypothetical protein B456_009G372200 [Gossypium raimondii]
Length=432

 Score =   238 bits (608),  Expect = 3e-73, Method: Compositional matrix adjust.
 Identities = 123/174 (71%), Positives = 146/174 (84%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV---VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG+   VS+P  + +L+ +D RK++E FT DQL +I+Q+AV RH DVL 
Sbjct  4    MDPTKKRKLDENGIISAVSEPDPITKLTPQDGRKLIERFTVDQLLDILQDAVCRHFDVLS  63

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRSIADQD +QRKLFIRGLGW+TTTD LRSLFS YGELEEAVVILDKATGKSKGYGF+T
Sbjct  64   AVRSIADQDPSQRKLFIRGLGWDTTTDGLRSLFSVYGELEEAVVILDKATGKSKGYGFVT  123

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            FKH+DGALLALKEPSK+IDGR+TVTQLAAAG       G++ NPVD+ +RKIYV
Sbjct  124  FKHVDGALLALKEPSKKIDGRVTVTQLAAAG-----NSGTNTNPVDVHMRKIYV  172


 Score = 70.9 bits (172),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + ++   DKL   F+ YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  164  DVHMRKIYVANVPYDMPADKLLGHFAQYGEIEEGPLGFDKQTGKSKGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K IDGR    +LA  G
Sbjct  224  SALVEPVKNIDGRQLNCKLAIEG  246



>ref|XP_008345124.1| PREDICTED: LOW QUALITY PROTEIN: UBP1-associated protein 2C-like 
[Malus domestica]
Length=432

 Score =   237 bits (605),  Expect = 7e-73, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NG+V  +DPS  P+LS EDAR+++E FT DQL +I+Q+A+ RH DVL A
Sbjct  1    MDATKKRKLDENGIVLDTDPSSPPKLSPEDARRLIERFTPDQLLDILQDALSRHXDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LRSLFS YGE+EEA+VILDK TGKSKGYGF+TF
Sbjct  61   VRSIADPDASQRKLFIRGLGWDTTTEGLRSLFSAYGEIEEAIVILDKTTGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGAL+ALKEPSK+IDGRMTVTQLA+AG        +SNN  D+SLRKIYV
Sbjct  121  RHVDGALMALKEPSKKIDGRMTVTQLASAGNS--NSNTASNNVADVSLRKIYV  171


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  +DKL + F+ YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPSDKLLAHFALYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K I+GR    +LA  G
Sbjct  223  AALVDPVKNIEGRQLTCKLAIDG  245



>gb|KJB13225.1| hypothetical protein B456_002G063400 [Gossypium raimondii]
Length=438

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS---DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG VS   +P  + +L+ +D RK++E FT DQL +I+Q+AV RH DVL 
Sbjct  4    MDPTKKRKLDENGTVSAQSEPDPITKLTPQDGRKLIERFTVDQLLDILQDAVCRHVDVLS  63

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRSIADQD +QRKLFIRGLGW+TTTD LRSLFS YGELEEAVVILDK TGKSKGYGF+T
Sbjct  64   AVRSIADQDPSQRKLFIRGLGWDTTTDGLRSLFSVYGELEEAVVILDKTTGKSKGYGFVT  123

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            FKH+DGALLALKEPSK+IDGR+TVTQLAAAG        +++NPVDI +RKIYV
Sbjct  124  FKHVDGALLALKEPSKKIDGRVTVTQLAAAG-----NSATNSNPVDIHMRKIYV  172


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + ++   DKL   FS YGE+EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DIHMRKIYVANVPYDMPADKLLGHFSQYGEIEEGPLGFDKQTGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K IDGR    +LA  G
Sbjct  224  AALAEPVKNIDGRQMNCKLAIEG  246



>gb|KHG05172.1| Heterogeneous nuclear ribonucleoprotein D0 [Gossypium arboreum]
Length=438

 Score =   237 bits (605),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 144/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS---DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG VS   +P  + +L+ +D RK++E FT DQL +I+Q+AV RH DVL 
Sbjct  4    MDPTKKRKLDENGTVSALSEPDPITKLTPQDGRKLIERFTVDQLLDILQDAVCRHVDVLS  63

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRSIADQD +QRKLFIRGLGW+TTTD LRSLFS YGELEEAVVILDK TGKSKGYGF+T
Sbjct  64   AVRSIADQDPSQRKLFIRGLGWDTTTDGLRSLFSVYGELEEAVVILDKTTGKSKGYGFVT  123

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            FKH+DGALLALKEPSK+IDGR+TVTQLAAAG        +++NPVDI +RKIYV
Sbjct  124  FKHVDGALLALKEPSKKIDGRVTVTQLAAAG-----NSATNSNPVDIHMRKIYV  172


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/122 (34%), Positives = 60/122 (49%), Gaps = 11/122 (9%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E ++KI    T  QL     +A   +P            D   RK+++  + ++   DKL
Sbjct  136  EPSKKIDGRVTVTQLAAAGNSATNSNP-----------VDIHMRKIYVANVPYDMPADKL  184

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F+ YGE+EE  +  DK TGKS+G+    +K  +GA  AL EP K IDGR    +LA 
Sbjct  185  LGHFAQYGEIEEGPLGFDKQTGKSRGFALFVYKTAEGAQAALAEPVKNIDGRQMNCKLAI  244

Query  467  AG  472
             G
Sbjct  245  EG  246



>gb|KHG22515.1| Heterogeneous nuclear ribonucleoprotein A3 [Gossypium arboreum]
Length=432

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 122/174 (70%), Positives = 145/174 (83%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV---VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG+   VS+P  + +L+ +D RK++E FT DQL +I+Q+AV RH DVL 
Sbjct  4    MDPTKKRKLDENGIISAVSEPDPITKLTPQDGRKLIERFTVDQLLDILQDAVCRHLDVLS  63

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A RSIADQD +QRKLFIRGLGW+TTTD LRSLFS YGELEEAVVILDKATGKSKGYGF+T
Sbjct  64   AARSIADQDPSQRKLFIRGLGWDTTTDGLRSLFSVYGELEEAVVILDKATGKSKGYGFVT  123

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            FKH+DGALLALKEPSK+IDGR+TVTQLAAAG       G++ NPVD+ +RKIYV
Sbjct  124  FKHVDGALLALKEPSKKIDGRVTVTQLAAAG-----NSGTNTNPVDVHMRKIYV  172


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + ++ + DKL   F+ YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  164  DVHMRKIYVANVPYDMSADKLLGHFAQYGEIEEGPLGFDKQTGKSKGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K IDGR    +LA  G
Sbjct  224  SALVEPVKNIDGRQLNCKLAIEG  246



>ref|XP_003541062.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 isoform 
X1 [Glycine max]
 ref|XP_006592544.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 isoform 
X2 [Glycine max]
 ref|XP_006592545.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 isoform 
X3 [Glycine max]
Length=437

 Score =   237 bits (604),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 117/172 (68%), Positives = 143/172 (83%), Gaps = 6/172 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLP-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRKL++NG +++ S  P +LS  DARK++E FT DQL +I+Q+ V RHPDVL AV
Sbjct  1    MDPTKKRKLDENGFINNDSSEPLKLSPSDARKLIERFTTDQLLDILQDTVARHPDVLAAV  60

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            R+++D D +QRKLFIRGLGW+TTTD LRSLFSTYG+LEEAVVILDKATGKSKGYGF+TF+
Sbjct  61   RAVSDPDVSQRKLFIRGLGWDTTTDGLRSLFSTYGDLEEAVVILDKATGKSKGYGFVTFR  120

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGALLAL+EPSK+IDGR+TVTQLAAAG         + N VD++LRKIYV
Sbjct  121  HVDGALLALREPSKRIDGRVTVTQLAAAG-----NSALNANAVDVALRKIYV  167


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  +  +   DKL + FS YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  159  DVALRKIYVANVPPDLPADKLLAHFSVYGEIEEGPLGFDKQTGKSKGFALFVYKSPEGAK  218

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K ++GR    +LA
Sbjct  219  AALIDPMKTVEGRQLSCKLA  238



>ref|XP_008367946.1| PREDICTED: UBP1-associated protein 2C-like [Malus domestica]
Length=432

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NG V  +DPS  P+LS EDAR+++E FT DQL +I+Q+A+ RH DVL A
Sbjct  1    MDATKKRKLDENGXVLDTDPSSXPKLSPEDARRLIERFTPDQLLDILQDALSRHXDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LRSLFS YGE+EEA+VILDK TGKSKGYGF+TF
Sbjct  61   VRSIADPDASQRKLFIRGLGWDTTTEGLRSLFSAYGEIEEAIVILDKTTGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGAL+ALKEPSK+IDGRMTVTQLA+AG        +SNN  D+SLRKIYV
Sbjct  121  RHVDGALMALKEPSKKIDGRMTVTQLASAGNS--NSNTASNNVADVSLRKIYV  171


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  +DKL + F+ YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPSDKLLAHFALYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K I+GR    +LA  G
Sbjct  223  AALVDPVKNIEGRQLTCKLAIDG  245



>ref|XP_009335191.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
 ref|XP_009335192.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
Length=432

 Score =   236 bits (602),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 145/173 (84%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NGVV  +DPS  P+LS EDAR+++E FT DQL +I+Q+A+ RH DVL A
Sbjct  1    MDATKKRKLDENGVVLDTDPSSAPKLSPEDARRLIERFTPDQLLDILQDALSRHVDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LRSLFS YGE+E+A+VILDK TGKSKGYGF+TF
Sbjct  61   VRSIADPDASQRKLFIRGLGWDTTTEGLRSLFSAYGEIEDAIVILDKTTGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGAL+ALKEPSK+IDGRMTVTQLA+AG        +SNN  D+SLRKIYV
Sbjct  121  RHVDGALMALKEPSKKIDGRMTVTQLASAGNS--NSNTASNNVADVSLRKIYV  171


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  +DKL + F+ YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPSDKLLAHFALYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K I+GR    +LA  G
Sbjct  223  AALVDPVKNIEGRQLTCKLAIDG  245



>ref|XP_007021676.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY13201.1| RNA-binding family protein [Theobroma cacao]
Length=429

 Score =   236 bits (601),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 122/175 (70%), Positives = 146/175 (83%), Gaps = 8/175 (5%)
 Frame = +2

Query  26   AMDFMKKRKLEDNGVVS---DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
             MD  KKRKL++NG+VS   +P  + +L+ +D RK++E F+ DQL +I+Q+AV RH DVL
Sbjct  3    GMDPTKKRKLDENGIVSTQSEPDPITKLTPQDGRKLIERFSVDQLLDILQDAVSRHVDVL  62

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
             AVRS+ADQD  QRKLFIRGLGW+TTTD LRSLFS YGELEEAVVILDKATGKSKGYGF+
Sbjct  63   AAVRSVADQDPAQRKLFIRGLGWDTTTDGLRSLFSVYGELEEAVVILDKATGKSKGYGFV  122

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG       G++NNPVD+ +RKIYV
Sbjct  123  TFKHVDGALLALKEPSKKIDGRVTVTQLAAAG-----NSGTNNNPVDVHMRKIYV  172


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + ++   DKL   F+ YGE+EE  +  DK TGKS+G+    +K  DGA 
Sbjct  164  DVHMRKIYVANVPYDMPADKLLGHFAQYGEIEEGPLGFDKQTGKSRGFALFVYKTADGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K IDGR    +LA  G
Sbjct  224  AALVEPVKNIDGRQMNCKLAIEG  246



>ref|XP_009340211.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
 ref|XP_009340221.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
Length=435

 Score =   235 bits (599),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/173 (69%), Positives = 144/173 (83%), Gaps = 4/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NGVV  +DP+  P+LS EDAR+++E FT DQL +I+Q+A+ RH DVL A
Sbjct  1    MDSTKKRKLDENGVVLDTDPASAPKLSPEDARRLIERFTPDQLLDILQDALSRHVDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD D +QRKLFIRGLGW+TTT+ LRSLFS YGELEEA+VILDK TGKSKGYGF+TF
Sbjct  61   VRSIADPDASQRKLFIRGLGWDTTTEGLRSLFSAYGELEEAIVILDKTTGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+D AL+ALKEPSK+IDGRMTVTQLA+AG        +SNN  D+SLRKIYV
Sbjct  121  RHVDSALMALKEPSKKIDGRMTVTQLASAGNS--NSNTASNNVADVSLRKIYV  171


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  +DKL + F+ YGE+EE  +  DK TGK KGY    +K  +GA 
Sbjct  163  DVSLRKIYVANVPYDMPSDKLLAHFALYGEIEEGPLGFDKQTGKCKGYALFVYKTPEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P+K I+GR  + +LA  G
Sbjct  223  AALVDPAKNIEGRQLLCKLAIDG  245



>ref|XP_002300424.2| hypothetical protein POPTR_0001s38640g [Populus trichocarpa]
 gb|EEE85229.2| hypothetical protein POPTR_0001s38640g [Populus trichocarpa]
Length=376

 Score =   232 bits (591),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 120/177 (68%), Positives = 144/177 (81%), Gaps = 6/177 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFL--P-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKLE+NG+VS  + L  P +L+ +DARK++E FT DQL +I+QNAVVRHPD+L 
Sbjct  3    MDPTKKRKLEENGIVSSTTDLDSPYKLTPQDARKMMERFTPDQLLDILQNAVVRHPDILE  62

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRSIAD D TQRKLFIRGLGWETTT+ LR+LFSTYGELEEAVVILDK TGKSKGYGF+ 
Sbjct  63   AVRSIADPDATQRKLFIRGLGWETTTENLRNLFSTYGELEEAVVILDKNTGKSKGYGFVI  122

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA---AAGMQggpgggssnnpVDISLRKIYV  541
            +KH+DGALLALKEPSK+IDGR+TVTQLA    +G        ++   VD+++RKIYV
Sbjct  123  YKHVDGALLALKEPSKKIDGRVTVTQLAIAGNSGANNNNNSSANPGVVDVAMRKIYV  179


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E  +DKL + F+ YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  171  DVAMRKIYVANVPYEMPSDKLLNHFAQYGEIEEGPLGFDKQTGKSKGFALFVYKTAEGAQ  230

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K I+GR    +LA  G
Sbjct  231  AALLEPVKMIEGRQLNCKLAIDG  253



>ref|XP_010108262.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXC18502.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=416

 Score =   230 bits (587),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 120/176 (68%), Positives = 140/176 (80%), Gaps = 6/176 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS---FLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRK+E+NGVVS  +   + P L+LEDARK++ESF+ DQL +I+QNAVVRH DVL 
Sbjct  1    MDPSKKRKMEENGVVSAAAADNYPPSLTLEDARKMIESFSHDQLLDILQNAVVRHVDVLD  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRS A++D   RKLFIRGLG +TTTD LR+LFS YGELEEAVVILDK TGKSKGYGF+T
Sbjct  61   AVRS-ANRDIAHRKLFIRGLGLDTTTDGLRALFSVYGELEEAVVILDKTTGKSKGYGFVT  119

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggs--snnpVDISLRKIYV  541
            F+H+DGALLALKEPSK+IDGRMTVTQLAAAG        +  S    D+S RKIYV
Sbjct  120  FRHVDGALLALKEPSKKIDGRMTVTQLAAAGNSSSNTTANPVSVASADVSQRKIYV  175


 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/88 (40%), Positives = 54/88 (61%), Gaps = 0/88 (0%)
 Frame = +2

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+A  D +QRK+++  + ++ T +KL + FS +GE+EE  +  DK TGK +GY    +K 
Sbjct  162  SVASADVSQRKIYVANVPYDMTPEKLLAHFSLFGEVEEGPLGFDKQTGKCRGYALFVYKT  221

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +GA  AL +P K I+GR    +LA  G
Sbjct  222  PEGARAALVDPVKTIEGRQLSCKLAIDG  249



>emb|CDP05991.1| unnamed protein product [Coffea canephora]
Length=450

 Score =   230 bits (587),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 133/180 (74%), Positives = 152/180 (84%), Gaps = 8/180 (4%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV-SDP------SFLP-RLSLEDARKILESFTRDQLFEIVQNAVVRH  184
            MD +KKRKL++NGV+  DP        +P +LS+EDARKILE F+R+QL EIVQ+A++RH
Sbjct  1    MDPIKKRKLDENGVLLHDPDGAVAAGMVPFKLSVEDARKILEPFSREQLLEIVQSAILRH  60

Query  185  PDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKG  364
             DVL  VRSIAD+D  QRKLFIRGLGWETTTDKLR+LFS YG+LEEAVVILDK TGKSKG
Sbjct  61   VDVLDLVRSIADRDPAQRKLFIRGLGWETTTDKLRALFSQYGDLEEAVVILDKVTGKSKG  120

Query  365  YGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            YGFITFKHIDGA+ ALKEPSK+IDGRMTVTQLAAAG+ GGPGGG  NN VD+S RKIYV 
Sbjct  121  YGFITFKHIDGAMAALKEPSKKIDGRMTVTQLAAAGVSGGPGGGGGNNQVDVSDRKIYVA  180


 Score = 61.6 bits (148),  Expect = 5e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   ++L + FS YGE+EE  +  DKATGKS+G+    +K  + A 
Sbjct  171  DVSDRKIYVANVPYDMPAERLLAHFSMYGEIEEGPLGFDKATGKSRGFALFVYKTANAAR  230

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +  K IDG     +LA
Sbjct  231  ASLVDSVKNIDGHQLNCKLA  250



>ref|XP_010108263.1| Heterogeneous nuclear ribonucleoprotein A0 [Morus notabilis]
 gb|EXC18503.1| Heterogeneous nuclear ribonucleoprotein A0 [Morus notabilis]
Length=428

 Score =   230 bits (586),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 120/184 (65%), Positives = 142/184 (77%), Gaps = 13/184 (7%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS--------DPSFLP-RLSLEDARKILESFTRDQLFEIVQNAVVR  181
            MD  KKRK+E+NG+VS        +  + P  LS +DARK++E FT DQL +I+Q+AV R
Sbjct  1    MDPSKKRKMEENGIVSASAATNGGNHHYHPASLSPQDARKLIEHFTPDQLLDILQDAVAR  60

Query  182  HPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSK  361
            H DVL AVRSIAD+D +QRKLFIRGLGW+TTTD LR+LFS YGELEEAVVILDK TGKSK
Sbjct  61   HVDVLDAVRSIADRDISQRKLFIRGLGWDTTTDGLRALFSAYGELEEAVVILDKNTGKSK  120

Query  362  GYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG----MQggpgggssnnpVDISLR  529
            GYGF+TF+H+DGALLALKEPSK+IDGRMTVTQLAAAG             + +  D+SLR
Sbjct  121  GYGFVTFRHVDGALLALKEPSKKIDGRMTVTQLAAAGNSASNSAPNPAAPAASAADVSLR  180

Query  530  KIYV  541
            KIYV
Sbjct  181  KIYV  184


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++  +DKL + FS YG +EE  +  DK TGK +GY F  +K  +GA 
Sbjct  176  DVSLRKIYVANVPYDMASDKLLAHFSVYGAIEEGPLGFDKQTGKCRGYAFFVYKSPEGAQ  235

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL  P K I+GR    +LA  G
Sbjct  236  AALVHPVKTIEGRQLNCKLAVDG  258



>ref|XP_011006711.1| PREDICTED: UBP1-associated protein 2C [Populus euphratica]
 ref|XP_011006713.1| PREDICTED: UBP1-associated protein 2C [Populus euphratica]
Length=442

 Score =   230 bits (586),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 119/177 (67%), Positives = 144/177 (81%), Gaps = 6/177 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFL--P-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKLE+NG+VS  + L  P +L+ +DARK++E FT DQL +I+Q+AVVRHPD+L 
Sbjct  3    MDPTKKRKLEENGIVSSTTDLDSPYKLTPQDARKMMERFTPDQLLDILQSAVVRHPDILD  62

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRSIAD D TQRKLFIRGLGWETTT+ LR+LFSTYGELEEAVVILDK TGKSKGYGF+ 
Sbjct  63   AVRSIADPDATQRKLFIRGLGWETTTENLRNLFSTYGELEEAVVILDKNTGKSKGYGFVI  122

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA---AAGMQggpgggssnnpVDISLRKIYV  541
            +KH+DGALLALKEPSK+IDGR+TVTQLA    +G        ++   VD+++RKIYV
Sbjct  123  YKHVDGALLALKEPSKKIDGRVTVTQLAIAGNSGANNNNNSSANPGVVDVAMRKIYV  179


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/83 (42%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E  +DKL + F+ YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  171  DVAMRKIYVANVPYEMPSDKLLNHFAQYGEIEEGPLGFDKQTGKSKGFALFVYKTAEGAQ  230

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K I+GR    +LA  G
Sbjct  231  AALLEPVKMIEGRQLNCKLAIDG  253



>ref|XP_004294103.1| PREDICTED: UBP1-associated protein 2C [Fragaria vesca subsp. 
vesca]
Length=434

 Score =   229 bits (584),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/176 (69%), Positives = 142/176 (81%), Gaps = 5/176 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV--SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRKL++NGVV  +DPS +P+L  EDARKI+E F+ DQL +++ +A+ RH DVL A
Sbjct  1    MDLTKKRKLDENGVVLDTDPSSVPKLDREDARKIIERFSPDQLIDVLLDAISRHSDVLDA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRSIAD DT QRKLFIRGLGW+TTT+ LRSLFS YGELEEA+VILDK TGKSKGYGF+TF
Sbjct  61   VRSIADPDTAQRKLFIRGLGWDTTTEGLRSLFSAYGELEEAIVILDKNTGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQL---AAAGMQggpgggssnnpVDISLRKIYV  541
            KH+D A LALKEPSK+IDGRMTVTQL      G  GG    +S NPVD+SLRKIYV
Sbjct  121  KHVDAAYLALKEPSKKIDGRMTVTQLAAAGNQGGGGGGSTTASVNPVDVSLRKIYV  176


 Score = 69.7 bits (169),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 34/88 (39%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+   D + RK+++  + +E   DKL + F+ YGE+EE  +  DK TGK KGY    +K 
Sbjct  163  SVNPVDVSLRKIYVANVPYEMAADKLLAHFAQYGEVEEGPLGFDKQTGKCKGYALFVYKT  222

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +GA  AL +P K I+GR    + A+ G
Sbjct  223  PEGAQKALVDPIKNIEGRQLNCKFASDG  250



>ref|XP_006485663.1| PREDICTED: heterogeneous nuclear ribonucleoproteins A1 homolog 
isoform X1 [Citrus sinensis]
 ref|XP_006485664.1| PREDICTED: heterogeneous nuclear ribonucleoproteins A1 homolog 
isoform X2 [Citrus sinensis]
 gb|KDO48333.1| hypothetical protein CISIN_1g014397mg [Citrus sinensis]
Length=425

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD +KKRK+++NG V+SD     RL+ +DARKI+E  T DQL +++ +AV RH DVL +V
Sbjct  1    MDSIKKRKIDENGAVLSDLESPNRLTPQDARKIVERLTSDQLLDVLSSAVARHDDVLESV  60

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            RSIAD D TQRKLFIRGLGW+TTT+ LRS+FS YGELEEAVVILDKATGKSKGYGFITFK
Sbjct  61   RSIADADPTQRKLFIRGLGWDTTTEGLRSIFSAYGELEEAVVILDKATGKSKGYGFITFK  120

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            HIDGA+LALKEPSK+IDGR+TVT LA AG      G S+NNPVD+SLRKI+VG
Sbjct  121  HIDGAMLALKEPSKKIDGRVTVTNLAVAG----NSGNSTNNPVDVSLRKIFVG  169


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  + + DKL + F+ YGE+EE  +  DK TGK KG+    +K  +GA 
Sbjct  160  DVSLRKIFVGNVPNDMSADKLLAHFACYGEIEEGPLGFDKQTGKPKGFALFVYKTAEGAQ  219

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K +DG+    +LA
Sbjct  220  AALVDPIKTVDGKQLNCRLA  239



>ref|XP_006451727.1| hypothetical protein CICLE_v10008394mg [Citrus clementina]
 ref|XP_006451728.1| hypothetical protein CICLE_v10008394mg [Citrus clementina]
 gb|ESR64967.1| hypothetical protein CICLE_v10008394mg [Citrus clementina]
 gb|ESR64968.1| hypothetical protein CICLE_v10008394mg [Citrus clementina]
Length=425

 Score =   228 bits (582),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 122/173 (71%), Positives = 144/173 (83%), Gaps = 5/173 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD +KKRK+++NG V+SD     RL+ +DARKI+E  T DQL +++ +AV RH DVL +V
Sbjct  1    MDSIKKRKIDENGAVLSDLESPNRLTQQDARKIVERLTSDQLLDVLSSAVARHDDVLESV  60

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            RSIAD D TQRKLFIRGLGW+TTT+ LRS+FS YGELEEAVVILDKATGKSKGYGFITFK
Sbjct  61   RSIADADPTQRKLFIRGLGWDTTTEGLRSIFSAYGELEEAVVILDKATGKSKGYGFITFK  120

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            HIDGA+LALKEPSK+IDGR+TVT LA AG      G S+NNPVD+SLRKI+VG
Sbjct  121  HIDGAMLALKEPSKKIDGRVTVTNLAVAG----NSGNSTNNPVDVSLRKIFVG  169


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  + + DKL + F+ YGE+EE  +  DK TGK KG+    +K  +GA 
Sbjct  160  DVSLRKIFVGNVPNDMSADKLLAHFACYGEIEEGPLGFDKQTGKPKGFALFVYKTAEGAQ  219

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K +DG+    +LA
Sbjct  220  AALVDPIKTVDGKQLNCRLA  239



>ref|XP_008383632.1| PREDICTED: UBP1-associated protein 2C-like [Malus domestica]
 ref|XP_008383633.1| PREDICTED: UBP1-associated protein 2C-like [Malus domestica]
Length=380

 Score =   225 bits (573),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MDF KKRK E NG    S PS    L+ EDAR++L+  T+DQL  I+QNAVVRHPDVL +
Sbjct  1    MDFSKKRKTEPNGTXSTSPPSQSAYLTPEDARRLLQPLTQDQLIGILQNAVVRHPDVLES  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS+ADQD+T RKLFIRGLG +TT+D LRSLFS +GEL+EA+VI DKATGKSKGYGF+TF
Sbjct  61   VRSVADQDSTLRKLFIRGLGADTTSDSLRSLFSAFGELDEAIVIHDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH D ALL+LKEPSK+IDGR+TVTQ A+AG+       S+ N  D+S RKIYVG
Sbjct  121  KHADSALLSLKEPSKKIDGRVTVTQFASAGL-ATSXNSSNPNAADVSARKIYVG  173


 Score = 72.4 bits (176),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++ ++D+L S FS YG +EE  +  DK TGKSKG+ F  +K   GA 
Sbjct  164  DVSARKIYVGSVPFDISSDRLLSAFSAYGXIEEGPLGFDKVTGKSKGFAFFVYKAEQGAR  223

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K IDG     +LA
Sbjct  224  AALVEPLKNIDGHQVACKLA  243



>ref|XP_004137219.1| PREDICTED: uncharacterized protein LOC101207569 [Cucumis sativus]
 ref|XP_004156519.1| PREDICTED: uncharacterized protein LOC101231665 [Cucumis sativus]
 gb|KGN53592.1| hypothetical protein Csa_4G083660 [Cucumis sativus]
Length=434

 Score =   226 bits (577),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 116/171 (68%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD  KKR++++NGV S  S   R++ EDARKI++ FT DQL +I+Q+AV RH DVL AVR
Sbjct  1    MDVTKKRRMDENGVDSSESSFSRITPEDARKIIDRFTPDQLIDILQDAVSRHLDVLDAVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIAD+D +QRKLFIRGL  +T+T+ LRSLFS+YGELEEAVVI+DKATGKSKGYGF+TFKH
Sbjct  61   SIADRDVSQRKLFIRGLSCDTSTEGLRSLFSSYGELEEAVVIIDKATGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALKEPSK IDGR+TVTQLAA G+      G ++N  D+SLRKIYV
Sbjct  121  VDGALLALKEPSKTIDGRVTVTQLAAVGIS-----GQNSNAADLSLRKIYV  166


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   DKL + FS YGE+EE  +  DK TGK +GY    +K  +GA 
Sbjct  158  DLSLRKIYVANVPMDMPADKLLAHFSLYGEIEEGPLGFDKQTGKCRGYALFVYKKPEGAQ  217

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K IDGR    + A
Sbjct  218  AALVDPIKTIDGRQLSCKFA  237



>ref|XP_006582133.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like isoform X1 [Glycine max]
 ref|XP_006582134.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like isoform X2 [Glycine max]
Length=444

 Score =   226 bits (576),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 116/172 (67%), Positives = 142/172 (83%), Gaps = 6/172 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLP-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRKL++NG  ++ S  P +LS  + RK++E FT DQL +I+Q+AV RH DVL AV
Sbjct  1    MDPTKKRKLDENGFNNNDSSDPLKLSPSEVRKLIERFTSDQLLDILQDAVARHLDVLAAV  60

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            R++AD D +QRKLFIRGLGW+TTTD LRSLFST+G+LEEAVVILDKATGKSKGYGF+TF+
Sbjct  61   RAVADPDVSQRKLFIRGLGWDTTTDGLRSLFSTFGDLEEAVVILDKATGKSKGYGFVTFR  120

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGALLAL+EPSK+IDGR+TVTQLAAAG        S+ NP D++LRKIYV
Sbjct  121  HVDGALLALREPSKRIDGRVTVTQLAAAG-----NSASNVNPADVALRKIYV  167


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 32/88 (36%), Positives = 50/88 (57%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            +  ++   D   RK+++  +  +   DKL + FS YGE+EE  +  DK TGKSKG+    
Sbjct  151  SASNVNPADVALRKIYVANVPPDLPADKLLAHFSVYGEIEEGPLGFDKQTGKSKGFALFV  210

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +K  +GA  AL +P K ++GR    +LA
Sbjct  211  YKSPEGAQAALIDPVKTVEGRQLSCKLA  238



>ref|XP_008451717.1| PREDICTED: UBP1-associated protein 2C [Cucumis melo]
 ref|XP_008451718.1| PREDICTED: UBP1-associated protein 2C [Cucumis melo]
 ref|XP_008451719.1| PREDICTED: UBP1-associated protein 2C [Cucumis melo]
Length=434

 Score =   225 bits (573),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 115/171 (67%), Positives = 141/171 (82%), Gaps = 5/171 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD  KKR++++NGV S  +   R++ EDARKI++ FT DQL +I+Q+AV RH DVL AVR
Sbjct  1    MDVTKKRRMDENGVDSSENSFSRITPEDARKIIDRFTPDQLIDILQDAVSRHLDVLEAVR  60

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIAD+D +QRKLFIRGL  +T+T+ LRSLFS+YGELEEAVVI+DKATGKSKGYGF+TFKH
Sbjct  61   SIADRDVSQRKLFIRGLSCDTSTEGLRSLFSSYGELEEAVVIIDKATGKSKGYGFVTFKH  120

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLALKEPSK IDGR+TVTQLAA G+      G ++N  D+SLRKIYV
Sbjct  121  VDGALLALKEPSKTIDGRVTVTQLAAVGIS-----GQNSNAADLSLRKIYV  166


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   DKL + FS YGE+EE  +  DK TGK +GY    +K  +GA 
Sbjct  158  DLSLRKIYVANVPMDMPADKLLAHFSLYGEIEEGPLGFDKQTGKCRGYALFVYKKPEGAQ  217

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K IDGR    + A
Sbjct  218  AALVDPIKTIDGRQLSCKFA  237



>ref|XP_006852453.1| hypothetical protein AMTR_s00021p00110500 [Amborella trichopoda]
 gb|ERN13920.1| hypothetical protein AMTR_s00021p00110500 [Amborella trichopoda]
Length=409

 Score =   224 bits (570),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 113/168 (67%), Positives = 133/168 (79%), Gaps = 13/168 (8%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            KKRK E+NG  +       +S+EDARKI+E FT++QL +I+Q A  RHPDVL  VR+IAD
Sbjct  4    KKRKTEENGSGT-------ISVEDARKIIEPFTQEQLLDILQEATARHPDVLDLVRAIAD  56

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D T RKLFIRGLGW+TTT+ LR+LFS YGE+EE VVILDKATGKSKGYGF+TFKHIDGA
Sbjct  57   RDPTDRKLFIRGLGWDTTTESLRTLFSQYGEIEEGVVILDKATGKSKGYGFVTFKHIDGA  116

Query  401  LLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            L ALKEPSK+IDGRMTVTQLAA+G Q       S   VD+S RKI+VG
Sbjct  117  LNALKEPSKKIDGRMTVTQLAASGNQ------PSVPSVDVSARKIFVG  158


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 53/92 (58%), Gaps = 0/92 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   S+   D + RK+F+  + ++   D+L   F  YGE+EE  +  DK TGKS+G+   
Sbjct  140  GNQPSVPSVDVSARKIFVGNVPFDMPADRLLHHFLQYGEVEEGPLGFDKQTGKSRGFALF  199

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +K ++ A  AL+EP+K +DG   V +LA  G
Sbjct  200  VYKTVEAAKAALEEPNKSVDGHQLVCKLAVDG  231



>ref|XP_007133193.1| hypothetical protein PHAVU_011G159400g [Phaseolus vulgaris]
 gb|ESW05187.1| hypothetical protein PHAVU_011G159400g [Phaseolus vulgaris]
Length=438

 Score =   224 bits (571),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 113/172 (66%), Positives = 140/172 (81%), Gaps = 9/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV-SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRKL++NG   SDP    +LS  +ARK++E FT +QL +I+Q+AV RH DVL +V
Sbjct  1    MDLTKKRKLDENGFGDSDPL---KLSPSEARKLIERFTPEQLLDILQDAVARHADVLASV  57

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            R++AD D +QRKLF+RGLGW+TTTD LRSLFS YGELEEAVVI+DKATGKSKGYGF+TF+
Sbjct  58   RAVADPDVSQRKLFVRGLGWDTTTDGLRSLFSAYGELEEAVVIVDKATGKSKGYGFVTFR  117

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGA+LAL+EPSK+IDGR+TVTQLAAAG        S+ N  D++LRKIYV
Sbjct  118  HVDGAILALREPSKRIDGRVTVTQLAAAG-----NSPSNANAADVALRKIYV  164


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  +  +   DKL + FS YGE+EE  +  DK TGKSKG+    +K  +GA 
Sbjct  156  DVALRKIYVANVPPDLPADKLLAHFSVYGEIEEGPLGFDKQTGKSKGFALFVYKTPEGAQ  215

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K ++GR    +LA
Sbjct  216  AALLDPVKTVEGRQLSCKLA  235



>emb|CDO96777.1| unnamed protein product [Coffea canephora]
Length=423

 Score =   222 bits (566),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 113/185 (61%), Positives = 138/185 (75%), Gaps = 19/185 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--------VVSDPS-----FLPRLSLEDARKILESFTRDQLFEIVQN  169
            MD  KKRK E+NG        +++DP+     F   LS ED  KIL+ FT++QL  I++ 
Sbjct  1    MDLSKKRKTEENGSGYPAPTSLIADPNATLPPFPSPLSAEDISKILDPFTKEQLLPIIRA  60

Query  170  AVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKAT  349
            A+VRHPDVL AVR++AD D  QRKLF+RGLGWET T+KLR++FSTYGEL+EA+VI DK T
Sbjct  61   AIVRHPDVLEAVRAVADSDPAQRKLFVRGLGWETNTEKLRAVFSTYGELDEAIVISDKNT  120

Query  350  GKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLR  529
            GKSKGYGF+TFKHID A+LALKEP+K+IDGR+TVTQLAAAG  G           D+SLR
Sbjct  121  GKSKGYGFVTFKHIDAAILALKEPNKKIDGRITVTQLAAAGNSGNSQSS------DVSLR  174

Query  530  KIYVG  544
            KIYVG
Sbjct  175  KIYVG  179


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + +E ++++L S F+ YGE+EE  +  DK TGK KG+ F  +K  +GA 
Sbjct  170  DVSLRKIYVGNIPFEISSERLLSHFTMYGEIEEGPLGFDKQTGKVKGFAFFVYKTEEGAR  229

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L EP+K IDG + V +LA
Sbjct  230  ASLMEPNKVIDGHVVVCKLA  249



>emb|CDY55846.1| BnaCnng29340D [Brassica napus]
Length=401

 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 136/173 (79%), Gaps = 7/173 (4%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD +KKR+L++NG+  ++D     RL+  DARKI+E F+ DQL +I+Q AV RHPDVL  
Sbjct  1    MDVLKKRRLDENGIGLLNDGHITTRLTPHDARKIIERFSNDQLLDILQEAVARHPDVLEL  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS AD D +QRKLFIRGL  ETTT+ LRSLFSTYG+LEEA+VILDK T KSKGYGF+TF
Sbjct  61   VRSTADSDVSQRKLFIRGLAAETTTEGLRSLFSTYGDLEEAIVILDKVTAKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            KH+DGALLALK+PSK+IDGR+TVTQLAAAG QG     S     DIS RKIYV
Sbjct  121  KHVDGALLALKDPSKKIDGRVTVTQLAAAGNQGTTAHVS-----DISTRKIYV  168


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  160  DISTRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKVTGKSRGFALFVYKTSEGAQ  219

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P+K +DG+    +LA  G
Sbjct  220  AALADPTKVVDGKHLQCKLAIDG  242



>gb|KEH19556.1| RNA-binding (RRM/RBD/RNP motif) family protein [Medicago truncatula]
Length=445

 Score =   223 bits (567),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 113/171 (66%), Positives = 138/171 (81%), Gaps = 6/171 (4%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD  KKRKL++NG   +   L +LS  + RK++E FT DQL  I+Q+AVVRHPDVL AVR
Sbjct  5    MDPTKKRKLDENGFGGESDHL-KLSPSEGRKLIERFTPDQLINILQDAVVRHPDVLSAVR  63

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            ++ D D ++RKLFIRGLGW+TTT+ LRSLFSTYGELEEA+VI+DKATGKSKGYGF+TF H
Sbjct  64   AVVDPDISRRKLFIRGLGWDTTTEGLRSLFSTYGELEEAIVIVDKATGKSKGYGFVTFLH  123

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLAL+EPSK+IDGR+TVTQLAAAG       GS+ N  D++ RKIYV
Sbjct  124  VDGALLALREPSKRIDGRVTVTQLAAAG-----NSGSNTNAADVAQRKIYV  169


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRK+++  +  +   DKL + FS YGE+EE  +  DK TG+SKG+    +K  +GA 
Sbjct  161  DVAQRKIYVSNVPPDLPGDKLLAHFSIYGEIEEGPLGFDKQTGRSKGFALFVYKTPEGAN  220

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ EP K ++GR    +LA
Sbjct  221  AAVSEPVKNVEGRQLNCKLA  240



>ref|XP_010535053.1| PREDICTED: UBP1-associated protein 2C [Tarenaya hassleriana]
Length=421

 Score =   222 bits (565),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 117/174 (67%), Positives = 137/174 (79%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNG---VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG   +    +   RL+  DARKI+E F+ DQL +I+Q AVVRHPDVL 
Sbjct  1    MDLTKKRKLDENGGGLLTEGVTGTIRLTPHDARKIIERFSTDQLLDILQQAVVRHPDVLE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRS AD D +QRKLFIRGL  ETTT+ LRSLFSTYG+LEEA+VILDK TGKSKGYGF+T
Sbjct  61   AVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSTYGDLEEAIVILDKVTGKSKGYGFVT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            F+H+DGALLALKEPSK+IDGR+TVTQLAA+G QG     S     DIS+RKIYV
Sbjct  121  FRHVDGALLALKEPSKKIDGRVTVTQLAASGNQGTSTNVS-----DISMRKIYV  169


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  161  DISMRKIYVANVPFDMPADRLLNHFLAYGDIEEGPLGFDKLTGKSRGFALFVYKTAEGAH  220

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
              L +P K IDG+    +LA  G
Sbjct  221  ATLADPVKVIDGKNLHCKLAIDG  243



>gb|EYU26340.1| hypothetical protein MIMGU_mgv1a024658mg [Erythranthe guttata]
Length=387

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 111/151 (74%), Positives = 128/151 (85%), Gaps = 4/151 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS---DPSFLP-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            MD +KKRK++ NGVV      SF P  LS +DARKILE  T + L EIVQNA++RH DVL
Sbjct  1    MDPIKKRKIDGNGVVQAADHGSFNPLMLSPDDARKILEPLTHEHLLEIVQNALLRHRDVL  60

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
             +VRSIAD+D  QRKLF+RGLGWETTT+KLR LFS+YGEL+EAVVILDK TGKSKGYGF+
Sbjct  61   ESVRSIADRDAAQRKLFVRGLGWETTTEKLRGLFSSYGELDEAVVILDKVTGKSKGYGFV  120

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAA  469
            TFKHIDGA++ALKEPSK+IDGRMTVTQLAAA
Sbjct  121  TFKHIDGAIVALKEPSKKIDGRMTVTQLAAA  151


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + +E   ++L   FS YGE+EE  +  DKATGKSKG+    +K  + A 
Sbjct  185  DVSTRKIYVSNVPYEMPGERLLQHFSMYGEIEEGPLGFDKATGKSKGFALFVYKTAEAAR  244

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +P K +DG     +LA+ G
Sbjct  245  ASLVDPVKNLDGHQLNCKLASDG  267



>ref|XP_010527509.1| PREDICTED: UBP1-associated protein 2C-like [Tarenaya hassleriana]
Length=423

 Score =   221 bits (562),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 116/174 (67%), Positives = 136/174 (78%), Gaps = 8/174 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLP---RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRKL++NG    P  +P   RL+ +DARKI+E F+ +Q+ +I+Q A V HPDVL 
Sbjct  1    MDLTKKRKLDENGGGLFPDGVPGPIRLTPQDARKIIERFSTEQMLDILQQAAVCHPDVLE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            AVRS AD D  QRKLFIRGL  ETTT+ LRSLFSTYG+LEEA+VILDK TGKSKGYGF+T
Sbjct  61   AVRSTADSDIAQRKLFIRGLAAETTTEGLRSLFSTYGDLEEAIVILDKVTGKSKGYGFVT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            F+H+DGALLALKEPSK+IDGR+TVTQLAAAG QG     S     DIS+RKIYV
Sbjct  121  FRHVDGALLALKEPSKKIDGRVTVTQLAAAGNQGTTTNVS-----DISMRKIYV  169


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  161  DISMRKIYVANVPFDMPADRLLNHFLAYGDIEEGPLGFDKLTGKSRGFALFVYKTSEGAR  220

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K IDG+    +LA  G
Sbjct  221  AALADPVKVIDGKNLHCKLAIDG  243



>ref|XP_006307615.1| hypothetical protein CARUB_v10009243mg [Capsella rubella]
 ref|XP_006307616.1| hypothetical protein CARUB_v10009243mg [Capsella rubella]
 gb|EOA40513.1| hypothetical protein CARUB_v10009243mg [Capsella rubella]
 gb|EOA40514.1| hypothetical protein CARUB_v10009243mg [Capsella rubella]
Length=422

 Score =   221 bits (562),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/176 (66%), Positives = 138/176 (78%), Gaps = 9/176 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSDP---SFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MD +KKRKL+DNG+  ++D    +   RL  +DARKI+E F+ DQL +I+Q A+VRHPDV
Sbjct  1    MDMLKKRKLDDNGIGMLNDGVIGAVSSRLMPQDARKIIERFSTDQLLDILQEAIVRHPDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L  VRS AD D +QRKLFIRGL  ETTT+ LRSLFS YG+LEEA+VILDK T KSKGYGF
Sbjct  61   LEIVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSNYGDLEEAIVILDKVTAKSKGYGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG QG      S    DIS+RKIYV
Sbjct  121  VTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQGTTNSHVS----DISMRKIYV  172


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKITGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K +DG+    +LA  G
Sbjct  224  AALAEPMKVVDGKNLQCKLAIDG  246



>ref|XP_008791396.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera]
Length=443

 Score =   221 bits (563),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 117/168 (70%), Positives = 137/168 (82%), Gaps = 4/168 (2%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            KKRK ++NG V+  + L  L+ EDARKI+E FTRDQL +IVQ A+ R   VL AVR+IAD
Sbjct  6    KKRKTDENGAVA--TSLAGLTPEDARKIVEPFTRDQLLDIVQEAMCRDAGVLDAVRAIAD  63

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D  QRKLFIRGLGWETTTD LR+LFS+YGELEEAVVI+DKATGKSKGYGFITF+HIDGA
Sbjct  64   RDPAQRKLFIRGLGWETTTDALRNLFSSYGELEEAVVIVDKATGKSKGYGFITFRHIDGA  123

Query  401  LLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            LLALKEPSK+IDGRMTVTQLAA          ++  P+D+SLRKI+VG
Sbjct  124  LLALKEPSKKIDGRMTVTQLAA--AGTAGPTAAAPPPIDVSLRKIFVG  169


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +K  + A 
Sbjct  160  DVSLRKIFVGNVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYKTAEAAR  219

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +P+K IDG   V +LA  G
Sbjct  220  ASLVDPTKNIDGHHLVCKLAIEG  242



>ref|XP_009352781.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
 ref|XP_009352782.1| PREDICTED: UBP1-associated protein 2C-like [Pyrus x bretschneideri]
Length=379

 Score =   219 bits (557),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 113/174 (65%), Positives = 139/174 (80%), Gaps = 3/174 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS-DPSFLPR-LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MDF KKRK E NG VS  PS     L+ EDAR++L+  T+DQL +I++NAVVRHPDVL +
Sbjct  1    MDFSKKRKTEPNGTVSTSPSSQSACLTPEDARRLLQPLTQDQLIDILKNAVVRHPDVLES  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS+AD+D+T RKLFIRGLG +TT+D LRSLFS +GEL+EA+VI DKATGKSKGYGF+TF
Sbjct  61   VRSVADKDSTLRKLFIRGLGADTTSDSLRSLFSAFGELDEAIVIHDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH D ALL+LKEPSK+IDGR+TVTQ A++G+       S+ N  D+S RKIYVG
Sbjct  121  KHADSALLSLKEPSKKIDGRVTVTQFASSGL-ATSFNSSNPNAADVSARKIYVG  173


 Score = 75.1 bits (183),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++ ++D+L S FS YGE+EE  +  DK TGKSKG+ F  +K   GA 
Sbjct  164  DVSARKIYVGSVPFDISSDRLLSAFSAYGEIEEGPLGFDKVTGKSKGFAFFVYKAEQGAR  223

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K IDG     +LA
Sbjct  224  AALVEPLKNIDGHQVACKLA  243



>ref|XP_010479881.1| PREDICTED: UBP1-associated protein 2C-like [Camelina sativa]
Length=424

 Score =   219 bits (559),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 115/176 (65%), Positives = 140/176 (80%), Gaps = 9/176 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSDPSFLP---RLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MD +KKRKL++NG+  +++    P   RL   DARKI+E F+ DQL +I+Q AVVRHPD+
Sbjct  1    MDMLKKRKLDENGISMLNEGVIGPVSSRLMPHDARKIIERFSTDQLLDILQEAVVRHPDI  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L  VRS AD D +QRKLFIRGL  ETTT+ LRSLFS YG+LEEA+VILDK T KSKGYGF
Sbjct  61   LEIVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSNYGDLEEAIVILDKVTAKSKGYGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG Q    G ++++  DIS+RKIYV
Sbjct  121  VTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQ----GTTNSHVTDISMRKIYV  172


 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKITGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K +DG+    +LA  G
Sbjct  224  AALAEPMKVVDGKNLQCKLAIDG  246



>ref|XP_006392809.1| hypothetical protein EUTSA_v10011518mg [Eutrema salsugineum]
 gb|ESQ30095.1| hypothetical protein EUTSA_v10011518mg [Eutrema salsugineum]
Length=421

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 118/180 (66%), Positives = 136/180 (76%), Gaps = 18/180 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFL---------PRLSLEDARKILESFTRDQLFEIVQNAVVR  181
            MD +KKRKL++NG+     FL          RL  +DARKI+E F+ DQL +I+Q AVVR
Sbjct  1    MDMLKKRKLDENGI----GFLNDGHVGAVPTRLMPQDARKIIERFSTDQLLDILQEAVVR  56

Query  182  HPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSK  361
            HPDVL  VRS AD D +QRKLFIRGL  ETTT+ LRSLFS YG+LEEA+VILDK T KSK
Sbjct  57   HPDVLEFVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSNYGDLEEAIVILDKVTAKSK  116

Query  362  GYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            GYGF+TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG QG     S     DIS+RKIYV
Sbjct  117  GYGFVTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQGATAHVS-----DISMRKIYV  171


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  163  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKVTGKSRGFALFVYKTAEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K IDG+    +LA  G
Sbjct  223  AALADPVKVIDGKNLQCKLAIDG  245



>ref|XP_008775614.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera]
 ref|XP_008775615.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera]
 ref|XP_008775618.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera]
Length=449

 Score =   219 bits (559),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 117/171 (68%), Positives = 139/171 (81%), Gaps = 8/171 (5%)
 Frame = +2

Query  38   MKKRKLEDNG-VVSDP-SFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRS  211
            +KKRK ++NG VV+ P S +P    EDARK++E FTR+QL +IVQ+A+ R   VL AVR+
Sbjct  5    LKKRKSDENGAVVASPASLMP----EDARKVVEPFTREQLLDIVQDAMCRDAGVLDAVRA  60

Query  212  IADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHI  391
            IAD+D  QRKLFIRGLGWETTT+ LR+LFS+YGELEEAVVI+DKATGKSKGYGFITF+HI
Sbjct  61   IADRDPAQRKLFIRGLGWETTTEALRNLFSSYGELEEAVVIVDKATGKSKGYGFITFRHI  120

Query  392  DGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            DGALLALKEPSK+IDGRMTVTQLAA          ++   VD+SLRKIYVG
Sbjct  121  DGALLALKEPSKKIDGRMTVTQLAA--AGTAGPTAAAPPAVDVSLRKIYVG  169


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  160  DVSLRKIYVGNVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYKTAEGAR  219

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L + +K IDG   V +LA
Sbjct  220  ASLVDATKDIDGHHLVCKLA  239



>ref|XP_010462203.1| PREDICTED: UBP1-associated protein 2C-like [Camelina sativa]
Length=422

 Score =   219 bits (557),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/181 (64%), Positives = 138/181 (76%), Gaps = 19/181 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV----------VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVV  178
            MD +KKRKL++NG+          VS      RL   DARKI+E F+ DQL +I+Q AVV
Sbjct  1    MDMLKKRKLDENGIAMLNEGVIGAVSS-----RLMPHDARKIIERFSTDQLLDILQEAVV  55

Query  179  RHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKS  358
            RHPD+L  VRS AD D +QRKLFIRGL  ETTT+ LRSLFS YG+LEEA+VILDK T KS
Sbjct  56   RHPDILEIVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSNYGDLEEAIVILDKVTAKS  115

Query  359  KGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIY  538
            KGYGF+TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG Q    G ++++  DIS+RKIY
Sbjct  116  KGYGFVTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQ----GTTNSHVTDISMRKIY  171

Query  539  V  541
            V
Sbjct  172  V  172


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKITGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K +DG+    +LA  G
Sbjct  224  AALAEPMKVVDGKNLQCKLAIDG  246



>ref|XP_010500962.1| PREDICTED: UBP1-associated protein 2C-like [Camelina sativa]
Length=428

 Score =   218 bits (554),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 115/181 (64%), Positives = 138/181 (76%), Gaps = 19/181 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV----------VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVV  178
            MD +KKRKL++NG+          VS      RL   DARKI+E F+ DQL +I+Q AVV
Sbjct  1    MDMLKKRKLDENGIAMINEGVIGAVSS-----RLMPHDARKIIERFSTDQLLDILQEAVV  55

Query  179  RHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKS  358
            RHPD+L  VRS AD D +QRKLFIRGL  ETTT+ LRSLF+ YG+LEEA+VILDK T KS
Sbjct  56   RHPDILEIVRSTADSDISQRKLFIRGLAAETTTEGLRSLFTNYGDLEEAIVILDKVTAKS  115

Query  359  KGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIY  538
            KGYGF+TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG Q    G ++++  DIS+RKIY
Sbjct  116  KGYGFVTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQ----GTTNSHVTDISMRKIY  171

Query  539  V  541
            V
Sbjct  172  V  172


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKITGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K +DG+    +LA  G
Sbjct  224  AALAEPMKVVDGKNLQCKLAIDG  246



>ref|XP_007211523.1| hypothetical protein PRUPE_ppa008108mg [Prunus persica]
 gb|EMJ12722.1| hypothetical protein PRUPE_ppa008108mg [Prunus persica]
Length=345

 Score =   214 bits (544),  Expect = 9e-65, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 137/174 (79%), Gaps = 3/174 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSL--EDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MDF KKRK E NG VS        SL  EDARK+L+  T+DQL +I+QNAVVRHPDVL +
Sbjct  1    MDFTKKRKTELNGTVSLSPTSQSSSLTSEDARKLLQPLTQDQLIDILQNAVVRHPDVLDS  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS+ D+D+T RKLFIRGLG +TT+D LRSLFS +G+L+EA+VI DKATGKSKGYGF+TF
Sbjct  61   VRSVTDKDSTLRKLFIRGLGADTTSDSLRSLFSAFGDLDEAIVIPDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH D ALLALKEPSK+IDGR+TVTQ AAAG+       S++N  D+S RKIYVG
Sbjct  121  KHADSALLALKEPSKKIDGRVTVTQFAAAGL-TASFSNSNSNAADVSARKIYVG  173


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 23/54 (43%), Positives = 38/54 (70%), Gaps = 0/54 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            D + RK+++  + ++ ++++L S FS YGE+EE  +  DKATGKSKG+ F  +K
Sbjct  164  DVSARKIYVGSVPFDISSERLLSTFSAYGEIEEGPLGFDKATGKSKGFAFFVYK  217



>ref|XP_010913172.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
 ref|XP_010913180.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
 ref|XP_010913187.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
 ref|XP_010913194.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
 ref|XP_010913202.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
 gb|AFC89654.1| RBP42 [Elaeis guineensis]
Length=413

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/169 (68%), Positives = 137/169 (81%), Gaps = 9/169 (5%)
 Frame = +2

Query  41   KKRKLEDNG-VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIA  217
            KKRK ++NG VV+ P+ L   + EDARKI+E FTR+ L +IV+ A+ R   VL AVR+IA
Sbjct  6    KKRKSDENGAVVASPALL---TPEDARKIVEPFTREHLLDIVREAMCRDAGVLDAVRAIA  62

Query  218  DQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            D+D  QRKLFIRGLGWETTT+ LR+LFS+YGELEEAVVI+DKATGKSKGYGFITF+HIDG
Sbjct  63   DRDPAQRKLFIRGLGWETTTESLRNLFSSYGELEEAVVIVDKATGKSKGYGFITFRHIDG  122

Query  398  ALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ALLALKEPSK+IDGRMTVTQLAAA         ++   +D+SLRKIYVG
Sbjct  123  ALLALKEPSKKIDGRMTVTQLAAA-----GTTAAAPPAIDVSLRKIYVG  166


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  157  DVSLRKIYVGNVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYKTAEGAG  216

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +P+K IDG   V +LA  G
Sbjct  217  ASLVDPTKNIDGHHLVCKLAIDG  239



>ref|XP_009144782.1| PREDICTED: UBP1-associated protein 2C-like [Brassica rapa]
 ref|XP_009144783.1| PREDICTED: UBP1-associated protein 2C-like [Brassica rapa]
Length=414

 Score =   215 bits (548),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 137/176 (78%), Gaps = 10/176 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSD---PSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MD +KKR+L++NG+  ++D    +   RL+  DARKI++ F+ DQL +I+Q AV RHPDV
Sbjct  1    MDMLKKRRLDENGIGLLNDGHVTTISTRLTPHDARKIIDRFSNDQLLDILQEAVARHPDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L  VRS AD D +QRKLFIRGL  ETTT+ LRSLFSTYG+LEEA+VILDK T KSKGYGF
Sbjct  61   LELVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSTYGDLEEAIVILDKVTAKSKGYGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +TFKH+DGALLALK+PSK+IDGR+TVTQLAAAG QG     S     DIS RKIYV
Sbjct  121  VTFKHVDGALLALKDPSKKIDGRVTVTQLAAAGNQGTTAHVS-----DISTRKIYV  171


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
             D + RK+++  + +E   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA
Sbjct  162  SDISTRKIYVANVPFEMPADRLLNQFLAYGDIEEGPLGFDKVTGKSRGFALFVYKTSEGA  221

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              AL +P+K +DG+    +LA  G
Sbjct  222  QAALADPTKVVDGKHLQCKLAIDG  245



>ref|XP_008225274.1| PREDICTED: UBP1-associated protein 2C-like [Prunus mume]
 ref|XP_008225276.1| PREDICTED: UBP1-associated protein 2C-like [Prunus mume]
 ref|XP_008225277.1| PREDICTED: UBP1-associated protein 2C-like [Prunus mume]
Length=381

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/174 (66%), Positives = 136/174 (78%), Gaps = 3/174 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSL--EDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MDF KKRK E NG VS        SL  EDARK+L+  T+DQL +I+QNAVVRHPDVL +
Sbjct  1    MDFTKKRKTELNGTVSLSPTSQSSSLTSEDARKLLQPLTQDQLIDILQNAVVRHPDVLDS  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS+ D+D+T RKLFIRGLG +TT+D LRSLFS +G+L+EA+VI DKATGKSKGYGF+TF
Sbjct  61   VRSVTDKDSTLRKLFIRGLGADTTSDSLRSLFSAFGDLDEAIVIPDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH D ALLALKEPSK+IDGR+TVTQ AAAG+       S+ N  D+S RKIYVG
Sbjct  121  KHADSALLALKEPSKKIDGRVTVTQFAAAGL-TASFSNSNTNSADVSARKIYVG  173


 Score = 75.1 bits (183),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++ ++++L S FS YGE+EE  +  DKATGKSKG+ F  +K  +GA 
Sbjct  164  DVSARKIYVGSVPFDISSERLLSTFSAYGEIEEGPLGFDKATGKSKGFAFFVYKTEEGAR  223

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K IDG     +LA
Sbjct  224  AALVEPIKNIDGHQVACKLA  243



>ref|XP_010924885.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
Length=445

 Score =   216 bits (550),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 115/168 (68%), Positives = 135/168 (80%), Gaps = 4/168 (2%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            KKRK ++NG V+    +  L+ EDARKI+E FTR+QL +IVQ A+ R   VL AVR+IAD
Sbjct  6    KKRKTDENGAVAASQAM--LTPEDARKIVEPFTREQLLDIVQEAMCRDAGVLDAVRAIAD  63

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D  QRKLFIRGLGWETTT+ LR+LFS YGELEEAVVI+DKATGKSKGYGFITF+HIDGA
Sbjct  64   RDPAQRKLFIRGLGWETTTEALRNLFSAYGELEEAVVIVDKATGKSKGYGFITFRHIDGA  123

Query  401  LLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            LLALKEPSK+IDGRMTVTQLAA          ++  PVD+SLRKI+VG
Sbjct  124  LLALKEPSKKIDGRMTVTQLAA--AGTAGPTAAAPPPVDVSLRKIFVG  169


 Score = 64.3 bits (155),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +K  + A 
Sbjct  160  DVSLRKIFVGNVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYKTAEAAR  219

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +P+K IDG   V +LA  G
Sbjct  220  ASLVDPTKNIDGHHLVCKLAIEG  242



>ref|XP_009147615.1| PREDICTED: UBP1-associated protein 2C-like [Brassica rapa]
Length=415

 Score =   214 bits (545),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 116/173 (67%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD +KKR+L++NG  +++D + + RL+  DARK++E F+ DQL +I+QNAV RHPDVL  
Sbjct  1    MDMLKKRRLDENGNGILND-AHITRLTPHDARKLIERFSTDQLLDILQNAVARHPDVLEL  59

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS AD D TQRKLFIRGL  ETTT+ LRSLFSTYG+LEEA+VILDK T KSKGYGF+TF
Sbjct  60   VRSTADADITQRKLFIRGLAAETTTEGLRSLFSTYGDLEEAIVILDKVTAKSKGYGFVTF  119

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGALLALK+PSK+IDGR+TVTQLAAAG QGG G  ++ N  D+S+RKIYV
Sbjct  120  RHVDGALLALKDPSKKIDGRVTVTQLAAAGNQGGGGAAAAANGSDVSMRKIYV  172


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   D+L +LF  YGE+EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DVSMRKIYVANVPVDMPADRLLNLFLAYGEIEEGPLGFDKVTGKSRGFALFVYKSPEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P+K IDG+    +LA
Sbjct  224  SALADPTKVIDGKHLQCKLA  243



>emb|CDY25867.1| BnaA05g14580D [Brassica napus]
Length=405

 Score =   213 bits (543),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 113/176 (64%), Positives = 136/176 (77%), Gaps = 10/176 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV--VSD---PSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MD +KKR+L++NG+  ++D    +   RL+  DARKI++ F+ DQL +I+Q AV RHPDV
Sbjct  1    MDMLKKRRLDENGIGLLNDGHVTTISTRLTPHDARKIIDRFSNDQLLDILQEAVARHPDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L  VRS AD D +QRKLFIRGL  ETTT+ LRSLFSTYG+ EEA+VILDK T KSKGYGF
Sbjct  61   LDLVRSTADSDISQRKLFIRGLAAETTTEGLRSLFSTYGDPEEAIVILDKVTAKSKGYGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +TFKH+DGALLALK+PSK+IDGR+TVTQLAAAG QG     S     DIS RKIYV
Sbjct  121  VTFKHVDGALLALKDPSKKIDGRVTVTQLAAAGNQGTTAHVS-----DISTRKIYV  171


 Score = 65.1 bits (157),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
             D + RK+++  + +E   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA
Sbjct  162  SDISTRKIYVANVPFEMPADRLLNQFLAYGDIEEGPLGFDKVTGKSRGFALFVYKTSEGA  221

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              AL +P+K +DG+    +LA  G
Sbjct  222  QAALADPTKVVDGKHLQCKLAIDG  245



>gb|AGV54510.1| polyadenylate-binding protein, cytoplasmic and nuclear-like protein 
[Phaseolus vulgaris]
Length=437

 Score =   213 bits (543),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 139/172 (81%), Gaps = 9/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV-SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRKL++NG   SDP    +LS  +ARK++E FT +QL +I+Q+AV RH DVL +V
Sbjct  1    MDLTKKRKLDENGFGDSDPL---KLSPSEARKLIERFTPEQLLDILQDAVARHADVLASV  57

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            R++AD D +QRKLF+RGLGW+TTTD LRSLFS YGELEEAVVI+DKATGKSKGYGF+TF+
Sbjct  58   RAVADPDVSQRKLFVRGLGWDTTTDGLRSLFSAYGELEEAVVIVDKATGKSKGYGFVTFR  117

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGA+LAL+EPSK+IDGR+TVTQLAAA         S+ N  D++LRKIYV
Sbjct  118  HVDGAILALREPSKRIDGRVTVTQLAAA-----GNSASNANAADVALRKIYV  164


 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 45/80 (56%), Gaps = 1/80 (1%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  +  E   DKL + FS YGE+EE  +  DK  GKSKG  F  +K  +GA 
Sbjct  156  DVALRKIYVANVPPELPADKLLAQFSVYGEIEEGPLGFDKQLGKSKGLPF-GYKFPEGAQ  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A  +P K ++GR    +LA
Sbjct  215  AAFIDPVKTVEGRQLSCKLA  234



>gb|AGV54416.1| polyadenylate-binding protein [Phaseolus vulgaris]
Length=438

 Score =   213 bits (542),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 112/172 (65%), Positives = 139/172 (81%), Gaps = 9/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV-SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAV  205
            MD  KKRKL++NG   SDP    +LS  +ARK++E FT +QL +I+Q+AV RH DVL +V
Sbjct  1    MDLTKKRKLDENGFGDSDPL---KLSPSEARKLIERFTPEQLLDILQDAVARHADVLASV  57

Query  206  RSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFK  385
            R++AD D +QRKLF+RGLGW+TTTD LRSLFS YGELEEAVVI+DKATGKSKGYGF+TF+
Sbjct  58   RAVADPDVSQRKLFVRGLGWDTTTDGLRSLFSAYGELEEAVVIVDKATGKSKGYGFVTFR  117

Query  386  HIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            H+DGA+LAL+EPSK+IDGR+TVTQLAAA         S+ N  D++LRKIYV
Sbjct  118  HVDGAILALREPSKRIDGRVTVTQLAAA-----GNSASNANAADVALRKIYV  164


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  +  +   DKL + FS YGE+EE  +  DK TGKSKG+    +K+ +GA 
Sbjct  156  DVALRKIYVANVPPDLPADKLLAHFSVYGEIEEGPLGFDKQTGKSKGFALFVYKNPEGAQ  215

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K ++GR    +LA
Sbjct  216  AALLDPVKTVEGRQLSCKLA  235



>ref|XP_004510069.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3 homolog 
2-like [Cicer arietinum]
Length=418

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 110/171 (64%), Positives = 131/171 (77%), Gaps = 19/171 (11%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            MD  KKRKL++NG                 +I+E F   QL  I+Q+AVVRHPDVL +VR
Sbjct  1    MDPTKKRKLDENGF--------------GGEIIERFPPAQLINILQDAVVRHPDVLSSVR  46

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            ++AD D +QRKLFIRGLGW+TTTD LRSLFSTYGELEEA+VI+DKATGKSKGYGF+TF+H
Sbjct  47   AVADTDISQRKLFIRGLGWDTTTDGLRSLFSTYGELEEAIVIVDKATGKSKGYGFVTFRH  106

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +DGALLAL+EPSK+IDGR+TVTQLAAAG       GS+ N  D +LRKIYV
Sbjct  107  VDGALLALREPSKRIDGRVTVTQLAAAG-----NSGSNTNSTDTALRKIYV  152


 Score = 67.0 bits (162),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            DT  RK+++  +  +   DKL + FS YGE+EE  +  DK TG+SKG+    +K  +GA 
Sbjct  144  DTALRKIYVSNVTPDLAADKLLAHFSLYGEIEEGPLGFDKQTGRSKGFALFVYKTPEGAQ  203

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K ++GR    +LA
Sbjct  204  AALLEPVKNVEGRQLNCKLA  223



>ref|XP_002882908.1| hypothetical protein ARALYDRAFT_478927 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59167.1| hypothetical protein ARALYDRAFT_478927 [Arabidopsis lyrata subsp. 
lyrata]
Length=404

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 113/179 (63%), Positives = 137/179 (77%), Gaps = 16/179 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSD--------PSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRH  184
            MD MKKRKL++NG            P+   RL+ +DARKI+E FT DQL +++Q A+VRH
Sbjct  1    MDMMKKRKLDENGGGLITNGGGIIGPT---RLTPQDARKIIERFTTDQLLDLLQEAIVRH  57

Query  185  PDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKG  364
            PDVL +VRS AD D +QRKLFIRGL  +TTT+ L SLFS YG+LEEA+VILDK TGKSKG
Sbjct  58   PDVLDSVRSTADSDISQRKLFIRGLAADTTTEGLLSLFSNYGDLEEAIVILDKVTGKSKG  117

Query  365  YGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            YGF+TF H+DGALLALKEPSK+IDGR+TVTQLAA+G Q     G+ +   DIS+RKIYV
Sbjct  118  YGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQ-----GTGSQIADISMRKIYV  171


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  163  DISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P K IDG+    +LA
Sbjct  223  TALADPVKVIDGKHLNCKLA  242



>emb|CDY24106.1| BnaA06g01040D [Brassica napus]
Length=413

 Score =   212 bits (540),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 115/173 (66%), Positives = 144/173 (83%), Gaps = 3/173 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD +KKR+L++NG  +++D + + RL+  DARK++E F+ DQL +I+QNAV RHPDVL  
Sbjct  1    MDMLKKRRLDENGNGILND-AHITRLTPHDARKLIERFSTDQLLDILQNAVARHPDVLEL  59

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS AD D TQRKLFIRGL  ETTT+ LRSLFSTYG+LE+A+VILDK T KSKGYGF+TF
Sbjct  60   VRSTADADITQRKLFIRGLAAETTTEGLRSLFSTYGDLEKAIVILDKVTAKSKGYGFVTF  119

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGALLALK+PSK+IDGR+TVTQLAAAG QGG G  ++ N  D+S+RKIYV
Sbjct  120  RHVDGALLALKDPSKKIDGRVTVTQLAAAGNQGGGGTAAAANGSDVSMRKIYV  172


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   D+L +LF  YGE+EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DVSMRKIYVANVPVDMPADRLLNLFVAYGEIEEGPLGFDKVTGKSRGFALFVYKSPEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P+K IDG+    +LA
Sbjct  224  SALADPTKVIDGKHLQCKLA  243



>ref|XP_009795836.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
 ref|XP_009795837.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
Length=420

 Score =   213 bits (541),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 106/182 (58%), Positives = 134/182 (74%), Gaps = 16/182 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNG----------VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVV  178
            MD  KKRK ++NG            + P  L  LS ED  +ILE FT+DQ   I++NA +
Sbjct  1    MDLTKKRKADENGGAYPVSNELVTAAAPPALGVLSPEDIDRILEPFTKDQCISILRNASL  60

Query  179  RHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKS  358
            R+PD+L AVRSIAD D +QRKLF+RGLGWETTTDKL+ +FS YGEL+EA+VI DKA+ KS
Sbjct  61   RYPDILEAVRSIADADVSQRKLFVRGLGWETTTDKLKQVFSAYGELDEAIVITDKASQKS  120

Query  359  KGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIY  538
            KGYGF+TFKH+D ++LALKEP+K+IDGR+TVTQLAAAG         ++   D++LRKIY
Sbjct  121  KGYGFVTFKHVDASILALKEPNKKIDGRITVTQLAAAG------NAGNSQSADVALRKIY  174

Query  539  VG  544
            VG
Sbjct  175  VG  176


 Score = 69.7 bits (169),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E T++KL + FS YGE+EE  +  DK TGK+KG+ F  +K  +GA 
Sbjct  167  DVALRKIYVGNVPFEITSEKLLNHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEEGAR  226

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG   + +LA
Sbjct  227  ASLVDPVKTIDGHQVLCKLA  246



>ref|XP_002894431.1| hypothetical protein ARALYDRAFT_892356 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70690.1| hypothetical protein ARALYDRAFT_892356 [Arabidopsis lyrata subsp. 
lyrata]
Length=420

 Score =   212 bits (540),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 114/176 (65%), Positives = 134/176 (76%), Gaps = 9/176 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS-----DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MD +KKRKL++NG+       + S   RL  +DARKI+E F+ DQL +I+Q AVVRH DV
Sbjct  1    MDMLKKRKLDENGIGMLNDGINGSVSSRLMPQDARKIIERFSTDQLLDILQEAVVRHTDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L  VR  AD D +QRKLFIRGL  ETTT+ LRSLFS YG+L+EA+VILDK T KSKGYGF
Sbjct  61   LEIVRLTADSDISQRKLFIRGLAAETTTEGLRSLFSNYGDLDEAIVILDKVTAKSKGYGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +TFKH+DGALLALKEPSK+IDGR+TVTQLAAAG QG      S    DIS+RKIYV
Sbjct  121  VTFKHVDGALLALKEPSKKIDGRVTVTQLAAAGNQGTTNSHVS----DISMRKIYV  172


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  164  DISMRKIYVANVPFDMPADRLLNQFLAYGDIEEGPLGFDKITGKSRGFALFVYKTAEGAQ  223

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL EP K +DG+    +LA  G
Sbjct  224  AALAEPMKVVDGKNLQCKLAIDG  246



>gb|EPS74427.1| hypothetical protein M569_00327 [Genlisea aurea]
Length=414

 Score =   211 bits (538),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 110/187 (59%), Positives = 137/187 (73%), Gaps = 16/187 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS-----------DPSFLPRLSLEDARKILESFTRDQLFEIVQNAV  175
            MD +K+R++++NG              D   +  L++ DA KILE  T DQ+  ++QNAV
Sbjct  1    MDPIKRRRVDENGAAVPLPVAVAVAVADTESINMLNVNDALKILEPLTHDQILGVLQNAV  60

Query  176  VRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGK  355
            +RHPDVL AVR+ AD+D TQRKLFIRGLGWET+T+KL ++FS+YGEL+EA VILDK TGK
Sbjct  61   LRHPDVLDAVRTFADRDVTQRKLFIRGLGWETSTEKLGAIFSSYGELDEAAVILDKYTGK  120

Query  356  SKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpV-----DI  520
            SKGYGFITFKHIDGA++ALKEPSK+IDGRMTVTQLA+AG+  G   G           D+
Sbjct  121  SKGYGFITFKHIDGAIMALKEPSKKIDGRMTVTQLASAGVSTGGAAGVGGVGGASNPRDV  180

Query  521  SLRKIYV  541
            S RKIYV
Sbjct  181  SARKIYV  187


 Score = 66.6 bits (161),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D + RK+++  + ++  +++L   FS YGE+EE  +  DKATGKSKG+    +K ++ A
Sbjct  178  RDVSARKIYVSNVPYDMPSERLLQHFSMYGEIEEGPLGFDKATGKSKGFALFVYKTVEAA  237

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              +L +P K++DG     +LA  G
Sbjct  238  RASLVDPIKKVDGHQLSCKLAVDG  261



>ref|NP_188119.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 ref|NP_974317.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 sp|Q9LKA4.1|UBA2C_ARATH RecName: Full=UBP1-associated protein 2C [Arabidopsis thaliana]
 dbj|BAA97064.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL36202.1| putative RNA-binding protein [Arabidopsis thaliana]
 gb|AAM14167.1| putative RNA-binding protein [Arabidopsis thaliana]
 dbj|BAH19456.1| AT3G15010 [Arabidopsis thaliana]
 gb|AEE75602.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
 gb|AEE75603.1| RNA recognition motif-containing protein [Arabidopsis thaliana]
Length=404

 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 114/179 (64%), Positives = 138/179 (77%), Gaps = 16/179 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS--------DPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRH  184
            MD MKKRKL++NG            P+   RLS +DARKI+E FT DQL +++Q A+VRH
Sbjct  1    MDMMKKRKLDENGNGLNTNGGGTIGPT---RLSPQDARKIIERFTTDQLLDLLQEAIVRH  57

Query  185  PDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKG  364
            PDVL +VR  AD D +QRKLFIRGL  +TTT+ LRSLFS+YG+LEEA+VILDK TGKSKG
Sbjct  58   PDVLESVRLTADSDISQRKLFIRGLAADTTTEGLRSLFSSYGDLEEAIVILDKVTGKSKG  117

Query  365  YGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            YGF+TF H+DGALLALKEPSK+IDGR+TVTQLAA+G Q     G+ +   DIS+RKIYV
Sbjct  118  YGFVTFMHVDGALLALKEPSKKIDGRVTVTQLAASGNQ-----GTGSQIADISMRKIYV  171


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + ++   D+L + F  YG++EE  +  DK TGKS+G+    +K  +GA 
Sbjct  163  DISMRKIYVANVPFDMPADRLLNHFMAYGDVEEGPLGFDKVTGKSRGFALFVYKTAEGAQ  222

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL +P K IDG+    +LA  G
Sbjct  223  AALADPVKVIDGKHLNCKLAVDG  245



>gb|ACN41154.1| unknown [Picea sitchensis]
Length=446

 Score =   211 bits (538),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 104/168 (62%), Positives = 129/168 (77%), Gaps = 13/168 (8%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            KKRK+E+NGVV        +++ED RK+LE FTR+QL +I+Q A  +H  VL  VRSIAD
Sbjct  6    KKRKVEENGVVD-------ITVEDTRKMLEPFTREQLLDILQEAATKHLGVLEQVRSIAD  58

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D  QRKLF+RGLGW+T T+ L++LFS +GELEE VVI+DK TGKSKGYGF+TFKH+DGA
Sbjct  59   KDPAQRKLFVRGLGWDTNTESLKALFSQFGELEEGVVIMDKNTGKSKGYGFVTFKHMDGA  118

Query  401  LLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            L ALKEPSK+IDGRMTV+QLA+AG Q       +    D+S RKIYVG
Sbjct  119  LNALKEPSKKIDGRMTVSQLASAGSQ------PAQPAADVSARKIYVG  160


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   D+L SLFS YGE+EE  +  DK +GKS+G+    FK +D   
Sbjct  151  DVSARKIYVGNVPMDMAADRLLSLFSQYGEIEEGPLGFDKQSGKSRGFALFIFKSVDATK  210

Query  404  LALKEPSKQIDGRMTVTQLAAAGMQ  478
             AL+EP K IDG     +LA  G +
Sbjct  211  RALEEPMKTIDGHQMFCKLAVEGQK  235



>ref|XP_009616692.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
 ref|XP_009616693.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
Length=420

 Score =   209 bits (532),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/183 (58%), Positives = 135/183 (74%), Gaps = 18/183 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-----------VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAV  175
            MD  KKRK ++NG             + P+ L  LS ED  +ILE FT+DQ   I++NA 
Sbjct  1    MDLTKKRKADENGGAYPVSNELVTAAASPA-LGVLSPEDIDRILEPFTKDQCISILRNAS  59

Query  176  VRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGK  355
            +R+PD+L AVRSIAD D +QRKLF+RGLGWETTTDKL+ +FS YGEL+EA+VI DKA+ K
Sbjct  60   LRYPDILEAVRSIADADVSQRKLFVRGLGWETTTDKLKQVFSAYGELDEAIVITDKASQK  119

Query  356  SKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKI  535
            SKGYGF+TFKH+D ++LALKEP+K+IDGR+TVTQLAAAG         ++   D++LRKI
Sbjct  120  SKGYGFVTFKHVDASILALKEPNKKIDGRITVTQLAAAG------NSGNSQSADVALRKI  173

Query  536  YVG  544
            YVG
Sbjct  174  YVG  176


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E T++KL + FS YGE+EE  +  DK TGK+KG+ F  +K  +GA 
Sbjct  167  DVALRKIYVGNVPFEITSEKLLNHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEEGAR  226

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K IDG   + +LA
Sbjct  227  ASLVDPVKTIDGHQVLCKLA  246



>emb|CDY26001.1| BnaC06g06230D [Brassica napus]
Length=407

 Score =   208 bits (530),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 111/173 (64%), Positives = 141/173 (82%), Gaps = 5/173 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD +KKR+L++NG  +++D + + RL+  DARK++E F+ DQL +I+QNAV RHPDVL  
Sbjct  1    MDMLKKRRLDENGNGILND-AHITRLTPHDARKLIERFSTDQLLDILQNAVARHPDVLDL  59

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VRS AD D TQRKLFIRGL  ETTT+ LRSLFS+YG+LEEA+VILDK T KSKGYGF+TF
Sbjct  60   VRSTADADITQRKLFIRGLAAETTTEGLRSLFSSYGDLEEAIVILDKVTAKSKGYGFVTF  119

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            +H+DGALLALK+PSK++DGR+TVTQLAAAG QG     +  +  D+S+RKIYV
Sbjct  120  RHVDGALLALKDPSKKMDGRVTVTQLAAAGNQGAAAAAAHVS--DVSMRKIYV  170


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
             D + RK+++  +  +   D+L +LF  YGE+EE  +  DK TGKS+G+    +K  +GA
Sbjct  161  SDVSMRKIYVANVPVDMPADRLLNLFLAYGEIEEGPLGFDKVTGKSRGFALFVYKTSEGA  220

Query  401  LLALKEPSKQIDGRMTVTQLA  463
              AL +P+K IDG+    +LA
Sbjct  221  QAALADPTKVIDGKHLQCKLA  241



>gb|EYU28074.1| hypothetical protein MIMGU_mgv1a007599mg [Erythranthe guttata]
 gb|EYU28075.1| hypothetical protein MIMGU_mgv1a007599mg [Erythranthe guttata]
Length=402

 Score =   208 bits (529),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 107/187 (57%), Positives = 133/187 (71%), Gaps = 21/187 (11%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-------------VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQN  169
            MD  KKRK ++NG               + P  +  LS EDA KILE FT++QL  I++ 
Sbjct  1    MDLSKKRKADENGRAYPLGTDLNNTMAAAPPPQMSILSPEDAEKILEPFTKEQLLPILRA  60

Query  170  AVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEA--VVILDK  343
            AV+RHPDVL  VR++AD D  QRKLF+RGLGWETTT+KLR  FS YGEL+EA  +VI DK
Sbjct  61   AVLRHPDVLEEVRAVADADPVQRKLFVRGLGWETTTEKLRQEFSAYGELDEANSIVITDK  120

Query  344  ATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDIS  523
             TGKSKGYGF+TF HID A+LALK+P+K+IDGR+TVTQLAAAG         +++  D++
Sbjct  121  NTGKSKGYGFVTFNHIDAAILALKQPNKKIDGRITVTQLAAAG------NSGNSHSTDVA  174

Query  524  LRKIYVG  544
            LRKIYVG
Sbjct  175  LRKIYVG  181


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E ++++L + FS YGE+EE  +  DK TGK+KG+ F  +K  +GA 
Sbjct  172  DVALRKIYVGNIPFEISSERLLAHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEEGAK  231

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K +DG   V +LA
Sbjct  232  SSLVDPMKTVDGHQLVCKLA  251



>ref|XP_010062800.1| PREDICTED: UBP1-associated protein 2C-like [Eucalyptus grandis]
 gb|KCW69929.1| hypothetical protein EUGRSUZ_F03253 [Eucalyptus grandis]
Length=429

 Score =   208 bits (529),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 113/173 (65%), Positives = 140/173 (81%), Gaps = 6/173 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS--FLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            MD  KKRK++DNGV    S      L+ ++ R++LESF++DQL +++Q+A++RHPD+  A
Sbjct  1    MDLAKKRKMDDNGVAPPDSSDAGAALTRDEGRRMLESFSKDQLLDLLQDALLRHPDLRAA  60

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
             RS+AD D T+RKLFIRGLGW+TT D LRSLFSTYGELEEAVVILDKATGKSKGYGF+TF
Sbjct  61   ARSVADADPTRRKLFIRGLGWDTTNDSLRSLFSTYGELEEAVVILDKATGKSKGYGFVTF  120

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            KH+DGALLAL+EPSK+I+GR+TVTQLAAAG      G S+ N  D+S RKIYV
Sbjct  121  KHVDGALLALREPSKRIEGRVTVTQLAAAG----NSGASTGNSADVSDRKIYV  169


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +   DKL S F  YGE+EE  +  DK TGKS+G+    +K  +GA 
Sbjct  161  DVSDRKIYVANVPIDMPADKLLSHFLMYGEIEEGPLGFDKQTGKSRGFALFVYKTAEGAQ  220

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K IDGR    +LA
Sbjct  221  AALAEPVKNIDGRPLNCKLA  240



>ref|XP_011096428.1| PREDICTED: UBP1-associated protein 2C [Sesamum indicum]
 ref|XP_011096429.1| PREDICTED: UBP1-associated protein 2C [Sesamum indicum]
Length=412

 Score =   207 bits (528),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 109/187 (58%), Positives = 137/187 (73%), Gaps = 21/187 (11%)
 Frame = +2

Query  29   MDFMKKRKLEDNG----VVSD---------PSFLPRLSLEDARKILESFTRDQLFEIVQN  169
            MD  KKRK ++ G    + SD         P  +  LS EDA KILE FT++QL  I++ 
Sbjct  1    MDLTKKRKADEYGRAYPLTSDINNTAAAGAPPPIGILSPEDAEKILEPFTKEQLLPILRA  60

Query  170  AVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEA--VVILDK  343
            AV+RHPDVL AVR++AD D  QRKLF+RGLGWETTT+KLR +F+ YGEL+EA  +VI DK
Sbjct  61   AVLRHPDVLEAVRTVADADPVQRKLFVRGLGWETTTEKLRQVFAAYGELDEANTIVITDK  120

Query  344  ATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDIS  523
             +GKSKGYGF+TFKHID A+LALKEP+K+IDGR+TVTQLAAAG         +++  D++
Sbjct  121  NSGKSKGYGFVTFKHIDAAILALKEPNKKIDGRITVTQLAAAG------NSGNSHSTDVA  174

Query  524  LRKIYVG  544
            LRKIYVG
Sbjct  175  LRKIYVG  181


 Score = 70.9 bits (172),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 52/81 (64%), Gaps = 0/81 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E ++++L + FS YGE+EE  +  DK TGK+KG+ F  +K  +GA 
Sbjct  172  DVALRKIYVGNIPFEISSERLLAHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEEGAK  231

Query  404  LALKEPSKQIDGRMTVTQLAA  466
             +L +P K IDG   V +LAA
Sbjct  232  ASLVDPMKTIDGHQVVCKLAA  252



>gb|AES90335.2| heterogeneous nuclear ribonucleoprotein [Medicago truncatula]
Length=356

 Score =   205 bits (522),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 139/179 (78%), Gaps = 18/179 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS-------FLPRLSLEDARKILESFTRDQLFEIVQNAVVRHP  187
            M+F KKRK E+NG  + P          P L+ +D RKIL+ FT++QL +++Q+A ++HP
Sbjct  1    MEF-KKRKTEENGDANSPPSSIDAAVIPPALTSDDIRKILQPFTQEQLLDLLQSASLQHP  59

Query  188  DVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGY  367
            D+L AVRS+AD+DTT+RKLF+RGL  ETTT+ LR++FS+YG+L+EA+VI DKATG+SKGY
Sbjct  60   DILDAVRSVADRDTTRRKLFVRGLSGETTTETLRTVFSSYGDLDEAIVIFDKATGRSKGY  119

Query  368  GFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            GF+ ++H+DGA+LALKEPSK+IDGRMTVTQLAAAG  GG          D+S RK++VG
Sbjct  120  GFVVYRHVDGAVLALKEPSKKIDGRMTVTQLAAAGSTGG----------DVSSRKVFVG  168


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E + + L S FS YGE+EE  +  DKA+GK++G+ F  +K  +GA 
Sbjct  159  DVSSRKVFVGNVPFEVSAESLLSEFSKYGEIEEGPLGFDKASGKTRGFAFFVYKTEEGAK  218

Query  404  LALKEPSKQIDGRMTVTQLA  463
             ++ E  K +DG   + + A
Sbjct  219  NSVAESMKTVDGHQVICKFA  238



>ref|XP_009400549.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400550.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
Length=435

 Score =   207 bits (526),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 130/168 (77%), Gaps = 5/168 (3%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVR-HPDVLGAVRSIA  217
            KKRK ++NG ++       L+ ED RKI+++F+ DQL +IV  AV R  P VL  VR+IA
Sbjct  6    KKRKADENGALATAIPAAELTPEDGRKIIDAFSLDQLRDIVAAAVSRGEPGVLADVRAIA  65

Query  218  DQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            D+D +QRKLFIRGLG ETTTD +RSLFSTYGE+EEA VI+D+ATGKSKGYGFITF+HIDG
Sbjct  66   DRDQSQRKLFIRGLGMETTTDAVRSLFSTYGEIEEAAVIVDRATGKSKGYGFITFRHIDG  125

Query  398  ALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            AL ALKEPSK+IDGRMTVTQLAAAG      G  +    D+SLRKIYV
Sbjct  126  ALRALKEPSKKIDGRMTVTQLAAAG----NSGSGAAPSADVSLRKIYV  169


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +K ++GA 
Sbjct  161  DVSLRKIYVANVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYKTVEGAK  220

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P+K IDG   V +LA
Sbjct  221  NSLVDPNKNIDGHNLVCKLA  240



>ref|XP_003608138.1| Heterogeneous nuclear ribonucleoprotein A3-like protein [Medicago 
truncatula]
Length=401

 Score =   205 bits (522),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 103/179 (58%), Positives = 139/179 (78%), Gaps = 18/179 (10%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS-------FLPRLSLEDARKILESFTRDQLFEIVQNAVVRHP  187
            M+F KKRK E+NG  + P          P L+ +D RKIL+ FT++QL +++Q+A ++HP
Sbjct  1    MEF-KKRKTEENGDANSPPSSIDAAVIPPALTSDDIRKILQPFTQEQLLDLLQSASLQHP  59

Query  188  DVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGY  367
            D+L AVRS+AD+DTT+RKLF+RGL  ETTT+ LR++FS+YG+L+EA+VI DKATG+SKGY
Sbjct  60   DILDAVRSVADRDTTRRKLFVRGLSGETTTETLRTVFSSYGDLDEAIVIFDKATGRSKGY  119

Query  368  GFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            GF+ ++H+DGA+LALKEPSK+IDGRMTVTQLAAAG  GG          D+S RK++VG
Sbjct  120  GFVVYRHVDGAVLALKEPSKKIDGRMTVTQLAAAGSTGG----------DVSSRKVFVG  168


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E + + L S FS YGE+EE  +  DKA+GK++G+ F  +K  +GA 
Sbjct  159  DVSSRKVFVGNVPFEVSAESLLSEFSKYGEIEEGPLGFDKASGKTRGFAFFVYKTEEGAK  218

Query  404  LALKEPSKQIDGRMTVTQLA  463
             ++ E  K +DG   + + A
Sbjct  219  NSVAESMKTVDGHQVICKFA  238



>ref|XP_009400552.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400553.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009400554.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
Length=444

 Score =   206 bits (524),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 109/168 (65%), Positives = 130/168 (77%), Gaps = 5/168 (3%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVR-HPDVLGAVRSIA  217
            KKRK ++NG ++       L+ ED RKI+++F+ DQL +IV  AV R  P VL  VR+IA
Sbjct  6    KKRKADENGALATAIPAAELTPEDGRKIIDAFSLDQLRDIVAAAVSRGEPGVLDDVRAIA  65

Query  218  DQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            D+D +QRKLFIRGLG ETTTD +RSLFSTYGE+EEA VI+D+ATGKSKGYGFITF+HIDG
Sbjct  66   DRDQSQRKLFIRGLGMETTTDAVRSLFSTYGEIEEAAVIVDRATGKSKGYGFITFRHIDG  125

Query  398  ALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            AL ALKEPSK+IDGRMTVTQLAAAG      G  +    D+SLRKIYV
Sbjct  126  ALRALKEPSKKIDGRMTVTQLAAAG----NSGSGAAPSADVSLRKIYV  169


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +  +D+L + FS+YGE+EE  +  DK TGK +G+    +  ++GA 
Sbjct  161  DVSLRKIYVANVPADMPSDRLLAHFSSYGEIEEGPLGFDKQTGKFRGFALFVYMTVEGAK  220

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P+K IDG   V +LA
Sbjct  221  NSLVDPNKNIDGHNLVCKLA  240



>ref|XP_002305079.1| hypothetical protein POPTR_0004s05450g [Populus trichocarpa]
 gb|EEE85590.1| hypothetical protein POPTR_0004s05450g [Populus trichocarpa]
Length=384

 Score =   202 bits (515),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 136/177 (77%), Gaps = 15/177 (8%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV-----VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            M+F+KKRK E+NG+      S PS +  L+ E+ RKILE FT+DQL +I+Q+A + H D+
Sbjct  1    MEFIKKRKAEENGISIPTGTSPPSPITPLTPEEIRKILEPFTKDQLLDILQSATLHHSDI  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L +VRS+AD D + RKLFIRGL  ETT+D LR LFS++GELEEA+VI DK TGKSKG+GF
Sbjct  61   LNSVRSVADGDISLRKLFIRGLSSETTSDTLRILFSSFGELEEAIVIHDKNTGKSKGFGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ITFKH+D A+L+++EPSK+IDGR+TVTQLA+          ++++  D+SLRK+YVG
Sbjct  121  ITFKHVDSAMLSIREPSKKIDGRITVTQLAS----------NNSSTGDVSLRKVYVG  167


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A  + +  D + RK+++  + +E T+++L   FS YGE+EE  +  DK+TGKSKG+ F+ 
Sbjct  150  ASNNSSTGDVSLRKVYVGNVPFEITSERLLGFFSMYGEIEEGPLGFDKSTGKSKGFAFLI  209

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +K  DGA  A+ +P K IDG   V +LA
Sbjct  210  YKSEDGAKAAIADPMKNIDGHQVVCKLA  237



>gb|KDP21080.1| hypothetical protein JCGZ_21551 [Jatropha curcas]
Length=404

 Score =   202 bits (515),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 105/178 (59%), Positives = 132/178 (74%), Gaps = 11/178 (6%)
 Frame = +2

Query  29   MDFM-KKRKLEDNGVVSDPS-----FLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPD  190
            MD++ KKRK ++ G    P+         L+ ED RK++E FT++ L EI+Q A +RH D
Sbjct  1    MDYIAKKRKADEIGTAITPTSTVTAVSTALTPEDIRKVIEPFTKENLLEILQTAAIRHSD  60

Query  191  VLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYG  370
            VL ++R++AD D + RKLFIRGL  ETTTD +R+LFS+YGELEEAVVI DK TGKSKG+G
Sbjct  61   VLDSIRTVADGDISLRKLFIRGLSSETTTDTIRTLFSSYGELEEAVVIFDKNTGKSKGFG  120

Query  371  FITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            FIT+KH+DGAL+ALKEPSK+IDGRMTVTQLA+AG      G       D+SLRKIYVG
Sbjct  121  FITYKHVDGALIALKEPSKKIDGRMTVTQLASAGQSSSVAGSG-----DVSLRKIYVG  173


 Score = 70.5 bits (171),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 64/120 (53%), Gaps = 11/120 (9%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E ++KI    T  QL    Q++ V               D + RK+++  + ++  +++L
Sbjct  136  EPSKKIDGRMTVTQLASAGQSSSV-----------AGSGDVSLRKIYVGNVPYDIPSERL  184

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+EE  +  DKATGKSKG+ FI +K  +GA  A+ +P K +DG   + ++AA
Sbjct  185  LGFFLAYGEIEEGPLGFDKATGKSKGFAFIIYKTEEGAKAAIADPVKNLDGHQILCKMAA  244



>ref|XP_011005481.1| PREDICTED: UBP1-associated protein 2C-like [Populus euphratica]
Length=388

 Score =   201 bits (510),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 101/177 (57%), Positives = 133/177 (75%), Gaps = 15/177 (8%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV-----VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            M+F+KKRK ++NG+      S PS +  L+ E+ RKILE FT+DQL +I+Q+A + H D+
Sbjct  1    MEFIKKRKADENGISIPTGTSPPSPITPLTPEEIRKILEPFTKDQLLDILQSATLHHSDI  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L +VRS+AD D + RKLFIRGL  ETT+D LR LFS++GELEEA+VI DK TGKSKG+GF
Sbjct  61   LNSVRSVADGDISLRKLFIRGLSSETTSDTLRILFSSFGELEEAIVIHDKNTGKSKGFGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ITFKH+D A+L+++EPSK+IDGR+TVTQLA+     G          D+SLRK+YVG
Sbjct  121  ITFKHVDSAMLSIREPSKKIDGRITVTQLASNNSSTG----------DVSLRKVYVG  167


 Score = 77.8 bits (190),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A  + +  D + RK+++  + +E T+++L   FS YGE+EE  +  DK+TGKSKG+ F+ 
Sbjct  150  ASNNSSTGDVSLRKVYVGNVPFEITSERLLGFFSMYGEIEEGPLGFDKSTGKSKGFAFLI  209

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +K  DGA  A+ +P K IDG   V +LA
Sbjct  210  YKSEDGAKAAIADPMKNIDGHQVVCKLA  237



>ref|XP_004293936.1| PREDICTED: UBP1-associated protein 2C-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011460604.1| PREDICTED: UBP1-associated protein 2C-like [Fragaria vesca subsp. 
vesca]
Length=353

 Score =   199 bits (507),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 108/175 (62%), Positives = 133/175 (76%), Gaps = 4/175 (2%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVS--DPSFLPR-LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            MD  KKRK E+NG VS   PS     L+ ED RK+L+  + D L EI+QNAVVRHPDVL 
Sbjct  1    MDSTKKRKTEENGDVSTAPPSSQSTTLTPEDFRKLLQPMSHDHLVEILQNAVVRHPDVLE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            ++R + ++D T RKLF+RGL  +TTTD LRS+FS++G+L+EA+VI DKATGKSKGYGF+T
Sbjct  61   SLRHVTNRDLTLRKLFVRGLSADTTTDSLRSVFSSFGDLDEAIVIFDKATGKSKGYGFVT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            FKH D AL+AL+EPSK+IDGR+TVTQ AAAG    P   SSN   D+S RKIYVG
Sbjct  121  FKHADEALIALREPSKKIDGRVTVTQYAAAG-HSAPFSSSSNGSADVSARKIYVG  174


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/102 (36%), Positives = 58/102 (57%), Gaps = 1/102 (1%)
 Frame = +2

Query  158  IVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVIL  337
            + Q A   H     +  S    D + RK+++  + ++ ++++L + FS +GE+EE  +  
Sbjct  144  VTQYAAAGHSAPFSS-SSNGSADVSARKIYVGTVPFDISSERLLAAFSAFGEIEEGPLGF  202

Query  338  DKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            DKATGKSKG+ F  +K  +GA  AL EP K IDG     +LA
Sbjct  203  DKATGKSKGFAFFVYKTEEGARAALAEPMKNIDGHQVTCKLA  244



>ref|XP_002522563.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
 gb|EEF39863.1| Heterogeneous nuclear ribonucleoprotein A1, putative [Ricinus 
communis]
Length=398

 Score =   200 bits (509),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 105/177 (59%), Positives = 129/177 (73%), Gaps = 6/177 (3%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSL-----EDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MDF KKRK ++NG  +  +            +D RKI+E FT++QL EI+QNA  RH DV
Sbjct  1    MDFTKKRKADENGTTTITTTSSPPPTTTLSPQDIRKIIEPFTKEQLLEILQNAATRHADV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L +VR++AD D + RKLFIRGL  ETTT+ +R+LF+ YGELEEA+VI DK TGKSKG+GF
Sbjct  61   LESVRTLADSDISLRKLFIRGLSSETTTETIRNLFNNYGELEEAIVIFDKNTGKSKGFGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ITFKH+DGAL+ALKEPSK+IDGRMTVTQLA+A         SS    D+S RKIYVG
Sbjct  121  ITFKHVDGALIALKEPSKKIDGRMTVTQLASA-GLSNSSINSSGGGSDVSARKIYVG  176


 Score = 72.0 bits (175),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  + +   +++L   F  YGE+EE  +  DK+TGKSKG+ FI +K  +GA 
Sbjct  167  DVSARKIYVGNVPYNIPSERLLGFFLNYGEVEEGPLGFDKSTGKSKGFAFIIYKTEEGAK  226

Query  404  LALKEPSKQIDGRMTVTQLAAA  469
             A+ +P K IDG   V ++A A
Sbjct  227  AAIADPVKMIDGHQVVCKMAVA  248



>ref|XP_010060672.1| PREDICTED: UBP1-associated protein 2C [Eucalyptus grandis]
 ref|XP_010060673.1| PREDICTED: UBP1-associated protein 2C [Eucalyptus grandis]
 gb|KCW67475.1| hypothetical protein EUGRSUZ_F01217 [Eucalyptus grandis]
 gb|KCW67476.1| hypothetical protein EUGRSUZ_F01217 [Eucalyptus grandis]
 gb|KCW67477.1| hypothetical protein EUGRSUZ_F01217 [Eucalyptus grandis]
Length=457

 Score =   201 bits (512),  Expect = 9e-59, Method: Compositional matrix adjust.
 Identities = 114/181 (63%), Positives = 142/181 (78%), Gaps = 13/181 (7%)
 Frame = +2

Query  26   AMDFMKKRKLED--NGVVSDPS------FLPRLSLEDARKILESFTRDQLFEIVQNAVVR  181
            A+D  KKRK+ED  NG    P           L+  +ARK++E+FTR+QL +++Q+A++ 
Sbjct  9    AVDLSKKRKIEDGNNGFAPPPPAGEQADAALALAPLEARKMVETFTREQLLDLLQDALIN  68

Query  182  HPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSK  361
            HPDVL A R++AD D TQRKLF+RGLGWETTT+ LRSLFS YGE+EEAVV+LDKATGKSK
Sbjct  69   HPDVLYAARAVADGDATQRKLFVRGLGWETTTEGLRSLFSVYGEIEEAVVVLDKATGKSK  128

Query  362  GYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            GYGF+TFKH+DGAL AL+EPSK+IDGR+ VTQLAAAG       GS++NPVD+S RKIYV
Sbjct  129  GYGFVTFKHVDGALRALREPSKKIDGRVAVTQLAAAG-----NSGSNSNPVDVSNRKIYV  183

Query  542  G  544
            G
Sbjct  184  G  184


 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+++  +  +  +DKL S FS YGE+EE  +  DK TGKS+G+    +K ++GA 
Sbjct  175  DVSNRKIYVGNVPNDMPSDKLLSHFSVYGEIEEGPLGFDKLTGKSRGFALFVYKTMEGAQ  234

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL EP K IDGR    +LA
Sbjct  235  AALVEPVKTIDGRQLNCKLA  254



>ref|XP_004505137.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A/B-like [Cicer 
arietinum]
Length=365

 Score =   197 bits (500),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 101/180 (56%), Positives = 137/180 (76%), Gaps = 16/180 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS--------FLPRLSLEDARKILESFTRDQLFEIVQNAVVRH  184
            MDF KKRK E+NG  + P             L+ ED RK+++ FT+DQL +++Q+A ++H
Sbjct  1    MDFSKKRKTEENGDANSPPPSTDAAATTTATLTPEDIRKMIQPFTQDQLLDLLQSASLQH  60

Query  185  PDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKG  364
            P+VL +VRSIAD+D T+RKLF+RGL  +TTTD LR++FS+YG+LEEA+VI DK+TG+SKG
Sbjct  61   PNVLDSVRSIADRDNTRRKLFVRGLAGDTTTDTLRAVFSSYGDLEEAIVIFDKSTGRSKG  120

Query  365  YGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            YGF+ F+H+DGA+LALKEPSK+IDGRMTVTQLAAA        G+ +   D+S RK++VG
Sbjct  121  YGFVVFRHVDGAILALKEPSKKIDGRMTVTQLAAA--------GAGSTGGDVSARKVFVG  172


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E +++ L S FS YGE+EE  +  DK++GK++G+ F  +K  +GA 
Sbjct  163  DVSARKVFVGNVPFEVSSESLLSEFSKYGEIEEGPLGFDKSSGKTRGFAFFVYKTEEGAR  222

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L E  K +DG   + +LA
Sbjct  223  ASLVESLKTVDGHQVICKLA  242



>ref|XP_010677513.1| PREDICTED: UBP1-associated protein 2C-like [Beta vulgaris subsp. 
vulgaris]
Length=398

 Score =   197 bits (502),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 104/185 (56%), Positives = 133/185 (72%), Gaps = 21/185 (11%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--VVSD-----------PSFLPRLSLEDARKILESFTRDQLFEIVQN  169
            M+ +KKRK ++NG   V+D           PS    L+L+DARK+LE FT +Q+  ++Q+
Sbjct  1    MESLKKRKADENGNSFVTDQTLISPTELTPPSENQTLTLDDARKLLEPFTHEQILSLLQS  60

Query  170  AVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKAT  349
            AVVR+ DVL + R++AD D ++RKLF+ GLG  TTTD L+SLFSTYGEL+EAVVI DK T
Sbjct  61   AVVRYSDVLSSARALADSDVSRRKLFVPGLGPNTTTDSLKSLFSTYGELDEAVVITDKTT  120

Query  350  GKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLR  529
            GKSKGYGF+TFKH+DGALLAL++PSK+IDGRMTVT LA+AG              D + R
Sbjct  121  GKSKGYGFVTFKHVDGALLALRQPSKKIDGRMTVTHLASAGRGPNSE--------DQATR  172

Query  530  KIYVG  544
            KIYVG
Sbjct  173  KIYVG  177


 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/91 (33%), Positives = 53/91 (58%), Gaps = 0/91 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A R    +D   RK+++  + +E + ++L   F+ +GE+EE  +  D+  GK++G+ F  
Sbjct  160  AGRGPNSEDQATRKIYVGNVPYEISAERLLDFFAAFGEIEEGPLGFDRQGGKARGFAFFV  219

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            +K  +GA ++L EP K IDG   + +LA  G
Sbjct  220  YKTEEGARMSLMEPMKMIDGHQVMCKLAGDG  250



>ref|XP_010677512.1| PREDICTED: UBP1-associated protein 2C-like [Beta vulgaris subsp. 
vulgaris]
Length=389

 Score =   197 bits (500),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 100/174 (57%), Positives = 131/174 (75%), Gaps = 12/174 (7%)
 Frame = +2

Query  29   MDFMKKRKLEDNG--VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            M+ +KKRK ++NG   V+D +    L+L+DARK+LE F+ +QL  ++Q AVVR+ DVL +
Sbjct  1    METLKKRKADENGNSFVTDQTLT--LTLDDARKLLEPFSHEQLLSLLQTAVVRYSDVLSS  58

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
             R++AD D ++RKLF+RGLG ETTT+ L SLF+TYGEL+EA+VI DK TGKSKGYGF+TF
Sbjct  59   ARALADSDVSRRKLFVRGLGPETTTESLNSLFATYGELDEAIVISDKTTGKSKGYGFVTF  118

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH+DGALLAL++P K+IDGRMTVT LA+AG              D + RKIYVG
Sbjct  119  KHVDGALLALRQPRKKIDGRMTVTHLASAGRGPNSE--------DQATRKIYVG  164


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/91 (36%), Positives = 54/91 (59%), Gaps = 0/91 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A R    +D   RK+++  + +E + ++L   F+T+GE+EE  +  DK  GK++G+ F  
Sbjct  147  AGRGPNSEDQATRKIYVGNVPYEISAERLLDFFATFGEIEEGPLGFDKQGGKTRGFAFFV  206

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            +K  +GA +AL EP K IDG   + +LA  G
Sbjct  207  YKTEEGARMALMEPMKMIDGNQVMCKLAEDG  237



>ref|XP_003529367.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0-like isoform 
X1 [Glycine max]
 ref|XP_006583847.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A0-like isoform 
X2 [Glycine max]
Length=384

 Score =   193 bits (491),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/187 (55%), Positives = 134/187 (72%), Gaps = 26/187 (14%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLE---------------DARKILESFTRDQLFEIV  163
            M+F KKRK E+NG  +D  + P+ S E               D RKIL+ F+++QL +++
Sbjct  1    MEFTKKRKTEENGDTTD--YPPQQSTEESPIAAAAPAPLAAEDIRKILQPFSQEQLLDLL  58

Query  164  QNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDK  343
            Q+A +RHPDVL AVR++AD D+T RKLF+RGL  ETTT+ LR +FS +GEL+EA+VI+DK
Sbjct  59   QSASLRHPDVLDAVRAVADLDSTLRKLFVRGLAGETTTETLRGVFSAFGELDEAIVIIDK  118

Query  344  ATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDIS  523
            ATG+SKGYGF+ F H+DGA+LALKEPSK+IDGRMTVTQLAAA               D+S
Sbjct  119  ATGRSKGYGFVVFSHVDGAILALKEPSKKIDGRMTVTQLAAA---------GGPGGGDVS  169

Query  524  LRKIYVG  544
            LRK++VG
Sbjct  170  LRKVFVG  176


 Score = 63.5 bits (153),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E ++++L   F  +GE+EE  +  DK++GKS+G+ F  +K  +GA 
Sbjct  167  DVSLRKVFVGNVPFEISSERLLDEFLKFGEVEEGPLGFDKSSGKSRGFAFFVYKTEEGAR  226

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L EP K I+G   + +LA
Sbjct  227  ASLVEPLKTIEGHQVICKLA  246



>ref|XP_002316830.2| hypothetical protein POPTR_0011s07480g [Populus trichocarpa]
 gb|EEE97442.2| hypothetical protein POPTR_0011s07480g [Populus trichocarpa]
Length=368

 Score =   192 bits (489),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 133/177 (75%), Gaps = 15/177 (8%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV-----VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MDF+KKRK ++NG       +  S +  L+ E+ RKI+E FT+DQL +I+Q+A + H DV
Sbjct  1    MDFIKKRKADENGNSIPTGTTPSSPITPLTPEEIRKIIEPFTKDQLLDILQSATLHHSDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L +VRS+AD D + RKLFIRGL  ETT++ LR LFS+ GELEEA+VI DK TGKSKG+GF
Sbjct  61   LNSVRSVADGDISLRKLFIRGLSSETTSETLRILFSSSGELEEAIVIHDKNTGKSKGFGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ITFKH+D A+L+++EPSK+IDGR+TVTQLA+          ++++  D+SLRK+YVG
Sbjct  121  ITFKHVDAAMLSIREPSKKIDGRITVTQLAS----------NNSSTTDVSLRKVYVG  167


 Score = 75.9 bits (185),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 57/89 (64%), Gaps = 0/89 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A  + +  D + RK+++  + +E ++++L   FS YGE+EE  +  DK+TGKSKG+ F+ 
Sbjct  150  ASNNSSTTDVSLRKVYVGNVPFEVSSERLLGFFSMYGEIEEGPLGFDKSTGKSKGFAFLI  209

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAA  466
            +K+ +GA  A+ +P K IDG   V + AA
Sbjct  210  YKNEEGAKAAIADPMKNIDGHQVVCKFAA  238



>ref|XP_011045924.1| PREDICTED: UBP1-associated protein 2C-like [Populus euphratica]
Length=373

 Score =   192 bits (488),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 98/177 (55%), Positives = 133/177 (75%), Gaps = 15/177 (8%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-----VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDV  193
            MDF+KKRK ++NG       +  S +  L+ E+ RKI+E FT+DQL +I+Q+A + H DV
Sbjct  1    MDFIKKRKADENGDSVPTGTTPSSPITPLTPEEIRKIIEPFTKDQLLDILQSATLHHSDV  60

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L +VRS+AD D + RKLFIRGL  ETT++ LR LFS+ GELEEA+VI DK TGKSKG+GF
Sbjct  61   LNSVRSVADGDISLRKLFIRGLSSETTSETLRILFSSSGELEEAIVIHDKNTGKSKGFGF  120

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ITFKH+D A+L+++EPSK+IDGR+TVTQLA+          ++++  D+SLRK+YVG
Sbjct  121  ITFKHVDAAMLSIREPSKKIDGRITVTQLAS----------NNSSTTDVSLRKVYVG  167


 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/89 (37%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
            A  + +  D + RK+++  + +E ++++L   FS YGE+EE  +  DK+ GKSKG+ F+ 
Sbjct  150  ASNNSSTTDVSLRKVYVGNVPFEVSSERLLGFFSMYGEIEEGPLGFDKSIGKSKGFAFLI  209

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAA  466
            +K+ +GA  A+ +P K IDG   V + AA
Sbjct  210  YKNEEGAKAAIADPMKNIDGHQVVCKFAA  238



>ref|XP_004231546.1| PREDICTED: UBP1-associated protein 2C [Solanum lycopersicum]
 ref|XP_004231547.1| PREDICTED: UBP1-associated protein 2C [Solanum lycopersicum]
 ref|XP_004231548.1| PREDICTED: UBP1-associated protein 2C [Solanum lycopersicum]
Length=424

 Score =   192 bits (489),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 103/183 (56%), Positives = 130/183 (71%), Gaps = 17/183 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNG-----------VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAV  175
            MD  KKRK ++NG             + P  L  LS ED  KILE+FT+DQ   I++NA 
Sbjct  1    MDLSKKRKTDENGGAYPVKTELVTTAAAPPALAVLSPEDIDKILETFTKDQCVSILRNAA  60

Query  176  VRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGK  355
            +R+PDVL  +R++AD D + RKLF+RGLGWETTTDKLR +FS +GEL+EAVVI DKA+ +
Sbjct  61   LRYPDVLEGLRAVADADVSNRKLFVRGLGWETTTDKLRQVFSEFGELDEAVVITDKASSR  120

Query  356  SKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKI  535
            SKGYGF+TFKH+D A+L+LK P+K IDGR+TVTQLAAAG  G           D++LRKI
Sbjct  121  SKGYGFVTFKHVDAAILSLKVPNKIIDGRVTVTQLAAAGNSGNSQSS------DVALRKI  174

Query  536  YVG  544
            YVG
Sbjct  175  YVG  177


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E +++KL + FS YGE+EE  +  DK TGK+KG+ F  +K  DGA 
Sbjct  168  DVALRKIYVGNVPFEISSEKLLNHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEDGAR  227

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K ++G   + +LA
Sbjct  228  ASLVDPVKTVEGHQVLCKLA  247



>ref|XP_003520185.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like isoform 
X1 [Glycine max]
 ref|XP_006575037.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like isoform 
X2 [Glycine max]
 ref|XP_006575038.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like isoform 
X3 [Glycine max]
Length=384

 Score =   191 bits (484),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 100/189 (53%), Positives = 135/189 (71%), Gaps = 26/189 (14%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLS-----------------LEDARKILESFTRDQLFE  157
            M+F KKRK ++NG  +  S  P+ +                  ED RKIL+ F+++QL +
Sbjct  1    MEFPKKRKTQENGDTTTDSPPPQSTEEAPLAAATPAPASPLASEDIRKILQPFSQEQLLD  60

Query  158  IVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVIL  337
            ++Q+A +RHPDVL AVR++AD D+T RKLF+RGL  ETTT+ LRS+FS +GEL+EA+VI+
Sbjct  61   LLQSASLRHPDVLDAVRAVADCDSTLRKLFVRGLAGETTTETLRSVFSGFGELDEAIVIM  120

Query  338  DKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVD  517
            DKATG+SKGYGF+ F+H+DGA+LALK+PSK+IDGRMTVTQLAAA               D
Sbjct  121  DKATGRSKGYGFVVFRHVDGAILALKDPSKKIDGRMTVTQLAAA---------GGPGGGD  171

Query  518  ISLRKIYVG  544
            +SLRK++VG
Sbjct  172  VSLRKVFVG  180


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E ++++L   F  +GE+EE  +  DK++GKS+G+ F  +K  +GA 
Sbjct  171  DVSLRKVFVGNVPFEISSERLLDEFLKFGEVEEGPLGFDKSSGKSRGFAFFVYKTEEGAR  230

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L EP K I+G   + +LA
Sbjct  231  ASLVEPLKTIEGHQVICKLA  250



>ref|XP_007153712.1| hypothetical protein PHAVU_003G058600g [Phaseolus vulgaris]
 gb|ESW25706.1| hypothetical protein PHAVU_003G058600g [Phaseolus vulgaris]
Length=386

 Score =   189 bits (481),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 103/185 (56%), Positives = 136/185 (74%), Gaps = 21/185 (11%)
 Frame = +2

Query  29   MDFMKKRKLEDNG----VVSDPS------FLP---RLSLEDARKILESFTRDQLFEIVQN  169
            MDF KKRK E+NG    + S PS       +P    L+ ED RKIL  F+++QL +++Q+
Sbjct  1    MDFSKKRKTEENGDADSLSSPPSQAFPTATVPTTAPLAAEDIRKILRPFSQEQLLDLLQS  60

Query  170  AVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKAT  349
            A +RH DVL AVR++AD+D+T RKLF+RGL  ETT++ LRS+FS +GEL+EA+VI DKAT
Sbjct  61   ASLRHSDVLDAVRAVADRDSTLRKLFVRGLAGETTSETLRSVFSAFGELDEAIVIFDKAT  120

Query  350  GKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLR  529
            G+SKGYGF+ F+H+DGA+LALK+PSK+IDGRMTVTQLAAA        G      D+S R
Sbjct  121  GRSKGYGFVVFRHVDGAILALKDPSKKIDGRMTVTQLAAA--------GGPGGSGDVSAR  172

Query  530  KIYVG  544
            K++VG
Sbjct  173  KVFVG  177


 Score = 72.8 bits (177),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  + +E ++DKL S F  +GE+EE  +  DK++GKS+G+ F  +K  +GA 
Sbjct  168  DVSARKVFVGNVPFEISSDKLLSEFLKFGEVEEGPLGFDKSSGKSRGFAFFVYKTEEGAR  227

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L+EP K IDG   + +LA
Sbjct  228  ASLQEPVKTIDGHQVICKLA  247



>ref|XP_006359092.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Solanum 
tuberosum]
Length=424

 Score =   190 bits (482),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 102/183 (56%), Positives = 128/183 (70%), Gaps = 17/183 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPS-----------FLPRLSLEDARKILESFTRDQLFEIVQNAV  175
            MD  KKRK ++NG     S            L  LS ED  KILE+FT+DQ   I++NA 
Sbjct  1    MDLTKKRKADENGGAYPVSNELVTTAAAPPALAVLSPEDIDKILETFTKDQCVSILRNAA  60

Query  176  VRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGK  355
            +R+ DVL  +R++AD D + RKLF+RGLGWETTTDKLR +FS +GEL+EAVVI DKA+ +
Sbjct  61   LRYADVLEGLRAVADADVSNRKLFVRGLGWETTTDKLRQVFSEFGELDEAVVITDKASSR  120

Query  356  SKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKI  535
            SKGYGF+TFKH+D A+L+LK P+K IDGR+TVTQLAAAG  G           D++LRKI
Sbjct  121  SKGYGFVTFKHVDAAILSLKVPNKIIDGRVTVTQLAAAGNSGNSQSS------DVALRKI  174

Query  536  YVG  544
            YVG
Sbjct  175  YVG  177


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+++  + +E +++KL + FS YGE+EE  +  DK TGK+KG+ F  +K  DGA 
Sbjct  168  DVALRKIYVGNVPFEISSEKLLNHFSMYGEIEEGPLGFDKQTGKAKGFAFFVYKTEDGAR  227

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +P K ++G   + +LA
Sbjct  228  ASLVDPVKTVEGHQVLCKLA  247



>ref|NP_001168409.1| hypothetical protein [Zea mays]
 ref|XP_008655205.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008655206.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 gb|ACN28124.1| unknown [Zea mays]
 gb|AFW83244.1| hypothetical protein ZEAMMB73_012333 [Zea mays]
Length=448

 Score =   183 bits (465),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 125/178 (70%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVV-SDPSFLPR---LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK +DNG V + P+       L+ ED  ++LE  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDDNGAVTASPAGGAATLGLTREDVLRLLEPLSRDQLADIAAAAALVSAHALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLFIRGLGWETT+D LR++FS YG+LEEAVVI DK+TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFIRGLGWETTSDSLRAIFSAYGDLEEAVVITDKSTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGM----QggpgggssnnpVDISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQLAAAG       G  G       D+SLRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPSVGAPGSGGAPVADVSLRKIFVG  181


 Score = 54.3 bits (129),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 27/80 (34%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  + ++++L + F++YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  172  DVSLRKIFVGNVPADMSSERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +  K ID    V +LA
Sbjct  232  ASLVDSVKVIDSHQLVCKLA  251



>ref|XP_001764798.1| predicted protein [Physcomitrella patens]
 gb|EDQ70497.1| predicted protein, partial [Physcomitrella patens]
Length=242

 Score =   176 bits (445),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/159 (52%), Positives = 119/159 (75%), Gaps = 8/159 (5%)
 Frame = +2

Query  68   VVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLF  247
              S P+F+  ++ ED +K++E FT++QL ++++NA + H DVL  +R +AD+D   RK+F
Sbjct  11   AASVPTFV--ITKEDVKKLVEPFTKEQLMDLLENAALNHADVLHEIRKLADKDPGHRKIF  68

Query  248  IRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSK  427
            +RGLGW+TTT+ L+++FS +GE+EE  VI+DKATGKS+G+GF+TFKH+DGA  +LKEPSK
Sbjct  69   VRGLGWDTTTETLKTVFSQFGEVEEGAVIMDKATGKSRGFGFVTFKHMDGAQRSLKEPSK  128

Query  428  QIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +IDGRMTV QLA+ G          N   ++S RKIYVG
Sbjct  129  RIDGRMTVCQLASTG------ALQVNPNQEVSQRKIYVG  161


 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 58/90 (64%), Gaps = 0/90 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            GA++   +Q+ +QRK+++  +  + + D+L +LF+ YGE+EE  +  DK TG+S+G+  I
Sbjct  143  GALQVNPNQEVSQRKIYVGNVPLDLSADRLLALFAGYGEIEEGPLGFDKFTGRSRGFALI  202

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             +K ++ A  AL EP K +DG     +LAA
Sbjct  203  IYKTVEAAKRALLEPIKTLDGIQMYCKLAA  232



>ref|NP_001150933.1| heterogeneous nuclear ribonucleoprotein A3-like protein 2 [Zea 
mays]
 gb|ACG40991.1| heterogeneous nuclear ribonucleoprotein A3-like protein 2 [Zea 
mays]
Length=447

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVV-SDPSFLPR---LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V + P+       L+ +D  ++LE  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVTASPAGGAATLGLTRDDVIRLLEPLSRDQLADIAAAAALVSSQALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWETT+D LR++FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETTSDSLRAIFSAYGDLEEAVVITDKPTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpV----DISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQLAAAG  GGP GG + +      D+SLRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPAGGPAGSGGAPVSDVSLRKIFVG  181


 Score = 57.4 bits (137),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  +  +++L + F++YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  172  DVSLRKIFVGNVPADMASERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +  K IDG   V +LA  G
Sbjct  232  ASLVDTVKVIDGHQLVCKLALDG  254



>ref|XP_008672966.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like protein 
2 isoform X1 [Zea mays]
 ref|XP_008672967.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like protein 
2 isoform X1 [Zea mays]
 ref|XP_008672968.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like protein 
2 isoform X1 [Zea mays]
 tpg|DAA58966.1| TPA: heterogeneous nuclear ribonucleoprotein A3-like protein 
2 isoform 1 [Zea mays]
 tpg|DAA58967.1| TPA: heterogeneous nuclear ribonucleoprotein A3-like protein 
2 isoform 2 [Zea mays]
Length=447

 Score =   168 bits (426),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 102/178 (57%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVV-SDPSFLPR---LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V + P+       L+ +D  ++LE  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVTASPAGGAATLGLTRDDVIRLLEPLSRDQLADIAAAAALVSSQALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWETT+D LR++FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETTSDSLRAIFSAYGDLEEAVVITDKPTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpV----DISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQLAAAG  GGP GG + +      D+SLRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPAGGPAGSGGAPVSDVSLRKIFVG  181


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  +  +++L + F++YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  172  DVSLRKIFVGNVPADMASERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +  K IDG   V +LA  G
Sbjct  232  ASLVDTVKVIDGHQLVCKLALDG  254



>ref|XP_002458152.1| hypothetical protein SORBIDRAFT_03g027820 [Sorghum bicolor]
 gb|EES03272.1| hypothetical protein SORBIDRAFT_03g027820 [Sorghum bicolor]
Length=445

 Score =   167 bits (423),  Expect = 7e-46, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 130/178 (73%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVV-SDPSFLPR---LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V + P+       L+ +D  ++LE  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVTASPAGGAATLGLTRDDVLRLLEPLSRDQLADIAAAAALVSAHALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWETT+D LR++FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETTSDSLRAIFSAYGDLEEAVVITDKTTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnp----VDISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQLAAAG  GGP GG++ +      D++LRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGSAGGPSGGAAGSGGAPVADVALRKIFVG  181


 Score = 56.6 bits (135),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK+F+  +  +  +++L + F++YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  172  DVALRKIFVGNVPADMPSERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +  K IDG   V +LA  G
Sbjct  232  ASLVDTVKVIDGHQLVCKLAIEG  254



>ref|XP_004969158.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like isoform 
X1 [Setaria italica]
 ref|XP_004969159.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like isoform 
X2 [Setaria italica]
Length=450

 Score =   167 bits (422),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 101/178 (57%), Positives = 129/178 (72%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVV-SDPSFLPR---LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            + KKRK ++NG   + P+       L+ +D  ++LE  +RDQL +I   A +     L A
Sbjct  4    YSKKRKPDENGAATASPAGGAAALGLTRDDVLRLLEPLSRDQLADIAAAAALVSAHALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWETT+D LRS+FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETTSDSLRSIFSAYGDLEEAVVITDKNTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnp----VDISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQLAAAG  GGP GG++ +      D+SLRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGAAGGPSGGAAGSGGAPVADVSLRKIFVG  181


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  + ++++L + F++YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  172  DVSLRKIFVGNVPADMSSERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +  K IDG   V +LA  G
Sbjct  232  ASLVDSVKVIDGHQLVCKLAIEG  254



>gb|ABK24718.1| unknown [Picea sitchensis]
 gb|ABR18466.1| unknown [Picea sitchensis]
Length=442

 Score =   160 bits (405),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 75/142 (53%), Positives = 103/142 (73%), Gaps = 6/142 (4%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE F ++QL +I+     + P +L ++R +AD+D   RK+F+RGLGWETT++ L+S+
Sbjct  51   KKLLEPFNKEQLMDIISEHAKKDPQLLESIRKLADKDPAHRKIFVRGLGWETTSEALKSV  110

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGM  475
            FS YGELEE  VI DK TGKSKGYGF+TFKH+ GA  ALK+PSK+ID RMT  Q+A+AG 
Sbjct  111  FSQYGELEECTVITDKGTGKSKGYGFVTFKHMVGAQKALKDPSKKIDSRMTACQMASAG-  169

Query  476  QggpgggssnnpVDISLRKIYV  541
                    ++ PV+ + RKIYV
Sbjct  170  -----PAPAHPPVEATGRKIYV  186


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 51/83 (61%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +  +   +KL + FS YGE+EE  +  DK TG+S+G+    +K+ +GA 
Sbjct  178  EATGRKIYVSNVSADIPAEKLLNFFSKYGEVEEGPLGFDKHTGRSRGFALFVYKNAEGAK  237

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP+K ++G     + AA G
Sbjct  238  KALEEPNKIVEGHSMNCKRAAEG  260



>dbj|BAJ89845.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=441

 Score =   157 bits (396),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 98/178 (55%), Positives = 126/178 (71%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVVSDPSFLPRLSL----EDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V+    +   +L    +D  ++L+  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVAASPAVGAATLGLTRDDVLRLLDPLSRDQLADIAAAAALASGVALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWET +D LR++FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETNSDSLRAIFSAYGDLEEAVVISDKTTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnn----pVDISLRKIYVG  544
            +H D ALLALKEPSK+ID R+TVTQLAAAG  GGP GG++        D+SLRKI+VG
Sbjct  124  RHADSALLALKEPSKKIDARVTVTQLAAAGAAGGPSGGTTGAGGIPSADVSLRKIFVG  181


 Score = 58.5 bits (140),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 29/88 (33%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +2

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             I   D + RK+F+  +  +  +++L + F++YGE+EE  +  DK TGK +G+    +K 
Sbjct  167  GIPSADVSLRKIFVGNVPADMPSERLLAHFASYGEIEEGPLGFDKLTGKFRGFALFVYKT  226

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +GA  +L + +K IDG+  + +LA  G
Sbjct  227  PEGAQASLVDSTKVIDGQQLLCKLAIEG  254



>gb|ACN39907.1| unknown [Picea sitchensis]
Length=536

 Score =   157 bits (398),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 74/144 (51%), Positives = 111/144 (77%), Gaps = 7/144 (5%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            KKRKLE+       S  P ++ E A K+L   T++QL +I++ A++ H D+L  VR I++
Sbjct  10   KKRKLEE-------SNTPEITEEVAAKLLVPLTKEQLADILKPAIINHSDLLDKVRQISN  62

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            QD + RKLF+RGLG+ETTT+  +S+F+ +GE+ +AVV++DK +GK+KGYGF+T++H+DGA
Sbjct  63   QDISLRKLFVRGLGYETTTESFKSVFAQHGEVIDAVVVVDKISGKNKGYGFVTYRHLDGA  122

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
            L AL+EPSK++DGR+ V+ LAAAG
Sbjct  123  LSALQEPSKEMDGRIVVSNLAAAG  146


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/88 (38%), Positives = 51/88 (58%), Gaps = 0/88 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A  D + R++++  +  +     L S FS YG++EE     D+ TGKSKGY  I ++ I+
Sbjct  234  ATTDASLRRIYVGNVPDDMKPATLTSFFSNYGDIEEGPGGFDRNTGKSKGYSLILYRTIE  293

Query  395  GALLALKEPSKQIDGRMTVTQLAAAGMQ  478
             A  AL++P K IDG     +LAA G++
Sbjct  294  AANRALEDPVKSIDGHQLFCKLAAEGLK  321



>ref|XP_002983841.1| hypothetical protein SELMODRAFT_45421, partial [Selaginella moellendorffii]
 gb|EFJ14853.1| hypothetical protein SELMODRAFT_45421, partial [Selaginella moellendorffii]
Length=251

 Score =   150 bits (379),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 85/178 (48%), Positives = 111/178 (62%), Gaps = 10/178 (6%)
 Frame = +2

Query  41   KKRKLE-DNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIA  217
            KKRK E D G  +     P L   D  K+LE   R  +  I+Q + ++HP VL  VR   
Sbjct  1    KKRKAEEDPGGDAGGVEQPDLDSADVLKLLEPLDRGAMHYILQISCLQHPAVLEEVRRYV  60

Query  218  DQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            D+D   RKLF+RGLGW+TTT+ L+ +FS  GE++EAV+I DKAT KS+G+GF++FKH+DG
Sbjct  61   DRDPAHRKLFVRGLGWDTTTETLKGVFSQSGEVDEAVIIRDKATQKSRGFGFVSFKHMDG  120

Query  398  ALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpV---------DISLRKIYVG  544
            AL ALKEPSK+IDGRMT  Q A+      P    + +           D+S RKIYVG
Sbjct  121  ALRALKEPSKRIDGRMTACQFASTSSSSTPCSSITPSMNPPPPRPFIEDVSTRKIYVG  178


 Score = 66.2 bits (160),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D + RK+++  +   T+ DK+ ++FS +GE+ E  +  D++TG SKG+  I F+  +GA
Sbjct  168  EDVSTRKIYVGSVPVGTSADKVLAIFSQFGEIAEGPLGFDRSTGASKGFALIIFRTSEGA  227

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              AL +P K IDG     +LAA G
Sbjct  228  RKALLDPFKTIDGHQVHCKLAAEG  251



>ref|XP_002960787.1| hypothetical protein SELMODRAFT_163608 [Selaginella moellendorffii]
 gb|EFJ38326.1| hypothetical protein SELMODRAFT_163608 [Selaginella moellendorffii]
Length=359

 Score =   152 bits (383),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 82/179 (46%), Positives = 112/179 (63%), Gaps = 19/179 (11%)
 Frame = +2

Query  29   MDFM----KKRKL---EDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHP  187
            MDF+    KKRKL   + NG      +   LS +D +++LE  +++QL  ++ +A  ++P
Sbjct  1    MDFVAEDTKKRKLNSDDSNG------YSVSLSKDDLKRLLEPLSKEQLVALLIDAGSQYP  54

Query  188  DVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGY  367
             V   +R +A +D   RKLF+RGL WETT+  LR  F  YGE+EE  VI DKATGKS+G+
Sbjct  55   AVADDIRDVASKDPAHRKLFVRGLAWETTSQALRDAFQHYGEIEEGAVITDKATGKSRGF  114

Query  368  GFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            GFITFKH+D A  ALKEPSK IDGR+TV  LA+ G        +     D + RK+Y+G
Sbjct  115  GFITFKHMDSAQRALKEPSKTIDGRITVCNLASVG------SSAGAGSADQAQRKLYIG  167


 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G+       D  QRKL+I GL +ET+ + L ++FS YGE+EE  V  DK T KS+G+ F
Sbjct  148  VGSSAGAGSADQAQRKLYIGGLSYETSNETLLNIFSQYGEIEEGAVAYDKNTNKSRGFAF  207

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
            IT+K ++ A  A+ +P+K I+GR  + +LAA G +
Sbjct  208  ITYKSVEAARKAIDDPNKTIEGRHVIVKLAAEGQK  242



>ref|NP_001043567.1| Os01g0614500 [Oryza sativa Japonica Group]
 dbj|BAD61233.1| heterogeneous nuclear ribonucleoprotein A2/B1-like [Oryza sativa 
Japonica Group]
 dbj|BAF05481.1| Os01g0614500 [Oryza sativa Japonica Group]
Length=447

 Score =   154 bits (388),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 87/153 (57%), Positives = 111/153 (73%), Gaps = 4/153 (3%)
 Frame = +2

Query  98   LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTT  277
            L+ +D  +++E  +RDQL +I   A +     L AVR+ AD+D   RKLF+RGLGWET +
Sbjct  30   LTRDDLLRLVEPLSRDQLADIAATAALASGVALDAVRAAADRDPALRKLFVRGLGWETNS  89

Query  278  DKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQ  457
            D LR++FS +G+LEEAVVI DK+TG+SKGYGF+TF+H D A+LALKEPSK+IDGRMTVTQ
Sbjct  90   DSLRAIFSAFGDLEEAVVITDKSTGRSKGYGFVTFRHADSAVLALKEPSKKIDGRMTVTQ  149

Query  458  L----AAAGMQggpgggssnnpVDISLRKIYVG  544
            L    AA G  GG  G       D+SLRKI+VG
Sbjct  150  LAAAGAAGGASGGAAGAGGAPAADVSLRKIFVG  182


 Score = 57.0 bits (136),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  +  +++L + F+ YGE+EE  +  DK TGK +G+    +K  +GA 
Sbjct  173  DVSLRKIFVGNVPADMPSERLLAHFAAYGEIEEGPLGFDKQTGKFRGFALFVYKTPEGAQ  232

Query  404  LALKEPSKQIDGRMTVTQLA  463
             +L +  K IDG   V +LA
Sbjct  233  ASLVDSVKVIDGHQLVCKLA  252



>ref|XP_003569353.1| PREDICTED: UBP1-associated protein 2C [Brachypodium distachyon]
 ref|XP_010232022.1| PREDICTED: UBP1-associated protein 2C [Brachypodium distachyon]
Length=448

 Score =   153 bits (387),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 97/178 (54%), Positives = 122/178 (69%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVVSDPSFLPR----LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V+           L+ +D  ++LE  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVAASPAAGAAALGLTRDDVLRLLEPLSRDQLADIAAAAALASGVALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWET +D LR++FS YG+LEEAVVI DK+TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETNSDSLRTIFSAYGDLEEAVVISDKSTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQL----AAAGMQggpgggssnnpVDISLRKIYVG  544
            +H D A+LALKEPSK+IDGRMTVTQL    AA G  GG  G       D+SLRKI+VG
Sbjct  124  RHADSAVLALKEPSKKIDGRMTVTQLAAAGAAGGPSGGTAGAGGAPAADVSLRKIFVG  181


 Score = 58.2 bits (139),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 29/83 (35%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RK+F+  +  + ++++L + F++YGE+EE  +  DK TGK +G+    +K  DGA 
Sbjct  172  DVSLRKIFVGNVPADMSSERLLAHFASYGEIEEGPLGFDKQTGKFRGFALFVYKTPDGAQ  231

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             +L +  K I+G   V +LA  G
Sbjct  232  ASLVDSIKTIEGHQLVCKLAIEG  254



>ref|XP_002960828.1| hypothetical protein SELMODRAFT_70937, partial [Selaginella moellendorffii]
 gb|EFJ38367.1| hypothetical protein SELMODRAFT_70937, partial [Selaginella moellendorffii]
Length=251

 Score =   148 bits (374),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 84/178 (47%), Positives = 110/178 (62%), Gaps = 10/178 (6%)
 Frame = +2

Query  41   KKRKLE-DNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIA  217
            KKRK E D G  +     P L   D  K+LE   R  +  I+Q + ++HP VL  VR   
Sbjct  1    KKRKAEEDPGGDAGGVEQPDLDSADVLKLLEPLDRGAMHYILQISCLQHPAVLEEVRRYV  60

Query  218  DQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            D+D   RKLF+RGLGW+TT + L+ +FS  GE++EAV+I DKAT KS+G+GF++FKH+DG
Sbjct  61   DRDPAHRKLFVRGLGWDTTAETLKGVFSQSGEVDEAVIIRDKATQKSRGFGFVSFKHMDG  120

Query  398  ALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpV---------DISLRKIYVG  544
            AL ALKEPSK+IDGRMT  Q A+      P    + +           D+S RKIYVG
Sbjct  121  ALRALKEPSKRIDGRMTACQFASTSSSSTPCSSITPSINPPPPRPFIEDVSTRKIYVG  178


 Score = 65.1 bits (157),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D + RK+++  +   T+ DK+ ++FS +GE+ E  +  D++TG SKG+  I ++  +GA
Sbjct  168  EDVSTRKIYVGSVPVGTSADKVLAIFSQFGEIAEGPLGFDRSTGASKGFALIIYRTSEGA  227

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              AL +P K IDG     +LAA G
Sbjct  228  RKALLDPFKTIDGHQVHCKLAAEG  251



>ref|XP_010943535.1| PREDICTED: UBP1-associated protein 2C-like [Elaeis guineensis]
Length=335

 Score =   150 bits (379),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 77/172 (45%), Positives = 111/172 (65%), Gaps = 9/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+  KKRKLE+ G  +  +F PR S    R +L+   +DQL +++     ++P V   ++
Sbjct  1    MEDAKKRKLEETG--NGDAFSPR-SEGQLRNLLDPLRKDQLVDLLVKLGTQYPTVAEEIK  57

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL WETT++ L + FS +GE+EE  VI DKATGKS+GYGFIT++H
Sbjct  58   GVASSDPVHRKLFVRGLAWETTSETLCAAFSMHGEIEEGAVIFDKATGKSRGYGFITYRH  117

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL+EPSK IDGR+ V  LA   +       S++   D++LRKIY+G
Sbjct  118  MESAHKALREPSKMIDGRLAVCNLACESLS------SASVSTDVALRKIYIG  163


 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK++I GL  + +++ L + F  +G++EE  V  DK T KS+G+GF+T+K ++ A 
Sbjct  154  DVALRKIYIGGLSPDISSETLLNFFGRHGDIEEGSVAYDKETNKSRGFGFVTYKTVEAAK  213

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P+  + GR    +LA
Sbjct  214  KAIDDPNMTLGGRNITVKLA  233



>emb|CDM83390.1| unnamed protein product [Triticum aestivum]
Length=440

 Score =   149 bits (376),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 95/178 (53%), Positives = 120/178 (67%), Gaps = 8/178 (4%)
 Frame = +2

Query  35   FMKKRKLEDNGVVSDPSFLPR----LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            F KKRK ++NG V+           L+ +D  ++L+  +RDQL +I   A +     L A
Sbjct  4    FSKKRKPDENGAVAASPAAGAAALGLTRDDVLRLLDPLSRDQLADIAAAAALASGVALDA  63

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            VR+ AD+D   RKLF+RGLGWET +D LR++FS YG+LEEAVVI DK TG+SKGYGF+TF
Sbjct  64   VRAAADRDPALRKLFVRGLGWETNSDSLRAIFSAYGDLEEAVVISDKTTGRSKGYGFVTF  123

Query  383  KHIDGALLALKEPSKQIDGRMTVTQL----AAAGMQggpgggssnnpVDISLRKIYVG  544
            +H D ALLALKEPSK+ID R+TVTQL    AA G  GG  G       D+SLRKI+VG
Sbjct  124  RHADSALLALKEPSKKIDARVTVTQLAAAGAAGGPSGGTTGAGGVPSADVSLRKIFVG  181


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/88 (32%), Positives = 52/88 (59%), Gaps = 0/88 (0%)
 Frame = +2

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +   D + RK+F+  +  +  +++L + F++YGE+EE  +  DK TGK +G+    +K 
Sbjct  167  GVPSADVSLRKIFVGNVPADMPSERLLAHFASYGEIEEGPLGFDKLTGKFRGFALFVYKT  226

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAG  472
             +GA  +L + +K IDG+  + +LA  G
Sbjct  227  PEGAQASLVDSTKVIDGQQLLCKLAIEG  254



>ref|XP_002976199.1| hypothetical protein SELMODRAFT_151090 [Selaginella moellendorffii]
 gb|EFJ23104.1| hypothetical protein SELMODRAFT_151090 [Selaginella moellendorffii]
Length=343

 Score =   147 bits (370),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 79/175 (45%), Positives = 112/175 (64%), Gaps = 13/175 (7%)
 Frame = +2

Query  41   KKRKLEDNGVVSDPSF------LP-RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            KKRK+++   + D         +P RLS +D +++LE  +++QL  ++ +A  ++  V  
Sbjct  8    KKRKIKEESDLHDAPMEGYEAPVPLRLSRDDLKRLLEPLSKEQLVALLTDAGSQYSAVAD  67

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             +R +A +D   RKLF+RGL WETT+  LR  F  +GE+EE  VI+DKATGKS+G+GFIT
Sbjct  68   DIREVASKDPAHRKLFVRGLAWETTSQDLRDAFEQFGEIEEGAVIIDKATGKSRGFGFIT  127

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            FKH+D A  ALKEPSK IDGR+TV  LA+ G  G  G        D + RK+Y+G
Sbjct  128  FKHMDSAQRALKEPSKTIDGRITVCNLASVGTSGSGGTN------DQAQRKLYIG  176


 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G   S    D  QRKL+I GL +ET+ + L ++FS YGE+EE  V  DK T KS+G+ F
Sbjct  157  VGTSGSGGTNDQAQRKLYIGGLSYETSNETLLNIFSKYGEIEEGAVAYDKNTNKSRGFAF  216

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
            +T+K ++ A  A+ +P+K I+GR  + +LAA G +
Sbjct  217  VTYKTVEAARNAIDDPNKTIEGRHVIVKLAAEGQK  251



>ref|XP_009417297.1| PREDICTED: UBP1-associated protein 2C-like [Musa acuminata subsp. 
malaccensis]
Length=335

 Score =   145 bits (366),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 76/172 (44%), Positives = 110/172 (64%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+  KKRKLE+ G  S  +F    S +  R +L+   +DQL +++     ++P V   ++
Sbjct  1    MEDSKKRKLEEEGG-SGGAFAMEFS-KQLRFLLDPLRKDQLVDLLVKLGNQYPSVAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A +D   RKLF+RGL WETT++ L ++FS +GE+EE  VI+DKATGKS+GYGFIT+KH
Sbjct  59   GLASEDPVHRKLFVRGLSWETTSETLCAVFSVHGEIEEGAVIVDKATGKSRGYGFITYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+EPSK IDGR+ V  LA  G+             D++LRKIY+G
Sbjct  119  MESTQKALQEPSKLIDGRLAVCNLACEGLSSTSVTS------DLALRKIYIG  164


 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK++I GL  + +++ L S FS +GE+EE  V  DK T KS+G+GF+TF+ ++ A 
Sbjct  155  DLALRKIYIGGLSPDISSENLLSFFSRHGEIEEGSVAYDKETNKSRGFGFVTFRTVEAAK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P+K + GR    +LA
Sbjct  215  KAIDDPNKTLGGRNITVKLA  234



>ref|XP_004136575.1| PREDICTED: uncharacterized RNA-binding protein C660.15-like [Cucumis 
sativus]
 ref|XP_004161491.1| PREDICTED: uncharacterized RNA-binding protein C660.15-like [Cucumis 
sativus]
 gb|KGN59314.1| hypothetical protein Csa_3G809410 [Cucumis sativus]
Length=335

 Score =   144 bits (363),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 75/172 (44%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKLE+   V +  F    SLE  R +LE   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKLEE--TVGNAEFS---SLEHLRTLLEPLPKPQLVDLLARLGSQYPSIAEEIK  55

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+A  D   RKLF+RGL W TT++ L + FS +GE+EE  VI DKATGKS+GYGFIT+KH
Sbjct  56   SVASADPVNRKLFVRGLAWNTTSETLCAAFSVHGEIEEGAVIYDKATGKSRGYGFITYKH  115

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    ALK PSK I+GRM V  LA  G+ G           D++ RK+Y+G
Sbjct  116  MESTKAALKAPSKIIEGRMAVCNLACEGLSGSSTTP------DLAQRKLYIG  161


 Score = 67.0 bits (162),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  YG++EE  V  DK T +S+G+GF+T+   + A 
Sbjct  152  DLAQRKLYIGGLSPDITSEVLLNFFGRYGDIEEGSVAYDKDTNESRGFGFVTYTTAEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K   GR  + +LA
Sbjct  212  KAIDDPDKTFGGRNIIVKLA  231



>ref|XP_008777247.1| PREDICTED: UBP1-associated protein 2C-like [Phoenix dactylifera]
Length=335

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 77/174 (44%), Positives = 109/174 (63%), Gaps = 13/174 (7%)
 Frame = +2

Query  29   MDFMKKRKLED--NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            M+  KKRKLE+  NG V  P    +L     R +L+   +DQL +++     ++  V   
Sbjct  1    MEEAKKRKLEETGNGDVFSPQSEGQL-----RNLLDPLRKDQLVDLLVKLGTQYSTVAEE  55

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            ++ +A  D   RKLF+RGL WETT++ L + FS +GE+EE  VI DKATGKS+GYGFITF
Sbjct  56   IKGVACSDPVHRKLFVRGLAWETTSETLCAAFSMHGEIEEGAVIFDKATGKSRGYGFITF  115

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +H++ A  AL+EPSK IDGR+ V  LA   +       S++   D++LRKIY+G
Sbjct  116  RHMESAQKALQEPSKMIDGRLAVCNLACESLS------SASVSTDVALRKIYIG  163


 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D   RK++I GL  + +++ L S F  +G++EE  V  DK T KS+G+GF+T+K  + A 
Sbjct  154  DVALRKIYIGGLSPDISSETLLSFFGRHGDIEEGSVAYDKDTNKSRGFGFVTYKTAEAAK  213

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P+K + GR    +LA
Sbjct  214  KAIDDPNKTLGGRNITVKLA  233



>ref|XP_006827046.1| hypothetical protein AMTR_s00010p00228950 [Amborella trichopoda]
 gb|ERM94283.1| hypothetical protein AMTR_s00010p00228950 [Amborella trichopoda]
Length=407

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/138 (51%), Positives = 95/138 (69%), Gaps = 1/138 (1%)
 Frame = +2

Query  134  FTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGE  313
            FT+DQL E+++ A+   P+VL   RS+AD+D + RKLF+ GLGW+TT++ L S FS+YGE
Sbjct  49   FTKDQLVELIKTAISLEPNVLNEARSLADRDPSHRKLFVHGLGWDTTSETLTSTFSSYGE  108

Query  314  LEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgg  493
            +E+  V+ DK+TGKSKGYGFI FKH   A  AL  P K+IDGRMT  Q A++G       
Sbjct  109  IEDCNVVSDKSTGKSKGYGFILFKHRHSAKKALISPQKKIDGRMTACQFASSGPTETLAK  168

Query  494  gssnnpVDISL-RKIYVG  544
             + N   + +L RKIYVG
Sbjct  169  KTQNPTSNENLARKIYVG  186


 Score = 55.5 bits (132),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +2

Query  236  RKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALK  415
            RK+++  +  +   +K+ + FS YGE+EE  +  D+ TGK+KG+    +K  + A  AL 
Sbjct  181  RKIYVGNVLSDIAPEKIHTFFSKYGEIEEGPLGFDRNTGKAKGFALFVYKSSESAKRALA  240

Query  416  EPSKQIDGRMTVTQLA  463
            EP+K  +G     Q A
Sbjct  241  EPNKIFEGHKLYCQRA  256



>ref|XP_010261151.1| PREDICTED: UBP1-associated protein 2A-like [Nelumbo nucifera]
Length=445

 Score =   145 bits (366),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/158 (47%), Positives = 95/158 (60%), Gaps = 13/158 (8%)
 Frame = +2

Query  110  DARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLR  289
            D  K+LE F ++QL ++++ A    P V   +  +AD+D   RKLF+ GLGWETT++KLR
Sbjct  36   DITKVLEPFNKEQLIDLLRWAASNDPKVRDEINRVADRDPVHRKLFVHGLGWETTSEKLR  95

Query  290  SLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAA  469
              FS YGELE+  V++DKATGKSKGYGF+ FKH  GA  ALKEP K+I+ RMT  QLA+ 
Sbjct  96   EFFSQYGELEDCNVVVDKATGKSKGYGFLLFKHRRGATKALKEPQKKIESRMTACQLAST  155

Query  470  G-------------MQggpgggssnnpVDISLRKIYVG  544
            G              Q        +   D   RKIYVG
Sbjct  156  GPVNPSHSNPSTHAQQSQQTHLGYHPSQDTLARKIYVG  193


 Score = 73.2 bits (178),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 49/81 (60%), Gaps = 0/81 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            QDT  RK+++  +  +  +DKL + FS YGE+EE  +  DK TGKSKG+    +K  +GA
Sbjct  183  QDTLARKIYVGNVHSDIPSDKLLAFFSKYGEIEEGPLGFDKQTGKSKGFALFIYKTTEGA  242

Query  401  LLALKEPSKQIDGRMTVTQLA  463
              AL+EP+K  DG     Q A
Sbjct  243  RKALEEPNKSFDGHQLYCQKA  263



>ref|XP_008443071.1| PREDICTED: UBP1-associated protein 2C-like [Cucumis melo]
Length=335

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 75/175 (43%), Positives = 106/175 (61%), Gaps = 17/175 (10%)
 Frame = +2

Query  29   MDFMKKRKLED---NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRKLE+   NG  S        S+E  R +LE   + QL +++     ++P +  
Sbjct  1    MEDLKKRKLEETVGNGEFS--------SVEHLRSLLEPLPKPQLVDLLARLGSQYPSIAE  52

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++S+A  D   RKLF+RGL W TT++ L + FS +GE+EE  VI DKATGKS+GYGFIT
Sbjct  53   EIKSVASADPVNRKLFVRGLAWNTTSETLCAAFSVHGEIEEGAVIYDKATGKSRGYGFIT  112

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KH++    ALK PSK I+GRM V  LA  G+ G           D++ RK+Y+G
Sbjct  113  YKHMESTKAALKAPSKIIEGRMAVCNLACEGLSGSSTTP------DLAQRKLYIG  161


 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 50/80 (63%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  YG++EE  V  DK T +S+G+GF+T+  ++ A 
Sbjct  152  DLAQRKLYIGGLSPDITSEVLLNFFGRYGDIEEGSVAYDKDTNESRGFGFVTYTTVEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K   GR  + +LA
Sbjct  212  KAIDDPDKTFGGRNIIVKLA  231



>ref|XP_010943670.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis]
 ref|XP_010943671.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis]
Length=511

 Score =   144 bits (363),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/119 (55%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE F +DQL EI+++A V+HPDVL  V  IAD D   RK+F+ GLGW+T  + L + 
Sbjct  101  QKLLEPFPKDQLIEILRDAAVKHPDVLEEVHRIADIDPAHRKIFVHGLGWDTKAETLIAA  160

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   ++DKATGKSKGYGFI FKH  GA  ALK+P K+I  RMT  QLA+ G
Sbjct  161  FRQYGEIEDCNAVIDKATGKSKGYGFILFKHRSGAWRALKQPQKKIGNRMTACQLASTG  219


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G E    +L   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  232  TQRKIFVSNVGAELDPQRLLQFFAKFGEIEEGPLGLDKVTGKPKGFCLFVYKTIESAKKA  291

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP K  +G +   Q A
Sbjct  292  LEEPHKNFEGHILHCQKA  309



>ref|XP_009369730.1| PREDICTED: UBP1-associated protein 2A-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009369737.1| PREDICTED: UBP1-associated protein 2A-like isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009369745.1| PREDICTED: UBP1-associated protein 2A-like isoform X1 [Pyrus 
x bretschneideri]
Length=314

 Score =   140 bits (354),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 107/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKLED     D   + R S +  R +LE   + QL +++     ++P +   ++
Sbjct  1    MEDVKKRKLEDASGNDD--DISRNSEDHLRSLLEPLAKPQLVDLLAKLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL W T+++ LR+ FS +GE+EE  VI +KA+GKS+GYGFIT+KH
Sbjct  59   GVASADPVHRKLFVRGLAWNTSSETLRAAFSEHGEIEEGAVIYEKASGKSRGYGFITYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGR+ V  LAA G+        +   +D++ RK+Y+G
Sbjct  119  MESTQCALRAPSKLIDGRLAVCNLAAEGLS------GTPATLDLTQRKLYIG  164


 Score = 69.3 bits (168),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D TQRKL+I GL    T++ L   F  +G++EE  V  DK + +S+G+GF+T++ ++ A 
Sbjct  155  DLTQRKLYIGGLSPNVTSEMLLHFFGRHGDIEEGSVAYDKDSNESRGFGFVTYRTVEAAK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  215  KAIDDPQKTLGGRNIIVKLA  234



>ref|XP_004493569.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A1-like [Cicer 
arietinum]
Length=337

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 72/172 (42%), Positives = 104/172 (60%), Gaps = 11/172 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKLE+ G          +S ED R ++E   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKLEETGNGE------LISKEDIRLLIEPLAKPQLVDLLAKLGSQYPSIAEEIK  54

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W  T++ LR+ F  +GE+EE  VI DK TGKS+GYGFIT+KH
Sbjct  55   SIASADPANRKLFVRGLAWNITSETLRAAFQEHGEIEEGAVIYDKVTGKSRGYGFITYKH  114

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL  PSK I+GR+ V  LA  G+ G           D++LRK+Y+G
Sbjct  115  MESAQNALSAPSKLIEGRLAVCNLACEGLSGTSSSAP-----DLTLRKLYIG  161


 Score = 63.5 bits (153),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S +  D T RKL+I  L  E T++ L S F  +G +EE  V  DK + +S+G+GF+T+K 
Sbjct  147  SSSAPDLTLRKLYIGSLSPEVTSELLLSYFGKHGSIEEGSVAYDKDSNESRGFGFVTYKT  206

Query  389  IDGALLALKEPSKQIDGRMTVTQLA  463
             + A  A+ +P K + GR+   + A
Sbjct  207  AEAAKKAIDDPEKTLGGRLITVKYA  231



>gb|ABR18205.1| unknown [Picea sitchensis]
Length=382

 Score =   142 bits (357),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 67/146 (46%), Positives = 102/146 (70%), Gaps = 8/146 (5%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            EDA  ++E+F++D+L EI++ A+ +H D++  V ++A +D+ +RKLF+RGLGW T  + L
Sbjct  112  EDAETLMETFSKDELAEILKLALKKHGDIVSEVANVASKDSAKRKLFVRGLGWHTKPETL  171

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+FS YGE+E+A +++D+ +GKSKG+GF+TFK   G + ALKEPSK+ID RMTV  L+ 
Sbjct  172  NSVFSAYGEVEKADIVMDRNSGKSKGFGFVTFKSFAGVVAALKEPSKKIDDRMTVCNLST  231

Query  467  AGMQggpgggssnnpVDISLRKIYVG  544
                      S+ +   +  RKIYVG
Sbjct  232  G--------VSAPDSQQVHGRKIYVG  249


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             V +   Q    RK+++ GL  +  + KL  LFS YGE+EE  +  DK TGKSKG+ F  
Sbjct  232  GVSAPDSQQVHGRKIYVGGLPNDVDSAKLVKLFSQYGEIEEGPLGFDKKTGKSKGFAFFI  291

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +K    A  AL EP K  DG     +LA
Sbjct  292  YKSEKSANNALDEPMKTFDGATLTCKLA  319



>gb|KJB34463.1| hypothetical protein B456_006G067200 [Gossypium raimondii]
Length=336

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 106/172 (62%), Gaps = 11/172 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRK+E+ G     S     + E+ R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKMEEMGNNDQLS-----TQEELRSLLDPLAKSQLVDLLSRLGSQYPSIAEEIK  55

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGFIT+KH
Sbjct  56   SIASSDPVHRKLFVRGLAWNTTSETLCAAFRMHGEIEEGAVIYDKATGKSRGYGFITYKH  115

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL+ PSK IDGRM V  LA  G+        ++   D++ RK+Y+G
Sbjct  116  MESAHSALRAPSKLIDGRMAVCNLACEGL------TGASTTPDLAQRKLYIG  161


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  +GE+EE  V  DK T +S+G+GF+T+K  + A 
Sbjct  152  DLAQRKLYIGGLSPDVTSEMLLNYFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTTEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  212  KAIDDPQKILGGRTIIVKLA  231



>ref|XP_007028959.1| RNA-binding family protein isoform 1 [Theobroma cacao]
 gb|EOY09461.1| RNA-binding family protein isoform 1 [Theobroma cacao]
Length=336

 Score =   140 bits (353),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 106/175 (61%), Gaps = 17/175 (10%)
 Frame = +2

Query  29   MDFMKKRKLE---DNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ MKKRK+E   +NG +S        + E+ R +L+   + QL +++     ++P +  
Sbjct  1    MEDMKKRKMEEMGNNGELS--------TQEELRSLLDPLAKSQLVDLLSRLGSQYPSIAE  52

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++SIA  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DK +GKS+GYGFIT
Sbjct  53   EIKSIASSDPVHRKLFVRGLAWNTTSETLCAAFQMHGEIEEGAVIYDKTSGKSRGYGFIT  112

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KH++ A  AL+ PSK IDGRM V  LA  G+ G           D++ RK+Y+G
Sbjct  113  YKHMESAQSALRAPSKLIDGRMAVCNLACEGLSGASTTP------DLAQRKLYIG  161


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  152  DLAQRKLYIGGLSPDVTSEILLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  212  KAIDDPQKILGGRTIIVKLA  231



>gb|EYU35971.1| hypothetical protein MIMGU_mgv1a004343mg [Erythranthe guttata]
 gb|EYU35972.1| hypothetical protein MIMGU_mgv1a004343mg [Erythranthe guttata]
Length=532

 Score =   142 bits (359),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/118 (54%), Positives = 87/118 (74%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F++DQL  I++ A+ +HPD+   V  +AD D + RK+F+ GLGWE +TD + S+F
Sbjct  153  KLLEPFSKDQLTLIIKEALAKHPDIAENVHKLADADPSHRKIFVHGLGWEASTDTITSVF  212

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+  V+ DK +GKSKGYGFI FKH  GA  ALK+P K I+GRMT +QLA+AG
Sbjct  213  GKYGEIEDCKVVKDKISGKSKGYGFILFKHRVGARRALKQPQKLIEGRMTSSQLASAG  270


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +  E    KL   F+ +GE+EE  + LDK TGK +G+    +K    A 
Sbjct  293  EYTQRKIYVSNVSAELDPKKLMEFFAKFGEIEEGPLGLDKQTGKPRGFCLFVYKSAKSAS  352

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G+M   Q A  G
Sbjct  353  KALEEPHKNFEGQMLHCQKAVDG  375



>ref|XP_007028960.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY09462.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=358

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 11/172 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ MKKRK+E+ G   + S     + E+ R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDMKKRKMEEMGNNGELS-----TQEELRSLLDPLAKSQLVDLLSRLGSQYPSIAEEIK  55

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DK +GKS+GYGFIT+KH
Sbjct  56   SIASSDPVHRKLFVRGLAWNTTSETLCAAFQMHGEIEEGAVIYDKTSGKSRGYGFITYKH  115

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL+ PSK IDGRM V  LA  G+ G           D++ RK+Y+G
Sbjct  116  MESAQSALRAPSKLIDGRMAVCNLACEGLSGASTTP------DLAQRKLYIG  161


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 29/68 (43%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  152  DLAQRKLYIGGLSPDVTSEILLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAK  211

Query  404  LALKEPSK  427
             A+ +P K
Sbjct  212  KAIDDPQK  219



>ref|XP_011078840.1| PREDICTED: UBP1-associated protein 2C-like isoform X1 [Sesamum 
indicum]
Length=336

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 72/179 (40%), Positives = 109/179 (61%), Gaps = 16/179 (9%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRL-------SLEDARKILESFTRDQLFEIVQNAVVRHP  187
            M+ +KKRKLE+   V +   LP L       ++E+ R +L+  ++ QL +++  A  ++P
Sbjct  1    MEDLKKRKLEE---VGNGQLLPNLNESEASSTVEELRGLLDPLSKPQLVDLLARAGSQYP  57

Query  188  DVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGY  367
             +   ++S+A  D   RKLF+RGL W T+++ L + F  +GE+EE  VI DKATGKS+GY
Sbjct  58   SIAEEIKSVASADPALRKLFVRGLAWNTSSETLCAAFQEHGEIEEGAVIYDKATGKSRGY  117

Query  368  GFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            GF+T+K ++ A  ALK PSK IDGRM V  LA+ G+             D + RK+Y+G
Sbjct  118  GFVTYKDMESAQRALKAPSKMIDGRMAVCNLASEGLSSTSVTP------DQAQRKLYIG  170


 Score = 77.4 bits (189),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  ET ++ L S FS +GE+EE  V  DK T KS+G+GF+T++ ++ A 
Sbjct  161  DQAQRKLYIGGLSPETNSEMLLSFFSRHGEIEEGSVAYDKETNKSRGFGFVTYRTVEAAK  220

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR    +LA
Sbjct  221  KAIDDPQKMLGGRNITVKLA  240



>ref|XP_004304376.1| PREDICTED: UBP1-associated protein 2C-like [Fragaria vesca subsp. 
vesca]
Length=309

 Score =   139 bits (349),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/172 (41%), Positives = 105/172 (61%), Gaps = 12/172 (7%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKL++N  +S        S +D R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDIKKRKLDNNERISP------HSEQDLRALLDPLAKSQLVDLLAKLGSQYPSIAEEIK  54

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             IA  D   RKLF+RGL W T++D L + FS YGE+EE  VI DKA+GKS+GYGFIT+K+
Sbjct  55   GIATADPVHRKLFVRGLAWNTSSDTLCAAFSEYGEIEEGAVIYDKASGKSRGYGFITYKY  114

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGRM V  LA  G+ G           D++ RK+Y+G
Sbjct  115  MESTHRALRAPSKLIDGRMAVCNLACDGLTGSSSTQ------DLTQRKLYIG  160


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 53/89 (60%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   S + QD TQRKL+I GL    T++ L      +G++EE  V   K T +S+G+GF+
Sbjct  142  GLTGSSSTQDLTQRKLYIGGLSPNVTSEMLLHFLGRHGDIEEGSVAYGKDTNESRGFGFV  201

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            TFK ++ A  A+ +P K + GR  + +LA
Sbjct  202  TFKTVEAARKAIDDPQKILGGRNVIVKLA  230



>gb|ABK24360.1| unknown [Picea sitchensis]
Length=365

 Score =   139 bits (351),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 73/170 (43%), Positives = 103/170 (61%), Gaps = 15/170 (9%)
 Frame = +2

Query  41   KKRKL--EDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSI  214
            KKRKL  E NG         +LS +    +LE  +++QL  ++ +A   +P +   ++ +
Sbjct  8    KKRKLDEEANGAAL------QLSKDHLHSLLEPLSKEQLISLLVDAGSSYPAIAEEIKDV  61

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A +D   RKLF+RGL WET++  L   F  YGE+EE  VI+DKA+GKS+G+GF+TFKH+D
Sbjct  62   ASKDPAHRKLFVRGLAWETSSQTLCDAFEQYGEIEEGAVIMDKASGKSRGFGFVTFKHMD  121

Query  395  GALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
             A  ALKEPSK IDGR+TV+ LA A               D + RK+Y+G
Sbjct  122  SAQKALKEPSKTIDGRITVSNLAVA-------STGPGQSADQAQRKLYIG  164


 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/85 (52%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL ++T  DKL  +FS YGE+EE  V  DK T KS+G+ F+TFK ++   
Sbjct  155  DQAQRKLYIGGLSYDTANDKLLEVFSKYGEIEEGSVAYDKNTNKSRGFAFVTFKTVEATK  214

Query  404  LALKEPSKQIDGRMTVTQLAAAGMQ  478
             ALKEP+K IDGR    +LAA G +
Sbjct  215  RALKEPNKTIDGRTVTVKLAADGQK  239



>ref|XP_008365599.1| PREDICTED: UBP1-associated protein 2C-like isoform X1 [Malus 
domestica]
 ref|XP_008365600.1| PREDICTED: UBP1-associated protein 2C-like isoform X1 [Malus 
domestica]
Length=313

 Score =   138 bits (348),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 106/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKLED     D   +   S +  R +LE   + QL +++     ++P +   ++
Sbjct  1    MEDVKKRKLEDASGNDD--DISTNSEDHLRSLLEPLAKSQLVDLLAKLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL W T+++ LR+ FS +GE+EE  VI +KA+GKS+GYGFIT+KH
Sbjct  59   GVASADPVHRKLFVRGLAWNTSSETLRAAFSEHGEIEEGAVIYEKASGKSRGYGFITYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGR+ V  LAA G+        +   +D++ RK+Y+G
Sbjct  119  MESTQCALRAPSKLIDGRLAVCNLAAEGLS------GTPATLDLTQRKLYIG  164


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D TQRKL+I GL    T++ L   F  +G++EE  V  DK T +S+G+GF+T++ ++ A 
Sbjct  155  DLTQRKLYIGGLSPNVTSEMLLHFFGRHGDIEEGSVAYDKDTNESRGFGFVTYRAVEAAK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  215  KAIDDPQKTLGGRNIIVKLA  234



>gb|EYU46155.1| hypothetical protein MIMGU_mgv1a006683mg [Erythranthe guttata]
 gb|EYU46156.1| hypothetical protein MIMGU_mgv1a006683mg [Erythranthe guttata]
Length=435

 Score =   140 bits (354),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/147 (46%), Positives = 95/147 (65%), Gaps = 5/147 (3%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE F++DQL  +++ AV +HPDV+ +V  +AD D    K+F+ GLGWE   + + S+
Sbjct  81   EKLLEPFSKDQLTLLIKEAVAKHPDVVESVHKLADSDPAHCKIFVHGLGWEANAETITSV  140

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG-  472
            F+ YGE+E+  V+ DK +GKSKGYGFI FKH  GA  ALK+P K I+GRM   QLA+AG 
Sbjct  141  FAKYGEIEDCKVVRDKNSGKSKGYGFILFKHRHGARRALKQPQKLIEGRMASCQLASAGP  200

Query  473  ----MQggpgggssnnpVDISLRKIYV  541
                 Q      S+ +  + + RKIYV
Sbjct  201  VQSPAQATVATVSTPHTSEYTQRKIYV  227


 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%), Gaps = 6/103 (6%)
 Frame = +2

Query  95   RLSLEDARKILESFTRDQLFEIVQNAVVRHPD--VLGAVRSIADQDTTQRKLFIRGLGWE  268
            R +L+  +K++E   R    ++     V+ P    +  V +    + TQRK+++  +  +
Sbjct  176  RRALKQPQKLIEG--RMASCQLASAGPVQSPAQATVATVSTPHTSEYTQRKIYVSNVSAD  233

Query  269  TTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
                KL   FS +GE+EE  + LDK TGK +  GF  FK +DG
Sbjct  234  IDPKKLWEFFSKFGEIEEGPLGLDKQTGKPR--GFCLFKAVDG  274



>ref|XP_008804059.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
 ref|XP_008804060.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
 ref|XP_008804061.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
Length=518

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/119 (54%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE F +DQ+ EI+++A ++HPDVL  V  IAD D   RK+F+ GLGW+T  + L + 
Sbjct  111  QKLLEPFPKDQIIEILRDAAMKHPDVLEEVHRIADIDPAHRKIFVHGLGWDTKAETLIAA  170

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   ++DKATGKSKGYGFI FKH  GA  ALK+P K+I  RMT  QLA+ G
Sbjct  171  FRQYGEIEDCNAVIDKATGKSKGYGFILFKHRSGAWRALKQPQKKIGNRMTACQLASTG  229


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G +    KL   FS +GE+EE  + LDK TG+ KG+    ++ ++ A 
Sbjct  240  EYTQRKIFVSNVGADLDPHKLLQFFSKFGEIEEGPLGLDKVTGRPKGFCLFVYRTVESAR  299

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  300  KALEEPHKNFEGHILHCQKAIDG  322



>ref|XP_010943275.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis]
Length=514

 Score =   141 bits (355),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/119 (55%), Positives = 84/119 (71%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE F +DQL EI+++A V+HPDVL  V  IAD D   RK+F+ GLGW+T  + L + 
Sbjct  104  QKLLEPFPKDQLVEILRDAAVKHPDVLEEVHRIADVDPAHRKIFVHGLGWDTNAETLVAA  163

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DKATGKSKGYGFI FKH  GA  ALK+P K+I  R+T  QLA+ G
Sbjct  164  FRRYGEIEDCNAVTDKATGKSKGYGFILFKHRSGARRALKQPQKKIGNRITACQLASTG  222


 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL   FS +GE+EE  + LDK TGK KG+    +K ++ A 
Sbjct  233  EYTQRKIFVSNVGAELDPQKLLQFFSKFGEVEEGPLGLDKVTGKPKGFCLFVYKTVESAK  292

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  293  KALEEPHKNFEGHILHCQKA  312



>gb|KDP24609.1| hypothetical protein JCGZ_25525 [Jatropha curcas]
Length=336

 Score =   138 bits (348),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 70/172 (41%), Positives = 104/172 (60%), Gaps = 10/172 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ MKKRK+E++    + S     + E  R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDMKKRKMEESSNGGEIS----TTQEHLRSLLDPLNKSQLVDLLSRLGTQYPSIAEEIK  56

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGFIT+KH
Sbjct  57   SLASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFITYKH  116

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGRM V  LA  G+ G           D++ RK+Y+G
Sbjct  117  MESTQNALRAPSKLIDGRMAVCNLACEGLSGVSTTP------DLAQRKLYIG  162


 Score = 70.9 bits (172),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I  L  E T++ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  153  DLAQRKLYIGSLSPEITSELLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVEAAK  212

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  V +LA
Sbjct  213  KAIDDPQKTLGGRTIVVKLA  232



>ref|XP_010673248.1| PREDICTED: UBP1-associated protein 2A-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010673249.1| PREDICTED: UBP1-associated protein 2A-like [Beta vulgaris subsp. 
vulgaris]
Length=504

 Score =   140 bits (354),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 89/143 (62%), Gaps = 2/143 (1%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE FT+DQL  I++ A   HPDV   VR +AD+DT  RK+F+ GLGW+TT D LRS F
Sbjct  131  KLLEPFTKDQLMMILREAAESHPDVASRVRKVADEDTVHRKIFVHGLGWDTTADTLRSAF  190

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG--  472
              +GE+E+   + DK +GKSKGYGFI FK   GA  AL+ P K+I GRMT  QLAA G  
Sbjct  191  CQFGEIEDCKAVSDKISGKSKGYGFILFKRRSGAKKALEIPQKRIGGRMTACQLAAVGPV  250

Query  473  MQggpgggssnnpVDISLRKIYV  541
                          + + RKIYV
Sbjct  251  PTSSTMVQPQQPMSEYTQRKIYV  273


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 28/80 (35%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +  +    KL + F+ +GE+EE  + LDK TGK KG+    ++ ++ A 
Sbjct  265  EYTQRKIYVSNVSADIDPHKLTAYFAKFGEIEEGPLGLDKQTGKPKGFCLFVYRSVESAK  324

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  325  KALEEPHKHYEGHVLHCQKA  344



>emb|CBI30033.3| unnamed protein product [Vitis vinifera]
Length=342

 Score =   138 bits (348),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 71/174 (41%), Positives = 106/174 (61%), Gaps = 15/174 (9%)
 Frame = +2

Query  29   MDFMKKRKLED--NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            M+ +KKRKLE+  NG +S        S E+ + +L+  ++ QL +++     ++P +   
Sbjct  1    MEDLKKRKLEEASNGQISS-------SPEELKLLLDPLSKSQLVDLLSKLGSQYPSIAEE  53

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI+DK TGKS+GYGFIT+
Sbjct  54   IKSVASADPVHRKLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFITY  113

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH++    AL+ PSK IDGRM V  LA  G+ G           D + RK+Y+G
Sbjct  114  KHMESTQSALQAPSKLIDGRMAVCNLACEGLSGASTTP------DQAQRKLYIG  161


 Score = 72.8 bits (177),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L S F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  152  DQAQRKLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  212  KAIDDPQKFLGGRSIIVKLA  231



>ref|XP_002278602.1| PREDICTED: UBP1-associated protein 2C-like isoform X1 [Vitis 
vinifera]
Length=355

 Score =   138 bits (348),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 15/176 (9%)
 Frame = +2

Query  23   SAMDFMKKRKLED--NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            + M+ +KKRKLE+  NG +S        S E+ + +L+  ++ QL +++     ++P + 
Sbjct  12   TTMEDLKKRKLEEASNGQISS-------SPEELKLLLDPLSKSQLVDLLSKLGSQYPSIA  64

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
              ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI+DK TGKS+GYGFI
Sbjct  65   EEIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFI  124

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            T+KH++    AL+ PSK IDGRM V  LA  G+ G           D + RK+Y+G
Sbjct  125  TYKHMESTQSALQAPSKLIDGRMAVCNLACEGLSGASTTP------DQAQRKLYIG  174


 Score = 72.8 bits (177),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L S F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  165  DQAQRKLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAK  224

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  225  KAIDDPQKFLGGRSIIVKLA  244



>ref|NP_001241058.1| uncharacterized protein LOC100776344 [Glycine max]
 gb|ACU17785.1| unknown [Glycine max]
 gb|KHN07417.1| Heterogeneous nuclear ribonucleoprotein A3 [Glycine soja]
Length=340

 Score =   138 bits (347),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 103/172 (60%), Gaps = 9/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+  KKRKLE +    D  F    S E+ R ++E   + QL +++     ++P +   ++
Sbjct  1    MEDFKKRKLELDEAGGDGDFS---SKEELRFLIEPLAKPQLVDLLAKLGSQYPSIAEEIK  57

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W TT++ LR+ F  +GE+EE  VI DK TGKS+GYGFITFK+
Sbjct  58   SIASADPAHRKLFVRGLAWNTTSETLRAAFQEHGEIEEGAVIYDKVTGKSRGYGFITFKN  117

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGR+ V  LA   + G           D+SLRK+Y+G
Sbjct  118  MESTQQALRAPSKLIDGRLAVCNLACESLSGTSSAP------DLSLRKLYIG  163


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RKL+I  L  E T++ L + F+ +GE+EE  V  D+ T +S+G+GF+T+K  + A 
Sbjct  154  DLSLRKLYIGSLSPEVTSEILLNYFARHGEIEEGSVAYDRDTNESRGFGFVTYKTAEAAK  213

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +  K + GR  V + A
Sbjct  214  KAIDDLEKTLGGRNIVVKYA  233



>ref|XP_010102557.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXB93643.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=335

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/175 (41%), Positives = 104/175 (59%), Gaps = 17/175 (10%)
 Frame = +2

Query  29   MDFMKKRKLED---NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ MKKRKLE+   NG  S        S E  R +L+   + QL +++     ++P +  
Sbjct  1    MEDMKKRKLEETEGNGETS--------SEEHLRSLLDPLAKPQLVDLLAELGSQYPSIAD  52

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++S+A  D   RKLF+RGL W TT++ L   F  +GE+EE  VI DKAT +S+GYGFIT
Sbjct  53   KIKSVASADPVHRKLFVRGLAWNTTSETLCDAFKAHGEIEEGAVIYDKATFRSRGYGFIT  112

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KHI+   +AL+ PSK IDGRM V  LA+ G+        ++   D+  RK+Y+G
Sbjct  113  YKHIESTQMALRAPSKLIDGRMAVCNLASEGL------TGTSTTPDLPQRKLYIG  161


 Score = 71.2 bits (173),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  E T++ L + F  +G++EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  152  DLPQRKLYIGGLSREVTSEMLLNFFGRHGKIEEGSVAYDKDTNESRGFGFVTYKTVEAAK  211

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K   GR  + +LA
Sbjct  212  KAIDDPQKSFAGRTVIVKLA  231



>ref|XP_003554202.1| PREDICTED: DAZ-associated protein 1 [Glycine max]
 gb|KHN26378.1| Heterogeneous nuclear ribonucleoprotein A3 [Glycine soja]
Length=336

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/176 (41%), Positives = 105/176 (60%), Gaps = 18/176 (10%)
 Frame = +2

Query  29   MDFMKKRKLE----DNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            M+ +KKRKLE     NG ++        S E+ R ++E   + QL +++     ++P + 
Sbjct  1    MEGLKKRKLELDEAGNGELA--------SKEELRFLIEPLAKPQLVDLLAKLGSQYPSIA  52

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
              ++SIA  D   RKLF+RGL W TT++ LR+ F  +GE+EE  VI DK TGKS+GYGFI
Sbjct  53   EEIKSIASADPAHRKLFVRGLAWNTTSETLRAAFQEHGEIEEGAVIFDKVTGKSRGYGFI  112

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            TFK+++    AL+ PSK IDGR+ V  LA   + G           D+SLRK+Y+G
Sbjct  113  TFKNMESTQQALRAPSKLIDGRLAVCNLACESLSGTSSAP------DLSLRKLYIG  162


 Score = 59.7 bits (143),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RKL+I  L  E T++ L + F+ +GE+EE  V  D+ T +S+G+GF+T+K  + A 
Sbjct  153  DLSLRKLYIGSLSPEVTSEILLNYFARHGEIEEGSVAYDRDTNESRGFGFVTYKTAEAAK  212

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +  K + GR  V + A
Sbjct  213  KAIDDVEKMLGGRNIVVKYA  232



>ref|XP_010067463.1| PREDICTED: UBP1-associated protein 2C-like [Eucalyptus grandis]
 gb|KCW65606.1| hypothetical protein EUGRSUZ_G02996 [Eucalyptus grandis]
Length=339

 Score =   137 bits (346),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 73/175 (42%), Positives = 106/175 (61%), Gaps = 16/175 (9%)
 Frame = +2

Query  29   MDFMKKRKLED---NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRKL++   NG  SD       S E+ R +LE   +  L E++     ++P +  
Sbjct  1    MEDLKKRKLDETAGNGGSSD-------SEENLRSLLEPLAKPHLVELLAKLGSQYPSIAE  53

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++SIA  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DK TGKS+GYGFIT
Sbjct  54   EIKSIASADPVHRKLFVRGLAWNTTSETLCAAFQGHGEIEEGAVIYDKNTGKSRGYGFIT  113

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +K+I+   +AL+ PSK IDGRM V  LA  G+        S+   D++ RK+++G
Sbjct  114  YKNIESTQIALRAPSKMIDGRMAVCNLACDGL------TGSSGTPDLARRKLFIG  162


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/89 (38%), Positives = 51/89 (57%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   S    D  +RKLFI GL  + +++ L S F  YG++EE  V  DK T +S+G+GF+
Sbjct  144  GLTGSSGTPDLARRKLFIGGLSPDVSSEMLLSFFGRYGDIEEGSVAYDKDTTESRGFGFV  203

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            T+K  + A  A+ +P K + GR    + A
Sbjct  204  TYKASEAAKKAIDDPQKLLGGRSITVKYA  232



>ref|XP_010653903.1| PREDICTED: UBP1-associated protein 2A-like isoform X2 [Vitis 
vinifera]
Length=265

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 107/176 (61%), Gaps = 15/176 (9%)
 Frame = +2

Query  23   SAMDFMKKRKLED--NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            + M+ +KKRKLE+  NG +S        S E+ + +L+  ++ QL +++     ++P + 
Sbjct  12   TTMEDLKKRKLEEASNGQISS-------SPEELKLLLDPLSKSQLVDLLSKLGSQYPSIA  64

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
              ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI+DK TGKS+GYGFI
Sbjct  65   EEIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRLHGEIEEGAVIVDKTTGKSRGYGFI  124

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            T+KH++    AL+ PSK IDGRM V  LA  G+ G           D + RK+Y+G
Sbjct  125  TYKHMESTQSALQAPSKLIDGRMAVCNLACEGLSGASTTP------DQAQRKLYIG  174


 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/68 (44%), Positives = 45/68 (66%), Gaps = 0/68 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L S F  +GE+EE  V  DK T +S+G+GF+T+K ++ A 
Sbjct  165  DQAQRKLYIGGLAPDVTSEVLLSFFGRHGEIEEGSVAYDKETNESRGFGFVTYKTVEAAK  224

Query  404  LALKEPSK  427
             A+ +P K
Sbjct  225  KAIDDPQK  232



>gb|ABK21372.1| unknown [Picea sitchensis]
Length=265

 Score =   135 bits (340),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 98/140 (70%), Gaps = 8/140 (6%)
 Frame = +2

Query  125  LESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFST  304
            +E+F++D+L EI++ A+ +H D++  V ++A +D+ +RKLF+RGLGW T  + L S+FS 
Sbjct  1    METFSKDELAEILKLALKKHGDIVSEVANVASKDSAKRKLFVRGLGWHTKPETLNSVFSA  60

Query  305  YGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQgg  484
            YGE+E+A +++D+ +GKSKG+GF+TFK   G + ALKEPSK+ID RMTV  L+       
Sbjct  61   YGEVEKADIVMDRNSGKSKGFGFVTFKSFAGVVAALKEPSKKIDDRMTVCNLSTG-----  115

Query  485  pgggssnnpVDISLRKIYVG  544
                S+ +   +  RKIYVG
Sbjct  116  ---VSAPDSQQVHGRKIYVG  132


 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 47/88 (53%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             V +   Q    RK+++ GL  +  + KL  LFS YGE+EE  +  DK TGKSKG+ F  
Sbjct  115  GVSAPDSQQVHGRKIYVGGLPNDVDSAKLVKLFSQYGEIEEGPLGFDKKTGKSKGFAFFI  174

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +K    A  AL EP K  DG     +LA
Sbjct  175  YKSEKSANNALDEPMKTFDGATLTCKLA  202



>ref|XP_001763161.1| predicted protein [Physcomitrella patens]
 gb|EDQ72038.1| predicted protein, partial [Physcomitrella patens]
Length=210

 Score =   134 bits (336),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 73/150 (49%), Positives = 97/150 (65%), Gaps = 6/150 (4%)
 Frame = +2

Query  95   RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETT  274
            +L+ ++ + +LE   +DQL  ++  A    P V   +R IA +D   RKLF+RGL WET+
Sbjct  6    QLTRDELKSLLEPLNKDQLIALLIEAGSLFPAVADDIRDIASKDPVHRKLFVRGLAWETS  65

Query  275  TDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVT  454
            +  LR  F  YGE+EEA VI DK TGKS+G+GFITFKH+D A  ALKEPSK IDGR+TV 
Sbjct  66   SMALREAFEQYGEVEEACVITDKGTGKSRGFGFITFKHMDSAHRALKEPSKNIDGRITVC  125

Query  455  QLAAAGMQggpgggssnnpVDISLRKIYVG  544
             LA+AG        S  +  D + RK+Y+G
Sbjct  126  NLASAGST------SGTSSTDQAQRKLYIG  149


 Score = 79.3 bits (194),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 35/71 (49%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL ++TT+D L ++FS YGE+EE  +  DK T KS+G+ F+TFK I+GA 
Sbjct  140  DQAQRKLYIGGLSYDTTSDTLLNIFSQYGEIEEGAIAYDKNTNKSRGFAFVTFKSIEGAK  199

Query  404  LALKEPSKQID  436
             A+++ +K I+
Sbjct  200  RAIEDSNKSIE  210



>ref|XP_006836153.1| hypothetical protein AMTR_s00101p00033020 [Amborella trichopoda]
 gb|ERM99006.1| hypothetical protein AMTR_s00101p00033020 [Amborella trichopoda]
Length=481

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/145 (46%), Positives = 92/145 (63%), Gaps = 5/145 (3%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   ++LE F++DQL E+++ A ++H DV  ++  +AD D   RK+F+ GLGW+TT + L
Sbjct  71   ESLTRLLEPFSKDQLIELLRQAALQHSDVFDSINKVADVDPAHRKIFVHGLGWDTTAEIL  130

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S F  YGE+E+   + DK +GKSKGYGFI FKH  GA  ALK+P K+I  RMT  QLA+
Sbjct  131  ISTFKKYGEIEDCNAVADKHSGKSKGYGFILFKHRSGARKALKQPQKRIGNRMTACQLAS  190

Query  467  AGMQggpgggssnnpVDISLRKIYV  541
            AG              + ++RKIYV
Sbjct  191  AG-----PVPQQPPVSEYTMRKIYV  210


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +  +    +L + FS YGE+EE  + LDK TGK +G+    +K ++ A 
Sbjct  202  EYTMRKIYVSNVSSDIDPQRLYTFFSKYGEIEEGPLGLDKQTGKPRGFSLFVYKSLESAR  261

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL++P K  +G +   Q A  G
Sbjct  262  KALEDPHKNFEGHILHCQKAIDG  284



>gb|KHG11284.1| Heterogeneous nuclear ribonucleoprotein D-like protein [Gossypium 
arboreum]
Length=338

 Score =   137 bits (344),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/172 (40%), Positives = 106/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRK+E+   + +   L   + E+ R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKMEEMEEMGNNDQL--STQEELRSLLDPLAKSQLVDLLSRLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGF+T+KH
Sbjct  59   SIASSDPVHRKLFVRGLAWNTTSETLCAAFRMHGEIEEGAVIYDKATGKSRGYGFVTYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL  PSK IDGRM V  LA  G+        ++   D++ RK+Y+G
Sbjct  119  MESAHSALGAPSKLIDGRMAVCNLACEGL------TGASTTPDLAQRKLYIG  164


 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 52/80 (65%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  + T++ L + F  +GE+EE  V  DK T +S+G+GF+T+K I+ A 
Sbjct  155  DLAQRKLYIGGLSPDVTSEMLLNYFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTIEAAK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  215  KAIDDPQKILGGRTIIVKLA  234



>gb|AGT16098.1| RNA binding protein [Saccharum hybrid cultivar R570]
Length=467

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A V H DVL A+R +AD D  QRK+F+ GLGW+ TTD L   
Sbjct  98   QALLDSFPKDQLVELLRDAAVAHGDVLSAIRHVADADPAQRKIFVHGLGWDATTDTLSEA  157

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  158  FGPYGEIEDLRVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  216


 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 45/125 (36%), Positives = 62/125 (50%), Gaps = 9/125 (7%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEI------VQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWE  268
            E  +KI    T  QL  +      V N+ V  P  L   +     + TQRK+F+  +G +
Sbjct  198  EPQKKIGNRSTACQLASVGPVPGGVANSAVPAPAQL---QLPPVSEYTQRKIFVSNVGAD  254

Query  269  TTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMT  448
                KL   F+ YGE+EE  + LDK TGK KG+    +K I+ A  AL+EP K  DG + 
Sbjct  255  IDPQKLFQFFARYGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKALEEPHKHFDGVVL  314

Query  449  VTQLA  463
              Q A
Sbjct  315  HCQKA  319



>ref|XP_006362738.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A2 homolog 
1-like isoform X1 [Solanum tuberosum]
 ref|XP_006362739.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A2 homolog 
1-like isoform X2 [Solanum tuberosum]
 ref|XP_006362740.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A2 homolog 
1-like isoform X3 [Solanum tuberosum]
Length=490

 Score =   138 bits (348),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE FT+DQL  +++ A+ ++PD    ++ +AD+D   RK+F+ GLGW+TT + L S+F+
Sbjct  121  LLEPFTKDQLTALIKEALAKYPDFKENIQKLADKDPAHRKIFVHGLGWDTTAETLTSVFA  180

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            TYGE+E+   + DK +GKSKGYGFI FKH  GA  ALKEP K+I  RMT  QLA+AG
Sbjct  181  TYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGARKALKEPQKKIGTRMTSCQLASAG  237


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   FS +GE+EE  + LDK +GK KG+    +K ++GA 
Sbjct  253  EYTQRKIFVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTVEGAR  312

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  313  KALEEPHKTFEGHTLHCQKAIDG  335



>ref|XP_011080479.1| PREDICTED: UBP1-associated protein 2A-like [Sesamum indicum]
 ref|XP_011080482.1| PREDICTED: UBP1-associated protein 2A-like [Sesamum indicum]
Length=515

 Score =   138 bits (347),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = +2

Query  134  FTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGE  313
            F++DQL  +++ AV++HPD+L  V  +AD D    K+F+ GLGWE   D + S+F  YGE
Sbjct  137  FSKDQLTLLIKEAVLKHPDILENVHKLADADPAHCKIFVHGLGWEANADTITSVFGKYGE  196

Query  314  LEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG-----MQ  478
            +E+  V+ DK +GKSKGYGFI FKH DGA  ALK+P K I+GRMT  QLA+AG       
Sbjct  197  IEDCKVVRDKNSGKSKGYGFILFKHRDGARRALKQPQKMIEGRMTSCQLASAGPVQTPAP  256

Query  479  ggpgggssnnpVDISLRKIYV  541
                  S+    + + RKIYV
Sbjct  257  AAVATVSAPPVSEYTQRKIYV  277


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 41/126 (33%), Positives = 65/126 (52%), Gaps = 6/126 (5%)
 Frame = +2

Query  95   RLSLEDARKILES-FTRDQLFEI--VQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGW  265
            R +L+  +K++E   T  QL     VQ      P  +  V +    + TQRK+++  +  
Sbjct  226  RRALKQPQKMIEGRMTSCQLASAGPVQTPA---PAAVATVSAPPVSEYTQRKIYVSNVSA  282

Query  266  ETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRM  445
            E    KL   FS +GE+EE  + LDK TGK +G+    +K ++ A  AL+EP K  +G++
Sbjct  283  ELDPKKLLEFFSKFGEIEEGPLGLDKQTGKPRGFCLFVYKSLESAKKALEEPHKNFEGQI  342

Query  446  TVTQLA  463
               Q A
Sbjct  343  LHCQKA  348



>ref|NP_001274776.1| heterogeneous nuclear ribonucleoprotein A2 homolog 1-like [Solanum 
tuberosum]
 gb|ABB86250.1| RNA-binding protein AKIP1-like [Solanum tuberosum]
Length=498

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 85/117 (73%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE FT+DQL  +++ A+ ++PD    ++ +AD+D   RK+F+ GLGW+TT + L S+F+
Sbjct  121  LLEPFTKDQLTALIKEALAKYPDFKENIQKLADKDPAHRKIFVHGLGWDTTAETLTSVFA  180

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            TYGE+E+   + DK +GKSKGYGFI FKH  GA  ALKEP K+I  RMT  QLA+AG
Sbjct  181  TYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGARKALKEPQKKIGTRMTSCQLASAG  237


 Score = 63.2 bits (152),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   FS +GE+EE  + LDK +GK KG+    +K ++GA 
Sbjct  253  EYTQRKIFVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTVEGAR  312

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  313  KALEEPHKTFEGHTLHCQKAIDG  335



>ref|XP_009404688.1| PREDICTED: UBP1-associated protein 2B-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009404689.1| PREDICTED: UBP1-associated protein 2B-like [Musa acuminata subsp. 
malaccensis]
Length=494

 Score =   137 bits (346),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 61/115 (53%), Positives = 81/115 (70%), Gaps = 0/115 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE F RD L E++++A VRHPDVL  +  IAD D   RK+F+ GLGW+T  + L + 
Sbjct  94   QKLLEPFPRDHLVELLRDAAVRHPDVLAEIHRIADLDPAHRKIFVHGLGWDTNAETLTAA  153

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQL  460
            F  YGE+E+   ++DKATGKSKGYGFI FKH  GA  AL++P K+I  R+T  QL
Sbjct  154  FRQYGEIEDCNAVMDKATGKSKGYGFILFKHRAGARRALEQPQKKIGNRVTACQL  208


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G E    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  225  TQRKIFVSNVGAEIDPQKLLQFFAKFGEIEEGPLGLDKLTGKPKGFALFVYKTIESAKKA  284

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP K  DG +   Q A
Sbjct  285  LEEPHKNFDGHILHCQKA  302



>ref|XP_007162310.1| hypothetical protein PHAVU_001G141300g [Phaseolus vulgaris]
 gb|ESW34304.1| hypothetical protein PHAVU_001G141300g [Phaseolus vulgaris]
Length=333

 Score =   135 bits (341),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 73/172 (42%), Positives = 105/172 (61%), Gaps = 12/172 (7%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRKL++ G   +  F    S E+ R ++E   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKLDEAG---NGDFT---SKEELRFLIEPLAKPQLVDLLAKLGSQYPSIAEEIK  54

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            SIA  D   RKLF+RGL W TT++ LR+ F  +GE+EE  VI DK TGKS+GYGFITFK+
Sbjct  55   SIASADPAHRKLFVRGLAWNTTSETLRAAFEEHGEIEEGAVIHDKVTGKSRGYGFITFKN  114

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    ALK  SK IDGR+ V  LA  G+ G           D+SLRK+Y+G
Sbjct  115  MESTQQALKASSKLIDGRLAVCNLACEGLSGTSSAP------DLSLRKLYIG  160


 Score = 57.4 bits (137),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D + RKL+I  L  E T++ L   F+ +GE+EE  V  D+ T +S+G+GF+T+K  + A 
Sbjct  151  DLSLRKLYIGSLSPEVTSEMLLHYFARHGEIEEGSVAYDRDTDESRGFGFVTYKTAEAAK  210

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +  K + GR  + + A
Sbjct  211  KAIDDLEKVLGGRNIIVKYA  230



>ref|XP_010031654.1| PREDICTED: UBP1-associated protein 2B-like [Eucalyptus grandis]
Length=499

 Score =   137 bits (346),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 65/141 (46%), Positives = 93/141 (66%), Gaps = 1/141 (1%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE FT++QL  +++ AV +HPD++ +VR +AD D   RK+F+ GLGW+ T D L S+F
Sbjct  142  KLLEPFTKEQLTMVLKQAVAKHPDLIESVRGVADADPAHRKIFVHGLGWDATADALISVF  201

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
              YGE+E+   + D+ +GKSKGY FI FKH  GA  ALK+P K+I  R+T  QLA+ G  
Sbjct  202  GKYGEIEDCKAVTDRVSGKSKGYAFILFKHRSGARKALKQPQKKIGNRITSCQLASTGP-  260

Query  479  ggpgggssnnpVDISLRKIYV  541
                  S+    + +LRKI+V
Sbjct  261  VPAPPPSAPPVSEYTLRKIFV  281


 Score = 57.8 bits (138),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 27/72 (38%), Positives = 41/72 (57%), Gaps = 0/72 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+F+  +  E   +KL   F  +GE+EE  + LDK TGK KG+    ++  + A 
Sbjct  273  EYTLRKIFVSNVSAEVDPEKLLEFFKQFGEVEEGPLGLDKQTGKPKGFALFVYRSAESAK  332

Query  404  LALKEPSKQIDG  439
             AL+EP K  +G
Sbjct  333  RALEEPYKNFEG  344



>ref|XP_006492883.1| PREDICTED: RNA-binding protein Musashi homolog 2-like [Citrus 
sinensis]
Length=344

 Score =   135 bits (341),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV---SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRK+ED+ ++    D +     S +  R +L+  ++ QL +++     ++P +  
Sbjct  1    MEDVKKRKMEDDNILINGQDFNSSSSSSQDHLRSLLDPLSKSQLVDLLSRLGSQYPSIAE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGFIT
Sbjct  61   EIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFIT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KH++    AL+ PSK IDGR+ V  LA  G+ G           D++ RK+Y+G
Sbjct  121  YKHMESTQSALRAPSKLIDGRLAVCNLACEGLSGVSAVP------DLAQRKLYIG  169


 Score = 75.1 bits (183),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A  D  QRKL+I GL  E TT+ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++
Sbjct  157  AVPDLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVE  216

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  A+ +P K + GR  + +LA
Sbjct  217  AAKKAVDDPHKTLGGRTIIVKLA  239



>ref|XP_004228485.1| PREDICTED: UBP1-associated protein 2A [Solanum lycopersicum]
 ref|XP_004228486.1| PREDICTED: UBP1-associated protein 2A [Solanum lycopersicum]
 ref|XP_010313610.1| PREDICTED: UBP1-associated protein 2A [Solanum lycopersicum]
Length=488

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/141 (48%), Positives = 96/141 (68%), Gaps = 1/141 (1%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE FT+DQL  +++ A+ ++PD    ++ +AD+D   RK+F+ GLGW+TT + L S+F 
Sbjct  118  LLEPFTKDQLTALIKEALAKYPDFKENIQKLADKDPAHRKIFVHGLGWDTTAETLTSVFG  177

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQg  481
            +YGE+E+   + DK +GKSKGYGFI FKH  GA  ALKEP K+I  RMT  QLA+AG   
Sbjct  178  SYGEIEDCKAVADKVSGKSKGYGFILFKHRSGARKALKEPQKKIGTRMTSCQLASAGPVP  237

Query  482  gpgggssnnpV-DISLRKIYV  541
             P   ++  PV + + RKI+V
Sbjct  238  APPPSTAAAPVSEYTQRKIFV  258


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   FS +GE+EE  + LDK +GK KG+    +K ++GA 
Sbjct  250  EYTQRKIFVSNVAADLEPQKLLEYFSKFGEVEEGPLGLDKQSGKPKGFCLFVYKTVEGAR  309

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G     Q A
Sbjct  310  KALEEPHKTFEGHTLHCQKA  329



>gb|ACF83094.1| unknown [Zea mays]
 tpg|DAA54066.1| TPA: hypothetical protein ZEAMMB73_489429 [Zea mays]
 tpg|DAA54067.1| TPA: hypothetical protein ZEAMMB73_489429 [Zea mays]
Length=379

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A + H DVL  +R +AD D  QRK+F+ GLGW+TTTD L   
Sbjct  85   QALLDSFPKDQLVELLRDAAIAHGDVLTTIRRVADADPAQRKIFVHGLGWDTTTDTLTEA  144

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  145  FGPYGEIEDLKVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  203


 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G +    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  229  TQRKIFVSNVGADIDPQKLLQFFARFGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKA  288

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G M   Q A  G
Sbjct  289  LEEPHKHFEGVMLHCQKAIDG  309



>tpg|DAA54065.1| TPA: hypothetical protein ZEAMMB73_489429 [Zea mays]
Length=372

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A + H DVL  +R +AD D  QRK+F+ GLGW+TTTD L   
Sbjct  85   QALLDSFPKDQLVELLRDAAIAHGDVLTTIRRVADADPAQRKIFVHGLGWDTTTDTLTEA  144

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  145  FGPYGEIEDLKVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  203


 Score = 66.6 bits (161),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G +    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A 
Sbjct  227  EYTQRKIFVSNVGADIDPQKLLQFFARFGEIEEGPLGLDKVTGKPKGFALFVYKTIESAK  286

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G M   Q A  G
Sbjct  287  KALEEPHKHFEGVMLHCQKAIDG  309



>ref|XP_002457616.1| hypothetical protein SORBIDRAFT_03g010380 [Sorghum bicolor]
 gb|EES02736.1| hypothetical protein SORBIDRAFT_03g010380 [Sorghum bicolor]
Length=464

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A V H DVL A+R +AD D  QRK+F+ GLGW+ TTD L   
Sbjct  93   QALLDSFPKDQLVELLRDAAVAHGDVLSAIRHVADADPAQRKIFVHGLGWDATTDTLSEA  152

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YG++E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  153  FGPYGDIEDLRVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  211


 Score = 70.1 bits (170),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 46/125 (37%), Positives = 62/125 (50%), Gaps = 7/125 (6%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD------QDTTQRKLFIRGLGWE  268
            E  +KI    T  QL   V       P+  GAV + A        + TQRK+F+  +G +
Sbjct  193  EPQKKIGNRSTACQLAS-VGPVPGGAPNSAGAVPAPAQLHLPPVSEYTQRKIFVSNVGAD  251

Query  269  TTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMT  448
                KL   F+ YGE+EE  + LDK TGK KG+    +K I+ A  AL+EP K  DG + 
Sbjct  252  IDPKKLLQFFARYGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKALEEPHKHFDGVVL  311

Query  449  VTQLA  463
              Q A
Sbjct  312  HCQKA  316



>ref|XP_008805340.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
 ref|XP_008805341.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
Length=507

 Score =   137 bits (344),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +LE F +D L EI+++A V++PDVL  V  IAD D   RK+F+ GLGW+T  + L + 
Sbjct  104  QNLLEPFPKDHLMEILRDAAVKYPDVLEEVHRIADIDPAHRKVFVHGLGWDTNVETLVAA  163

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DKATGKSKGYGFI FKH  GA  ALK+P K+I  RMT  QLA+ G
Sbjct  164  FRQYGEIEDCNAVTDKATGKSKGYGFILFKHRSGARRALKQPQKKIGNRMTACQLASTG  222


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+FI  +G E    KL   FS +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  235  TQRKIFISNVGTELDPYKLLQFFSKFGEIEEGPLGLDKMTGKPKGFCLFVYKTIESARKA  294

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G +   Q A  G
Sbjct  295  LEEPHKNFEGHILHCQKAIDG  315



>gb|ACF84316.1| unknown [Zea mays]
Length=410

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A + H DVL  +R +AD D  QRK+F+ GLGW+TTTD L   
Sbjct  41   QALLDSFPKDQLVELLRDAAIAHGDVLTTIRRVADADPAQRKIFVHGLGWDTTTDTLTEA  100

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  101  FGPYGEIEDLKVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  159


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G +    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  185  TQRKIFVSNVGADIDPQKLLQFFARFGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKA  244

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G M   Q A  G
Sbjct  245  LEEPHKHFEGVMLHCQKAIDG  265



>ref|XP_008453765.1| PREDICTED: UBP1-associated protein 2B-like [Cucumis melo]
 ref|XP_008453766.1| PREDICTED: UBP1-associated protein 2B-like [Cucumis melo]
 ref|XP_008453768.1| PREDICTED: UBP1-associated protein 2B-like [Cucumis melo]
Length=347

 Score =   135 bits (339),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/167 (42%), Positives = 106/167 (63%), Gaps = 8/167 (5%)
 Frame = +2

Query  44   KRKLEDNGVVSDP-SFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD  220
            K++LEDN V S P   +     +D  K+LE F++ QL E++    ++ P++   +R+ AD
Sbjct  25   KKELEDN-VQSQPLDDVSDSDFDDLPKLLEPFSKTQLIELICTTALKDPNLQAQIRAAAD  83

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D T RK+F+ GLGW+TT + L S+F ++GE+E+  V++D+ TGK+KGYGF+ FK   GA
Sbjct  84   RDVTHRKIFVHGLGWDTTRETLTSVFESFGEIEDCNVVMDRNTGKAKGYGFVLFKSRQGA  143

Query  401  LLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYV  541
            + ALKEP K+I+ RMT  QLA+ G              ++  RKIYV
Sbjct  144  IKALKEPRKKINNRMTSCQLASVG------SVPPPQSQEVGPRKIYV  184


 Score = 62.4 bits (150),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 30/93 (32%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G+V     Q+   RK+++  +      ++LR+ F+ +GELE   +  D  TGKS+GY  
Sbjct  166  VGSVPPPQSQEVGPRKIYVANVHHNVDAERLRAFFAKFGELEMGPIGFDPETGKSRGYAI  225

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              ++  +GA  AL+EP K  +G     Q A+ G
Sbjct  226  FIYRTNEGARKALEEPHKVFEGNKLHCQRASEG  258



>ref|XP_008672918.1| PREDICTED: RNA binding protein isoform X1 [Zea mays]
 tpg|DAA54068.1| TPA: RNA binding protein isoform 1 [Zea mays]
 tpg|DAA54069.1| TPA: RNA binding protein isoform 2 [Zea mays]
Length=454

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A + H DVL  +R +AD D  QRK+F+ GLGW+TTTD L   
Sbjct  85   QALLDSFPKDQLVELLRDAAIAHGDVLTTIRRVADADPAQRKIFVHGLGWDTTTDTLTEA  144

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  145  FGPYGEIEDLKVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  203


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G +    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  229  TQRKIFVSNVGADIDPQKLLQFFARFGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKA  288

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP K  +G M   Q A
Sbjct  289  LEEPHKHFEGVMLHCQKA  306



>ref|NP_001149939.1| RNA binding protein [Zea mays]
 gb|ACG37277.1| RNA binding protein [Zea mays]
Length=455

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 83/119 (70%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A + H DVL  +R +AD D  QRK+F+ GLGW+TTTD L   
Sbjct  86   QALLDSFPKDQLVELLRDAAIAHGDVLTTIRRVADADPAQRKIFVHGLGWDTTTDTLTEA  145

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  146  FGPYGEIEDLKVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRSTACQLASVG  204


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G +    KL   F+ +GE+EE  + LDK TGK KG+    +K I+ A  A
Sbjct  230  TQRKIFVSNVGADIDPQKLLQFFARFGEIEEGPLGLDKVTGKPKGFALFVYKTIESAKKA  289

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP K  +G M   Q A
Sbjct  290  LEEPHKHFEGVMLHCQKA  307



>ref|XP_010251683.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera]
 ref|XP_010251684.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera]
 ref|XP_010251685.1| PREDICTED: UBP1-associated protein 2A [Nelumbo nucifera]
Length=508

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/144 (46%), Positives = 94/144 (65%), Gaps = 2/144 (1%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+LE FT+DQL ++++ A  +H D++  +R +AD D   RK+F+ GLGW+T  + L ++
Sbjct  113  QKLLEPFTKDQLIDLLREAADQHSDIMDRIRKVADVDPVHRKIFVHGLGWDTNAEILINV  172

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGM  475
            F  YGE+E+   ++DK TGKSKGYGFI FKH  GA  ALK+P K+I  RMT  QLA+AG 
Sbjct  173  FKKYGEIEDCNAVIDKITGKSKGYGFILFKHRSGARKALKQPQKRIGNRMTACQLASAGP  232

Query  476  QggpgggssnnpV--DISLRKIYV  541
                   +   P   + + RKIYV
Sbjct  233  VPPATQAAPPAPPVSEYTQRKIYV  256


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +  +    +L + FS YGE+EE  + LDK TGK KG+    +K ID A 
Sbjct  248  EYTQRKIYVSNVSADIDPQRLLNFFSKYGEIEEGPLGLDKQTGKPKGFALFVYKSIDSAK  307

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  308  KALEEPHKNYEGHILHCQKAIDG  330



>ref|XP_008240947.1| PREDICTED: UBP1-associated protein 2C-like [Prunus mume]
Length=313

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 106/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRK+E+     +   +   S +  R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDVKKRKIEE--ASGNGEEISTYSEDHLRSLLDPLAKPQLVDLLAKLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL W T++D LR+ FS +GE+EE  VI DKA+GKS+GYGFIT+K+
Sbjct  59   GVASADPVHRKLFVRGLAWNTSSDTLRAAFSEHGEIEEGAVIYDKASGKSRGYGFITYKY  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGR+ V  LA  G+        ++  +D++ RK+Y+G
Sbjct  119  MESTQHALRAPSKLIDGRLAVCNLACEGLS------GTSATLDLTQRKLYIG  164


 Score = 70.1 bits (170),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D TQRKL+I GL    T++ L   F  +G++EE  V  DK T +S+G+GF+T++ ++ A 
Sbjct  155  DLTQRKLYIGGLSPNVTSEMLLHFFGRHGDIEEGSVAYDKDTNESRGFGFVTYRTVEAAK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K + GR  + +LA
Sbjct  215  KAIDDPQKTLGGRNIIVKLA  234



>gb|EYU20704.1| hypothetical protein MIMGU_mgv1a0010912mg, partial [Erythranthe 
guttata]
Length=308

 Score =   132 bits (333),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 74/176 (42%), Positives = 104/176 (59%), Gaps = 10/176 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV-SDPSF---LPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            M+  KKRKL++ G   S P+     P  +LE+ R +L+   +  L  ++  A  ++  + 
Sbjct  1    MEETKKRKLDEIGNGRSLPNLNDTAPSSTLEELRTLLDPLAKPLLVNLLARAGSQYASIA  60

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
              ++S+A  D   RKLF+RGL W+TT++ L   F  +GE+EE  VI DKATGKS+GYGFI
Sbjct  61   EEIKSVASADPALRKLFVRGLAWDTTSETLCDAFQEHGEIEEGAVIYDKATGKSRGYGFI  120

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            TFK ++ A  ALK PSK IDGRM V  LA+ G+             D S RK+Y+G
Sbjct  121  TFKDMESAQNALKAPSKMIDGRMAVCNLASEGLSSTSATQ------DQSQRKLYIG  170


 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 56/89 (63%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   + A QD +QRKL+I GL  E T++ L S F  YG+++E  V  DK + KS+G+GF+
Sbjct  152  GLSSTSATQDQSQRKLYIGGLSPEITSEILLSFFGRYGDIDEGSVAYDKDSKKSRGFGFV  211

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            T+K  + A  A+++P K + GR    +LA
Sbjct  212  TYKTAEAAKRAIEDPQKMLGGRNVTVKLA  240



>ref|XP_003632233.2| PREDICTED: UBP1-associated protein 2A [Vitis vinifera]
Length=516

 Score =   135 bits (340),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F+++QL  +++ AV ++PD + +VR +AD D   RK+F+ GLGW+TT + L S+F
Sbjct  156  KLLEPFSKEQLLALLREAVEKYPDFVDSVRRLADADPAHRKIFVHGLGWDTTAETLTSVF  215

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK +GKSKGY FI FKH  GA  ALK+P K+I  RMT  QLA+AG
Sbjct  216  GKYGEIEDCKAVSDKISGKSKGYAFILFKHRSGARKALKQPQKKIGNRMTSCQLASAG  273


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E    KL   F+ +GE+EE  + LDK+TGK KG+    +K I+ + 
Sbjct  287  EYTQRKIFVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSIESSR  346

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  347  RALEEPHKIFEGHTLHCQKAIDG  369



>ref|XP_006850028.1| hypothetical protein AMTR_s00022p00189710 [Amborella trichopoda]
 gb|ERN11609.1| hypothetical protein AMTR_s00022p00189710 [Amborella trichopoda]
Length=344

 Score =   133 bits (335),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 105/176 (60%), Gaps = 10/176 (6%)
 Frame = +2

Query  29   MDFMKKRKLEDNGV----VSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVL  196
            MD  KKR+LE+ G      S        ++E  R +L+   ++QL +++     ++P + 
Sbjct  1    MDEAKKRRLEETGSGEEEASGYEGADEGAVEQLRSLLDPLKKEQLLDLLIKLGSQNPQIA  60

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
              +R  A  D   RKLF+RGL W+TT++ L   F  YGE+EE  VI+DKA GKS+G+GF+
Sbjct  61   AEIRDAACSDPVHRKLFVRGLAWDTTSETLCDAFLVYGEIEEGAVIMDKAAGKSRGFGFV  120

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            T+K ++ A  ALKEPSK IDGR+TV  LA  G+       S++   D + RK+Y+G
Sbjct  121  TYKDMESAQRALKEPSKLIDGRLTVCNLACEGL------TSASASTDQAQRKLYIG  170


 Score = 78.2 bits (191),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 55/89 (62%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   + A  D  QRKL+I GL  + ++  L S FS YGE+EE  V  DK T  S+G+GFI
Sbjct  152  GLTSASASTDQAQRKLYIGGLSTDISSKTLLSWFSKYGEIEEGSVAYDKDTNNSRGFGFI  211

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            TFK ++ A  A+ +P+K ++GR    +LA
Sbjct  212  TFKTVEAAKKAIDDPAKVLEGRAITVKLA  240



>emb|CAN80681.1| hypothetical protein VITISV_037734 [Vitis vinifera]
Length=478

 Score =   135 bits (339),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F+++QL  +++ AV ++PD + +VR +AD D   RK+F+ GLGW+TT + L S+F
Sbjct  118  KLLEPFSKEQLLALLREAVEKYPDFVDSVRRLADADPAHRKIFVHGLGWDTTAETLTSVF  177

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK +GKSKGY FI FKH  GA  ALK+P K+I  RMT  QLA+AG
Sbjct  178  GKYGEIEDCKAVSDKISGKSKGYAFILFKHRSGARKALKQPQKKIGNRMTSCQLASAG  235


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E    KL   F+ +GE+EE  + LDK+TGK KG+    +K I+ + 
Sbjct  249  EYTQRKIFVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSIESSR  308

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  309  RALEEPHKIFEGHTLHCQKAIDG  331



>ref|XP_004149162.1| PREDICTED: uncharacterized protein LOC101213550 [Cucumis sativus]
Length=405

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 93/141 (66%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F++ QL E++    ++ P++   +R+ AD+D T RK+F+ GLGW+TT + L S+F
Sbjct  50   KLLEPFSKTQLIELICTTALKDPNLQAQIRAAADRDVTHRKIFVHGLGWDTTRETLTSVF  109

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
             ++GE+E+  V++D+ TGK+KGYGFI FK   GA+ ALKEP K+I+ RMT  QLA+ G  
Sbjct  110  ESFGEIEDCNVVMDRNTGKAKGYGFILFKSRQGAIKALKEPRKKINNRMTSCQLASVG--  167

Query  479  ggpgggssnnpVDISLRKIYV  541
                        ++  RKIYV
Sbjct  168  ----SVPPPQSQEVGPRKIYV  184


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G+V     Q+   RK+++  +      ++LR+ F+ +G+LE   +  D  TGKS+GY  
Sbjct  166  VGSVPPPQSQEVGPRKIYVANVHHNVDAERLRAFFAKFGDLEMGPIGFDPETGKSRGYAI  225

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              ++  +GA  AL+EP K  +G     Q A+ G
Sbjct  226  FIYRTNEGARKALEEPHKVFEGNKLHCQRASEG  258



>emb|CBI24384.3| unnamed protein product [Vitis vinifera]
Length=467

 Score =   134 bits (338),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 84/118 (71%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F+++QL  +++ AV ++PD + +VR +AD D   RK+F+ GLGW+TT + L S+F
Sbjct  133  KLLEPFSKEQLLALLREAVEKYPDFVDSVRRLADADPAHRKIFVHGLGWDTTAETLTSVF  192

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK +GKSKGY FI FKH  GA  ALK+P K+I  RMT  QLA+AG
Sbjct  193  GKYGEIEDCKAVSDKISGKSKGYAFILFKHRSGARKALKQPQKKIGNRMTSCQLASAG  250


 Score = 63.9 bits (154),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E    KL   F+ +GE+EE  + LDK+TGK KG+    +K I+ + 
Sbjct  264  EYTQRKIFVSNVSSEIDPQKLLEFFAKFGEIEEGPLGLDKSTGKPKGFALFVYKSIESSR  323

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  324  RALEEPHKIFEGHTLHCQKAIDG  346



>ref|XP_004163497.1| PREDICTED: uncharacterized protein LOC101228639, partial [Cucumis 
sativus]
Length=405

 Score =   134 bits (336),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 93/141 (66%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F++ QL E++    ++ P++   +R+ AD+D T RK+F+ GLGW+TT + L S+F
Sbjct  50   KLLEPFSKTQLIELICTTALKDPNLQAQIRAAADRDVTHRKIFVHGLGWDTTRETLTSVF  109

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
             ++GE+E+  V++D+ TGK+KGYGFI FK   GA+ ALKEP K+I+ RMT  QLA+ G  
Sbjct  110  ESFGEIEDCNVVMDRNTGKAKGYGFILFKSRQGAIKALKEPRKKINNRMTSCQLASVG--  167

Query  479  ggpgggssnnpVDISLRKIYV  541
                        ++  RKIYV
Sbjct  168  ----SVPPPQSQEVGPRKIYV  184


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G+V     Q+   RK+++  +      ++LR+ F+ +G+LE   +  D  TGKS+GY  
Sbjct  166  VGSVPPPQSQEVGPRKIYVANVHHNVDAERLRAFFAKFGDLEMGPIGFDPETGKSRGYAI  225

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              ++  +GA  AL+EP K  +G     Q A+ G
Sbjct  226  FIYRTNEGARKALEEPHKVFEGNKLHCQRASEG  258



>ref|XP_004967762.1| PREDICTED: nuclear localization sequence-binding protein-like 
[Setaria italica]
Length=465

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/119 (51%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L+SF +DQL E++++A V H DV  AVR +AD D  QRK+F+ GLGW+ T D L   
Sbjct  98   QALLDSFPKDQLVELLRDAAVAHRDVRSAVRRVADADPAQRKIFVHGLGWDATADTLTEA  157

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F+ YGE+E+  V+ D+ TGK KGYGFI F+H  GA  AL+EP K+I  R T  QLA+ G
Sbjct  158  FTPYGEIEDLRVVTDRNTGKCKGYGFILFRHRSGARAALREPQKKIGNRNTACQLASVG  216


 Score = 65.5 bits (158),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G +    KL   F+ YGE+EE  + LDK TGK KG+    +K I+ A 
Sbjct  241  EYTQRKIFVSNVGADIDPQKLFLFFARYGEIEEGPLGLDKVTGKPKGFALFVYKTIESAK  300

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  301  KALEEPHKHFEGVVLHCQKA  320



>ref|XP_007141558.1| hypothetical protein PHAVU_008G206200g [Phaseolus vulgaris]
 gb|ESW13552.1| hypothetical protein PHAVU_008G206200g [Phaseolus vulgaris]
Length=494

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 65/127 (51%), Positives = 85/127 (67%), Gaps = 2/127 (2%)
 Frame = +2

Query  98   LSLEDA--RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWET  271
            LSLED    K+LE FT++QL  +V+ AV R P+ + +VR +AD D   RK+F+ GLGW+ 
Sbjct  118  LSLEDEPVEKLLEPFTKEQLHALVKQAVERFPEFVDSVRQLADVDPAHRKIFVHGLGWDA  177

Query  272  TTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTV  451
            T + L S+F  YGE+E+   + DK +GKSKGY FI FKH D A  ALK P K+I  R T 
Sbjct  178  TAETLTSVFGKYGEIEDCKAVTDKVSGKSKGYAFILFKHKDDARKALKNPQKKIGNRTTS  237

Query  452  TQLAAAG  472
             QLA+AG
Sbjct  238  CQLASAG  244


 Score = 63.2 bits (152),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +  E    KL   F  +GE+E+  + LDK TGK KG+    +K ++ +  A
Sbjct  260  TQRKIFVSNVSAEIDPQKLLEFFKQFGEVEDGPLGLDKNTGKPKGFALFVYKSVESSKKA  319

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G     Q A  G
Sbjct  320  LEEPHKNFEGHTLYCQKAVDG  340



>gb|KGN53237.1| hypothetical protein Csa_4G031080 [Cucumis sativus]
Length=421

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 93/141 (66%), Gaps = 6/141 (4%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F++ QL E++    ++ P++   +R+ AD+D T RK+F+ GLGW+TT + L S+F
Sbjct  50   KLLEPFSKTQLIELICTTALKDPNLQAQIRAAADRDVTHRKIFVHGLGWDTTRETLTSVF  109

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
             ++GE+E+  V++D+ TGK+KGYGFI FK   GA+ ALKEP K+I+ RMT  QLA+ G  
Sbjct  110  ESFGEIEDCNVVMDRNTGKAKGYGFILFKSRQGAIKALKEPRKKINNRMTSCQLASVG--  167

Query  479  ggpgggssnnpVDISLRKIYV  541
                        ++  RKIYV
Sbjct  168  ----SVPPPQSQEVGPRKIYV  184


 Score = 59.7 bits (143),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/93 (31%), Positives = 50/93 (54%), Gaps = 0/93 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G+V     Q+   RK+++  +      ++LR+ F+ +G+LE   +  D  TGKS+GY  
Sbjct  166  VGSVPPPQSQEVGPRKIYVANVHHNVDAERLRAFFAKFGDLEMGPIGFDPETGKSRGYAI  225

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              ++  +GA  AL+EP K  +G     Q A+ G
Sbjct  226  FIYRTNEGARKALEEPHKVFEGNKLHCQRASEG  258



>gb|EPS65588.1| hypothetical protein M569_09190 [Genlisea aurea]
Length=516

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/113 (53%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  134  FTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGE  313
            F+++QL  +++ AVV+HPDV+  V S+AD D    K+F+ GLGW+   + + S+FS YGE
Sbjct  149  FSKEQLTLLIKAAVVKHPDVMENVHSLADSDPAHCKIFVHGLGWDANAESITSVFSKYGE  208

Query  314  LEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            +E+  V+ DK +GKSKGYGFI +KH  GA  ALKEP K I+GRMT  QLA+AG
Sbjct  209  IEDCKVVKDKNSGKSKGYGFILYKHRLGARRALKEPQKLIEGRMTSCQLASAG  261


 Score = 62.4 bits (150),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 28/81 (35%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+++  +  +   +KL   FS +GE+EE  + LDK +G+ +G+    +K ++ A  +
Sbjct  284  TQRKIYVSNVSADLDPNKLYEFFSKFGEIEEGPLGLDKQSGRPRGFCLFVYKTVESAKKS  343

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K +DG +   Q A  G
Sbjct  344  LEEPHKTLDGHLLHCQKAIDG  364



>ref|XP_010261157.1| PREDICTED: UBP1-associated protein 2A-like [Nelumbo nucifera]
Length=404

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 66/150 (44%), Positives = 96/150 (64%), Gaps = 6/150 (4%)
 Frame = +2

Query  92   PRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWET  271
            P    E  +K+LE +T+DQL E + +A V+   +L  +RSIAD D + RK+F+ GLGW+T
Sbjct  44   PEPDSEKVQKLLEPYTKDQLIEFICDAAVKDASLLQRIRSIADCDVSHRKIFVHGLGWDT  103

Query  272  TTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTV  451
            T + L S F  +GE+E+  V++D+ATGK+KGYGF+ F    GA  ALK+P K+I+ R+T 
Sbjct  104  TRETLISAFQPFGEIEDCNVVMDRATGKAKGYGFVLFTSRAGATNALKQPQKKINNRVTS  163

Query  452  TQLAAAGMQggpgggssnnpVDISLRKIYV  541
             QLA+ G        +S    D + RKIY+
Sbjct  164  CQLASVG------PVTSQQTQDTTGRKIYI  187


 Score = 65.9 bits (159),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 34/90 (38%), Positives = 51/90 (57%), Gaps = 0/90 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G V S   QDTT RK++I  +  +   +KLR+ F+ +GE+E   +  D  TGKS+G+  
Sbjct  169  VGPVTSQQTQDTTGRKIYISNVHSDADPEKLRAFFAKFGEIENGPLGFDLLTGKSRGFAM  228

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
              +K  +GA  AL+EP K  +G     Q A
Sbjct  229  FVYKTQEGARKALEEPYKMFEGHQLHCQRA  258



>ref|XP_004148449.1| PREDICTED: uncharacterized protein LOC101211535 [Cucumis sativus]
 ref|XP_004161816.1| PREDICTED: uncharacterized protein LOC101228786 [Cucumis sativus]
 gb|KGN62091.1| hypothetical protein Csa_2G297150 [Cucumis sativus]
Length=500

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 89/148 (60%), Gaps = 3/148 (2%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   K+LE FT+DQL  +++ A  +H DV G +R +AD D + RK+F+ GLGW+T  + L
Sbjct  124  EPIHKLLEPFTKDQLINLLREAADKHVDVAGRIRMVADADPSHRKIFVHGLGWDTNAETL  183

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             ++F  +GE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  184  INVFKQFGEIEDCKAVCDKVSGKSKGYGFILFKKRSGARKALKEPQKKIGNRMTACQLAS  243

Query  467  AG---MQggpgggssnnpVDISLRKIYV  541
             G                 + + RKIYV
Sbjct  244  VGPVPTTNAVAAPQVPPASEYTQRKIYV  271


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 40/122 (33%), Positives = 62/122 (51%), Gaps = 3/122 (2%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +KI    T  QL  +     V   + + A +     + TQRK+++  +G +    KL
Sbjct  227  EPQKKIGNRMTACQLASV---GPVPTTNAVAAPQVPPASEYTQRKIYVSNVGADVDPQKL  283

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS +GE++E  + LDK TGK KG+    +K I+ A  AL+EP K  +G +   Q A 
Sbjct  284  LAFFSQFGEVDEGPLGLDKMTGKPKGFCLFVYKSIESAKKALEEPHKNFEGHVLHCQKAI  343

Query  467  AG  472
             G
Sbjct  344  DG  345



>ref|XP_006429841.1| hypothetical protein CICLE_v10013551mg [Citrus clementina]
 gb|ESR43081.1| hypothetical protein CICLE_v10013551mg [Citrus clementina]
Length=817

 Score =   135 bits (340),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV---SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRK+ED+ ++    D +     S +  R +L+  ++ QL +++     ++P +  
Sbjct  1    MEDVKKRKMEDDNILINGQDFNSSSSSSQDHLRSLLDPLSKSQLVDLLSRLGSQYPSIAE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGFIT
Sbjct  61   EIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFIT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KH++    AL+ PSK IDGR+ V  LA  G+ G           D++ RK+Y+G
Sbjct  121  YKHMESTQSALRAPSKLIDGRLAVCNLACEGLSGVSAVP------DLAQRKLYIG  169


 Score = 74.7 bits (182),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A  D  QRKL+I GL  E TT+ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++
Sbjct  157  AVPDLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVE  216

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  A+ +P K + GR  + +LA
Sbjct  217  AAKKAVDDPHKTLGGRTIIVKLA  239



>gb|KDO50156.1| hypothetical protein CISIN_1g045707mg [Citrus sinensis]
Length=901

 Score =   135 bits (341),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 69/175 (39%), Positives = 107/175 (61%), Gaps = 9/175 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVV---SDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRK+ED+ ++    D +     S +  R +L+  ++ QL +++     ++P +  
Sbjct  1    MEDVKKRKMEDDNILINGQDFNSSSSSSQDHLRSLLDPLSKSQLVDLLSRLGSQYPSIAE  60

Query  200  AVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFIT  379
             ++S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DKATGKS+GYGFIT
Sbjct  61   EIKSVASADPVHRKLFVRGLAWNTTSETLCAAFRVHGEIEEGAVIYDKATGKSRGYGFIT  120

Query  380  FKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            +KH++    AL+ PSK IDGR+ V  LA  G+ G           D++ RK+Y+G
Sbjct  121  YKHMESTQSALRAPSKLIDGRLAVCNLACEGLSGVSAVP------DLAQRKLYIG  169


 Score = 75.1 bits (183),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A  D  QRKL+I GL  E TT+ L + F  +GE+EE  V  DK T +S+G+GF+T+K ++
Sbjct  157  AVPDLAQRKLYIGGLSPEVTTEVLLNFFGRHGEIEEGSVAYDKDTNESRGFGFVTYKTVE  216

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  A+ +P K + GR  + +LA
Sbjct  217  AAKKAVDDPHKTLGGRTIIVKLA  239



>ref|XP_010525452.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
 ref|XP_010525453.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
 ref|XP_010525454.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
Length=472

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 66/151 (44%), Positives = 90/151 (60%), Gaps = 6/151 (4%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE FT+DQL  +++ A   HPDV   +R +AD+D   RK+F+ GLGW+T  D L
Sbjct  96   EPIQNLLEPFTKDQLIILLKEAAGNHPDVANQIRKVADEDPVHRKIFVHGLGWDTKADAL  155

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   ++DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  156  IEAFKQYGEIEDCKAVVDKISGKSKGYGFILFKSRSGARNALKQPQKKIGSRMTACQLAS  215

Query  467  AG------MQggpgggssnnpVDISLRKIYV  541
             G              + ++  + S RKIYV
Sbjct  216  VGPVQGNPTAAATSAPAQHSTSEFSYRKIYV  246


 Score = 58.2 bits (139),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 29/76 (38%), Positives = 42/76 (55%), Gaps = 0/76 (0%)
 Frame = +2

Query  236  RKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALK  415
            RK+++  +  E    KL + FS YGE+EE  + LDK TG+ KG+    +K  + A  AL 
Sbjct  242  RKIYVSNVAAELDAQKLFAFFSRYGEIEEGPLGLDKVTGRPKGFCLFIYKSPESAKRALD  301

Query  416  EPSKQIDGRMTVTQLA  463
            EP K  +G +   Q A
Sbjct  302  EPHKNFEGHVLHCQKA  317



>gb|KJB56079.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
 gb|KJB56080.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
 gb|KJB56081.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
 gb|KJB56082.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
 gb|KJB56083.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
 gb|KJB56084.1| hypothetical protein B456_009G105900 [Gossypium raimondii]
Length=503

 Score =   132 bits (332),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 64/137 (47%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = +2

Query  62   NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRK  241
            NG     S    L  E   K+LE F +DQL  +++ AV +HP+ + +VR +AD D  QRK
Sbjct  102  NGAPKGTSQDEELDDEPFEKLLEPFGKDQLITLIKKAVEKHPEFISSVRELADVDPAQRK  161

Query  242  LFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEP  421
            +F+ GL W+TT + L + FS YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P
Sbjct  162  IFVHGLSWDTTAETLTAEFSKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQP  221

Query  422  SKQIDGRMTVTQLAAAG  472
             K+I  R T  QLA+ G
Sbjct  222  QKKIGNRTTSCQLASQG  238


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E   +KL   F  +GE+EE  + LDK TGK KG+    ++ I+ A 
Sbjct  252  EYTQRKIFVSNVSAEMDPEKLLEFFKQFGEIEEGPLGLDKHTGKPKGFALFVYRSIESAR  311

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  312  KALEEPHKNFEGHVLHCQKA  331



>ref|XP_006645744.1| PREDICTED: heterogeneous nuclear ribonucleoprotein A3-like [Oryza 
brachyantha]
Length=416

 Score =   131 bits (330),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 61/117 (52%), Positives = 81/117 (69%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +L+SF +DQL E++++A V H DVL A+R  AD D  QRK+F+ GLGW+ T++ L   FS
Sbjct  50   LLDSFPKDQLVELLRDAAVAHEDVLTAIRRAADADPAQRKIFVHGLGWDATSETLTEAFS  109

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+  V+ D+ATGK KGYGFI F    GA  AL+EP K+I  R T  QLA+ G
Sbjct  110  PYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNRTTACQLASVG  166


 Score = 71.6 bits (174),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 44/125 (35%), Positives = 63/125 (50%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIAD------QDTTQRKLFIRGLGWE  268
            E  +KI    T  QL  +        P++     + A        + TQRK+F+  +G +
Sbjct  148  EPQKKIGNRTTACQLASVGPVPPGGMPNIPAPTAAPAQLVLPPVSEYTQRKIFVSNVGAD  207

Query  269  TTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMT  448
                KL   FS YGE+EE  + LDKATGK KG+    +K ++GA  AL+EP KQ +G + 
Sbjct  208  IDPQKLLLFFSKYGEIEEGPLGLDKATGKPKGFALFVYKTLEGAKKALQEPHKQFEGVVL  267

Query  449  VTQLA  463
              Q A
Sbjct  268  HCQKA  272



>ref|XP_010534355.1| PREDICTED: UBP1-associated protein 2C-like [Tarenaya hassleriana]
Length=348

 Score =   130 bits (328),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/172 (40%), Positives = 100/172 (58%), Gaps = 13/172 (8%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+  KKRK+++ G           S E+ R +LE   + QL +++     ++P +   ++
Sbjct  1    MEEAKKRKMDETGDG-------ETSQEELRSLLEPIEKSQLVDLLSRIGSQYPSIAEEIK  53

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+A  D   RKLF+RGL W T+++ L + F  +GE+EE  VI DK TGKS+GYGFIT+KH
Sbjct  54   SMASADPVHRKLFVRGLAWNTSSETLCATFRAHGEIEEGAVIYDKTTGKSRGYGFITYKH  113

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            I+ A  ALK   K IDGR+ V  LA  G+ G           D+S RK+++G
Sbjct  114  IESAQNALKAGGKMIDGRLAVCNLACEGLSGTNSIS------DLSQRKLFIG  159


 Score = 75.5 bits (184),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 41/90 (46%), Positives = 56/90 (62%), Gaps = 2/90 (2%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            L    SI+D   +QRKLFI GL  E T++ L S F   GE+EE  V  DK T +S+G+GF
Sbjct  142  LSGTNSISD--LSQRKLFIGGLSPEVTSEMLLSFFGRCGEIEEGSVAYDKDTNESRGFGF  199

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            +TF+ ++ A  AL +P K + GR  V +LA
Sbjct  200  VTFRTVEAAKKALDDPHKILGGRAIVVKLA  229



>ref|XP_010230747.1| PREDICTED: UBP1-associated protein 2B-like [Brachypodium distachyon]
 ref|XP_010230748.1| PREDICTED: UBP1-associated protein 2B-like [Brachypodium distachyon]
 ref|XP_010230749.1| PREDICTED: UBP1-associated protein 2B-like [Brachypodium distachyon]
 ref|XP_010230750.1| PREDICTED: UBP1-associated protein 2B-like [Brachypodium distachyon]
Length=478

 Score =   132 bits (331),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 62/119 (52%), Positives = 82/119 (69%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +LESF ++QL E++++A V H DVL  VR  AD D  QRK+F+ GLGW+TT D LR  
Sbjct  108  QSLLESFPKEQLVELLRDAAVGHGDVLETVRRAADADPAQRKIFVHGLGWDTTVDTLREA  167

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            FS+YGE+E+  ++ D+ TGK KGYGFI F    GA  AL+EP K+I  R T  QLA+ G
Sbjct  168  FSSYGEIEDLKLVSDRNTGKCKGYGFILFSRRSGARAALQEPQKKIGNRTTSCQLASVG  226


 Score = 73.2 bits (178),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G +    KL   FS YGE+EE  + LDKATGK KG+    +K ++GA 
Sbjct  257  EYTQRKIFVSNVGADIDPQKLVQFFSKYGEIEEGPLGLDKATGKPKGFALFVYKTLEGAR  316

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G M   Q A
Sbjct  317  KALQEPHKSFEGVMLHCQKA  336



>ref|XP_002968180.1| hypothetical protein SELMODRAFT_169811 [Selaginella moellendorffii]
 gb|EFJ30434.1| hypothetical protein SELMODRAFT_169811 [Selaginella moellendorffii]
Length=296

 Score =   129 bits (324),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/114 (55%), Positives = 79/114 (69%), Gaps = 6/114 (5%)
 Frame = +2

Query  203  VRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITF  382
            +R +A +D   RKLF+RGL WETT+  LR  F  +GE+EE  VI+DKATGKS+G+GFITF
Sbjct  22   IREVASKDPAHRKLFVRGLAWETTSQDLREAFEQFGEIEEGAVIIDKATGKSRGFGFITF  81

Query  383  KHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            KH+D A  ALKEPSK IDGR+TV  LA+ G  G  G        D + RK+Y+G
Sbjct  82   KHMDSAQRALKEPSKTIDGRITVCNLASVGTSGSGGTN------DQAQRKLYIG  129


 Score = 89.7 bits (221),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 62/95 (65%), Gaps = 0/95 (0%)
 Frame = +2

Query  194  LGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGF  373
            +G   S    D  QRKL+I GL +ET+ + L ++FS YGE+EE  V  DK T KS+G+ F
Sbjct  110  VGTSGSGGTNDQAQRKLYIGGLSYETSNETLLNIFSKYGEIEEGAVAYDKNTNKSRGFAF  169

Query  374  ITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
            +T+K ++ A  A+ +P+K I+GR  + +LAA G +
Sbjct  170  VTYKTVEAARNAIDDPNKTIEGRHVIVKLAAEGQK  204



>ref|XP_010939599.1| PREDICTED: UBP1-associated protein 2B-like [Elaeis guineensis]
Length=492

 Score =   132 bits (331),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 89/154 (58%), Gaps = 13/154 (8%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE  T++QL  ++++A    P  L  +  +AD D   RKLF+ GLGWETT+D LR+ F+
Sbjct  58   LLEPLTKEQLISLLRSAAASDPATLAEIHRLADLDPAHRKLFVHGLGWETTSDGLRAAFA  117

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQg  481
            +YGE+E+  ++ DKATG+SKGYGF+ F+H   A  AL++P K ID RMT  QLA+ G   
Sbjct  118  SYGEIEDCRIVADKATGRSKGYGFLLFRHRRSARQALRQPQKLIDNRMTACQLASTGPPS  177

Query  482  gpgggssnnpVDISL-------------RKIYVG  544
                    +    S              RKIYVG
Sbjct  178  ATSHPPPPHHYTASFNPNPNATPQDNLPRKIYVG  211


 Score = 68.2 bits (165),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 62/131 (47%), Gaps = 8/131 (6%)
 Frame = +2

Query  95   RLSLEDARKILES-FTRDQLFEIVQNAVVRHPDV-------LGAVRSIADQDTTQRKLFI  250
            R +L   +K++++  T  QL      +   HP              +   QD   RK+++
Sbjct  151  RQALRQPQKLIDNRMTACQLASTGPPSATSHPPPPHHYTASFNPNPNATPQDNLPRKIYV  210

Query  251  RGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQ  430
              +       +L + FS YGE+EE  +  D+ TGK KG+    +K +DGA  AL+EP+K 
Sbjct  211  GNVHSNIDGARLHAFFSKYGEIEEGPIGFDRQTGKPKGFALFVYKTVDGARRALEEPNKD  270

Query  431  IDGRMTVTQLA  463
             +G +   Q A
Sbjct  271  FEGYLLYCQKA  281



>ref|XP_007016698.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007016699.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007016700.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 ref|XP_007016701.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34317.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34318.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34319.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
 gb|EOY34320.1| RNA-binding family protein, putative isoform 1 [Theobroma cacao]
Length=500

 Score =   131 bits (330),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 86/137 (63%), Gaps = 0/137 (0%)
 Frame = +2

Query  62   NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRK  241
            NGV  + S    L  E   K+LE F +DQL  +++ AV +HP+ + +VR  AD D   RK
Sbjct  102  NGVPKETSQEEELDDEPFEKLLEPFGKDQLITLIKKAVEKHPEFMSSVREFADADPAHRK  161

Query  242  LFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEP  421
            +F+ GL W+TT + L + F  YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P
Sbjct  162  IFVHGLSWDTTAETLTAEFIKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQP  221

Query  422  SKQIDGRMTVTQLAAAG  472
             K+I  R+T  QLA+ G
Sbjct  222  QKKIGNRITSCQLASQG  238


 Score = 64.7 bits (156),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E   +KL   F  YGE+EE  + LDK +GK KG+    ++ I+ A 
Sbjct  252  EYTQRKIFVSNVSAEVDPEKLLEYFRQYGEIEEGPLGLDKQSGKPKGFALFVYRSIESAR  311

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  312  RALEEPHKNFEGHVLHCQKAIDG  334



>ref|XP_008457902.1| PREDICTED: UBP1-associated protein 2A-like [Cucumis melo]
Length=498

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   K+LE F++DQL  +++ A  +H DV G +R +AD D + RK+F+ GLGW+T  + L
Sbjct  122  EPIHKLLEPFSKDQLINLLREAADKHVDVAGRIRMVADADPSHRKIFVHGLGWDTNAETL  181

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             ++F  +GE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  182  INVFKQFGEIEDCKAVCDKVSGKSKGYGFILFKKRSGARKALKEPQKKIGNRMTACQLAS  241

Query  467  AG  472
             G
Sbjct  242  VG  243


 Score = 65.9 bits (159),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 32/81 (40%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+++  +G +    KL + FS +GE++E  + LDK TGK KG+    +K I+ A  A
Sbjct  263  TQRKIYVSNVGADVDPQKLLAFFSQFGEVDEGPLGLDKMTGKPKGFCLFVYKSIESAKKA  322

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G +   Q A  G
Sbjct  323  LEEPHKNFEGHVLHCQKAIDG  343



>ref|XP_011004820.1| PREDICTED: UBP1-associated protein 2A-like [Populus euphratica]
Length=340

 Score =   129 bits (325),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/172 (38%), Positives = 103/172 (60%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRK+++  +  + S     + +  R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDLKKRKMDEASI--NGSAKTSTTQDYLRSLLDPLNKPQLVDLLSRLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
            S+A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DK TGKS+GYGFIT+KH
Sbjct  59   SLASADPVHRKLFVRGLAWNTTSETLCAEFRIHGEIEEGSVIYDKVTGKSRGYGFITYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL  PSK IDGRM V  LA  G+        +    D++ RK+Y+G
Sbjct  119  MESAQRALGAPSKLIDGRMAVCNLACEGL------TGATTTPDLTQRKLYIG  164


 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   +    D TQRKL+I GL  E +++ L   F  YGE+ E  V  +K T +S+G+GFI
Sbjct  146  GLTGATTTPDLTQRKLYIGGLSPEISSEMLLHFFGRYGEIGEGSVAYNKDTNESRGFGFI  205

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            T+K ++ A  A+ +P K + GR    +LA
Sbjct  206  TYKTVEAAKKAIDDPHKLLGGRTITVKLA  234



>ref|XP_002270568.1| PREDICTED: UBP1-associated protein 2A [Vitis vinifera]
 ref|XP_010653136.1| PREDICTED: UBP1-associated protein 2A [Vitis vinifera]
Length=463

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 7/152 (5%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +KILE F++DQL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  75   EPIQKILEPFSKDQLINLLREAAEKHADVAERLRRVADEDPVHRKIFVHGLGWDTNAETL  134

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  135  ISVFKDYGEIEDCRAVCDKLSGKSKGYGFILFKTRSGARKALKQPQKKIGNRMTACQLAS  194

Query  467  AGM-------QggpgggssnnpVDISLRKIYV  541
             G        Q      ++ +  + + RKIYV
Sbjct  195  IGPVPSPAVGQAAMSVSAAQSVSEYTQRKIYV  226


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 60/120 (50%), Gaps = 7/120 (6%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDT----TQRKLFIRGLGWETTTDK  283
            +KI    T  QL  I     V  P V  A  S++   +    TQRK+++  +G E    K
Sbjct  181  KKIGNRMTACQLASI---GPVPSPAVGQAAMSVSAAQSVSEYTQRKIYVSNVGAELDPQK  237

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L   FS YGE+EE  + LDK TGK KG+    +K  +GA  AL EP K  DG +   Q A
Sbjct  238  LLVFFSKYGEIEEGPLGLDKQTGKPKGFCLFVYKTAEGAKKALDEPHKNFDGHILHCQKA  297



>emb|CAN72884.1| hypothetical protein VITISV_028589 [Vitis vinifera]
Length=463

 Score =   130 bits (328),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 66/152 (43%), Positives = 93/152 (61%), Gaps = 7/152 (5%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +KILE F++DQL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  75   EPIQKILEPFSKDQLINLLREAAEKHADVAERLRRVADEDPVHRKIFVHGLGWDTNAETL  134

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  135  ISVFKDYGEIEDCRAVCDKLSGKSKGYGFILFKTRSGARKALKQPQKKIGNRMTACQLAS  194

Query  467  AGM-------QggpgggssnnpVDISLRKIYV  541
             G        Q      ++ +  + + RKIYV
Sbjct  195  IGPVPSPAVGQAAMSVSAAQSVSEYTQRKIYV  226


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 46/120 (38%), Positives = 60/120 (50%), Gaps = 7/120 (6%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDT----TQRKLFIRGLGWETTTDK  283
            +KI    T  QL  I     V  P V  A  S++   +    TQRK+++  +G E    K
Sbjct  181  KKIGNRMTACQLASI---GPVPSPAVGQAAMSVSAAQSVSEYTQRKIYVSNVGAELDPQK  237

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L   FS YGE+EE  + LDK TGK KG+    +K  +GA  AL EP K  DG +   Q A
Sbjct  238  LLVFFSKYGEIEEGPLGLDKQTGKPKGFCLFVYKTAEGAKKALDEPHKNFDGHILHCQKA  297



>ref|XP_007204289.1| hypothetical protein PRUPE_ppa001255mg [Prunus persica]
 gb|EMJ05488.1| hypothetical protein PRUPE_ppa001255mg [Prunus persica]
Length=870

 Score =   133 bits (335),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 65/172 (38%), Positives = 106/172 (62%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ +KKRK+E+     +   +   S +  R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDVKKRKIEE--ASGNGEEISTYSEDHLRSLLDPLAKPQLVDLLAKLGCQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL W T++D LR+ FS +GE+EE  VI DKA+GKS+GYGFIT+K+
Sbjct  59   GVASADPVHRKLFVRGLAWNTSSDTLRAAFSEHGEIEEGAVIYDKASGKSRGYGFITYKY  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++    AL+ PSK IDGR+ V  LA  G+        ++  +D++ RK+Y+G
Sbjct  119  MESTQHALRAPSKLIDGRLAVCNLACEGLS------GTSATLDLTQRKLYIG  164


 Score = 70.5 bits (171),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 52/83 (63%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            A  D TQRKL+I GL    T++ L   F  +G++EE  V  DK T +S+G+GF+T++ ++
Sbjct  152  ATLDLTQRKLYIGGLSPNVTSEMLLHFFGRHGDIEEGSVAYDKDTNESRGFGFVTYRTVE  211

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  A+ +P K + GR  + +LA
Sbjct  212  AAKKAIDDPQKTLGGRNIIVKLA  234



>ref|XP_010108565.1| Heterogeneous nuclear ribonucleoprotein [Morus notabilis]
 gb|EXC19708.1| Heterogeneous nuclear ribonucleoprotein [Morus notabilis]
Length=324

 Score =   128 bits (322),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 65/145 (45%), Positives = 88/145 (61%), Gaps = 0/145 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   K+LE+F ++QL  +++ A  +H DV   VR I ++D   RK+FIRGL W TT++ L
Sbjct  46   EPIEKLLEAFGKEQLVNLLREAAEKHCDVADRVRKIGNEDQALRKIFIRGLEWATTSETL  105

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
            RS+F  YGE+E+  VI D  +GKSKGYGFI FK   GA  ALKEP K+I  R T +QL+ 
Sbjct  106  RSVFEEYGEIEDCTVICDMVSGKSKGYGFILFKTRSGARKALKEPEKKIGNRTTFSQLSM  165

Query  467  AGMQggpgggssnnpVDISLRKIYV  541
              +             + + RKIYV
Sbjct  166  GVVPAAASAQPQGPSSEETQRKIYV  190


 Score = 62.8 bits (151),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 45/86 (52%), Gaps = 0/86 (0%)
 Frame = +2

Query  185  PDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKG  364
            P    A       + TQRK+++  +G E   +KL   FS YGE+E   + LD+ T K KG
Sbjct  169  PAAASAQPQGPSSEETQRKIYVSNVGAELDPEKLTVFFSKYGEIERGPLGLDRVTRKPKG  228

Query  365  YGFITFKHIDGALLALKEPSKQIDGR  442
            +    +K +DGA  AL EP K  +G 
Sbjct  229  FCLFAYKTVDGARKALVEPVKDFEGH  254



>ref|XP_002322576.1| RNA recognition motif-containing family protein [Populus trichocarpa]
 gb|EEF04337.1| RNA recognition motif-containing family protein [Populus trichocarpa]
Length=477

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 60/118 (51%), Positives = 77/118 (65%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F +DQL  +++ A   H DV   +R +ADQD   RK+F+ GLGW+T  + L S F
Sbjct  94   KLLEPFGKDQLINLLREAADAHRDVAEKIRQVADQDPVHRKIFVHGLGWDTNAEALMSAF  153

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+ G
Sbjct  154  KPYGEIEDCKAVCDKVSGKSKGYGFILFKRRSGARKALKEPQKKIGNRMTACQLASIG  211


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +  +    KL S FS +GE+EE  + LDKATGK KG+    +K  +GA 
Sbjct  236  EYTLRKIYVSNVAADLDPQKLYSYFSEFGEIEEGPLGLDKATGKPKGFCLFVYKSSEGAK  295

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G M   Q A
Sbjct  296  KALEEPHKSFEGHMLHCQKA  315



>ref|XP_004493289.1| PREDICTED: heterogeneous nuclear ribonucleoprotein D-like [Cicer 
arietinum]
Length=490

 Score =   130 bits (327),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/122 (51%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K+LE FT+DQ+  ++  A  +H DV   +R IAD D   RK+F+ GLGW+TT+  L
Sbjct  85   EPIQKLLEPFTKDQIASLLCEAASKHRDVADRIRKIADGDAAHRKIFVHGLGWDTTSATL  144

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  145  INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKKRSGARNALKEPQKKIGNRMTACQLAS  204

Query  467  AG  472
             G
Sbjct  205  IG  206


 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/124 (36%), Positives = 66/124 (53%), Gaps = 7/124 (6%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEI--VQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTD  280
            E  +KI    T  QL  I  VQN++   P V     +    + TQ+K++I  +G +    
Sbjct  188  EPQKKIGNRMTACQLASIGPVQNSLQPTPQV-----TPQTSEYTQKKIYISNVGPDLDPQ  242

Query  281  KLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQL  460
            KL + FS +GE+EE  + LDKATGK KG+    +K  + A  AL+EP K+ +G +   Q 
Sbjct  243  KLFTFFSRFGEIEEGPLGLDKATGKPKGFCLFVYKSAESARRALEEPHKEFEGHILHCQK  302

Query  461  AAAG  472
            A  G
Sbjct  303  AIDG  306



>emb|CDP10118.1| unnamed protein product [Coffea canephora]
Length=351

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/147 (44%), Positives = 90/147 (61%), Gaps = 6/147 (4%)
 Frame = +2

Query  104  LEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDK  283
            +E+ R +LE   + QL +++     ++P +   +RS+A  D   RKLF+RGL W TT++ 
Sbjct  39   VEELRTLLEPLAKPQLTDLLVKLGFQYPFIAEEIRSVARADPALRKLFVRGLSWNTTSET  98

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L + F  +GE+EE  VI DKATGKS+GYGFIT+K ++ A  ALK PSK IDGRM V  LA
Sbjct  99   LCAAFEEHGEIEEGAVIADKATGKSRGYGFITYKDMESAQRALKAPSKMIDGRMAVCNLA  158

Query  464  AAGMQggpgggssnnpVDISLRKIYVG  544
              G+             D + RK+Y+G
Sbjct  159  CEGLSSSSTTP------DQAQRKLYIG  179


 Score = 78.2 bits (191),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 39/89 (44%), Positives = 54/89 (61%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            G   S    D  QRKL+I  L  ETT++ L S F+  GE+EE  V  DK T +S+G+GF+
Sbjct  161  GLSSSSTTPDQAQRKLYIGSLSPETTSEMLLSFFAKNGEIEEGSVAYDKETNRSRGFGFV  220

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            TFK ++GA  A+ +P K + GR    +LA
Sbjct  221  TFKTVEGAKRAIDDPQKMLGGRNITVKLA  249



>emb|CDP05989.1| unnamed protein product [Coffea canephora]
Length=395

 Score =   129 bits (325),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 61/116 (53%), Positives = 80/116 (69%), Gaps = 0/116 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
              IL SFT+ +L EI+Q A V HP +L  V S  D + + RK+FIR LG +TT + L S 
Sbjct  86   HNILHSFTKSRLVEILQEAAVAHPAILHTVLSTVDDNPSHRKIFIRNLGPKTTPENLHSF  145

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            FS YGE+EEA VI D+ TG SKGYGF+TFK+ +  LLAL+ PSK+IDG ++ T + 
Sbjct  146  FSNYGEVEEAKVIFDRTTGYSKGYGFVTFKNAESFLLALENPSKKIDGFVSFTSIC  201


 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 26/76 (34%), Positives = 43/76 (57%), Gaps = 0/76 (0%)
 Frame = +2

Query  233  QRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLAL  412
            +RK+ +  +  E +++ L S F  YGE+EE     D  TGKS+G+ ++ +K  + A  AL
Sbjct  227  KRKIRVENVPAEMSSETLLSFFEKYGEIEEGPWGFDMGTGKSRGFAYLLYKDEESAKAAL  286

Query  413  KEPSKQIDGRMTVTQL  460
             E  K +DG   V ++
Sbjct  287  AERVKFVDGFRLVCKM  302



>ref|XP_009611222.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana tomentosiformis]
Length=363

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 70/187 (37%), Positives = 109/187 (58%), Gaps = 22/187 (12%)
 Frame = +2

Query  29   MDFMKKRKLE---DNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLG  199
            M+ +KKRKL+   +NG + D +    LS+E+ R +L+   +  L +++     ++P +  
Sbjct  1    MEELKKRKLDEMANNGQI-DSNSTSSLSVEELRSLLDPLAKPHLVDLLAKIGSQYPSIAE  59

Query  200  AVRSIADQDTTQ------------RKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDK  343
             ++S+A  + +             RKLF+RGL W TT++ L + F+ +GE+EE  VI DK
Sbjct  60   EIKSVASAEQSNNKDSAASADPALRKLFVRGLAWNTTSETLCAAFTEHGEIEEGAVITDK  119

Query  344  ATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDIS  523
             TG S+GYGFIT+K ++ A +ALK PSK IDGRM V  LA  G+       S+    D +
Sbjct  120  VTGISRGYGFITYKDVESAQMALKAPSKMIDGRMAVCNLACEGL------SSTTVTADQA  173

Query  524  LRKIYVG  544
             RK+Y+G
Sbjct  174  QRKLYIG  180


 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  +TT++ L S FS +GE+EE  V  +K T  S+G+GF+T+K ++GA 
Sbjct  171  DQAQRKLYIGGLSSDTTSEMLLSFFSRHGEIEEGSVAYNKDTKTSRGFGFVTYKTVEGAK  230

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P + + GR    +LA
Sbjct  231  KALNDPQRILGGRNLTVKLA  250



>gb|AET00091.2| RNA recognition motif [Medicago truncatula]
Length=497

 Score =   130 bits (326),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE FT++QL  +V+ AV ++PD+   VR +AD D   RK+F+ GLGW+ T + L + 
Sbjct  125  EKLLEPFTKEQLHALVKQAVEKYPDLSENVRQLADVDPAHRKIFVHGLGWDATAETLTTT  184

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            FS YGE+E+   + DKA+GKSKGY FI FKH  G   ALK+P K I  R T  QLA+AG
Sbjct  185  FSKYGEIEDCKAVTDKASGKSKGYAFILFKHRTGCRRALKQPQKVIGNRTTSCQLASAG  243


 Score = 60.8 bits (146),  Expect = 8e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   F  +GE+++  + LDKATGK KG+    +K ++ A 
Sbjct  257  EYTQRKIFVSNVSSDIDPQKLLEFFKQFGEVDDGPLGLDKATGKPKGFALFVYKTVESAK  316

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP+K  +G     Q A  G
Sbjct  317  KALEEPNKVFEGHTLYCQKAVDG  339



>ref|XP_009773671.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana sylvestris]
 ref|XP_009773673.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana sylvestris]
 ref|XP_009773674.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana sylvestris]
 ref|XP_009773675.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana sylvestris]
 ref|XP_009773676.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana sylvestris]
Length=487

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE FT+DQL  +++ A+V +P++   ++ +AD+D   RK+F+ GLGW+TT + L S+F
Sbjct  118  KLLEPFTKDQLTALIKEALVTYPNLKDNIQKLADKDPAHRKIFVHGLGWDTTAETLTSVF  177

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQL  460
              YGE+E+   + DK +GKSKGYGFI FKH  GA  AL+EP K+I  RMT  QL
Sbjct  178  GKYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGARKALREPQKKIGTRMTSCQL  231


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   FS +GE+EE  + LDK TGK KG+    +K ++ A 
Sbjct  252  EYTQRKIFVSNVAADLDPQKLLEFFSKFGEVEEGPLGLDKQTGKPKGFCLFVYKSVESAR  311

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  312  KALEEPHKSFEGHTLHCQKAVDG  334



>ref|XP_003617132.1| Heterogeneous nuclear ribonucleoprotein D0 [Medicago truncatula]
Length=523

 Score =   130 bits (326),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE FT++QL  +V+ AV ++PD+   VR +AD D   RK+F+ GLGW+ T + L + 
Sbjct  125  EKLLEPFTKEQLHALVKQAVEKYPDLSENVRQLADVDPAHRKIFVHGLGWDATAETLTTT  184

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            FS YGE+E+   + DKA+GKSKGY FI FKH  G   ALK+P K I  R T  QLA+AG
Sbjct  185  FSKYGEIEDCKAVTDKASGKSKGYAFILFKHRTGCRRALKQPQKVIGNRTTSCQLASAG  243


 Score = 61.6 bits (148),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 47/83 (57%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   F  +GE+++  + LDKATGK KG+    +K ++ A 
Sbjct  257  EYTQRKIFVSNVSSDIDPQKLLEFFKQFGEVDDGPLGLDKATGKPKGFALFVYKTVESAK  316

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP+K  +G     Q A  G
Sbjct  317  KALEEPNKVFEGHTLYCQKAVDG  339



>ref|XP_009622309.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana tomentosiformis]
 ref|XP_009622310.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana tomentosiformis]
 ref|XP_009622311.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana tomentosiformis]
 ref|XP_009622312.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana tomentosiformis]
 ref|XP_009622313.1| PREDICTED: UBP1-associated protein 2B-like [Nicotiana tomentosiformis]
Length=489

 Score =   129 bits (324),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 57/114 (50%), Positives = 81/114 (71%), Gaps = 0/114 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE FT+DQL  +++ A+V +P++   ++ +AD+D   RK+F+ GLGW+TT + L S+F
Sbjct  120  KLLEPFTKDQLTALIKEALVTYPNLKDNIQRLADKDPAHRKIFVHGLGWDTTAETLTSVF  179

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQL  460
              YGE+E+   + DK +GKSKGYGFI FKH  GA  AL+EP K+I  RMT  QL
Sbjct  180  GKYGEIEDCKAVTDKVSGKSKGYGFILFKHRSGARKALREPQKKIGTRMTSCQL  233


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  +    KL   FS +GE+EE  + LDK TGK KG+    +K ++ A 
Sbjct  254  EYTQRKIFVSNVATDLDPQKLLEFFSKFGEVEEGPLGLDKQTGKPKGFCLFVYKSVESAR  313

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G     Q A  G
Sbjct  314  RALEEPHKSFEGHTLHCQKAVDG  336



>gb|KJB20258.1| hypothetical protein B456_003G140900 [Gossypium raimondii]
Length=499

 Score =   129 bits (325),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   KILE F +DQL  +++ AV  HPD + +VR  AD D   RK+F+ GL W+TT + L
Sbjct  120  EPVEKILEPFAKDQLITLIKKAVENHPDFISSVREFADADPAHRKIFVHGLSWDTTAETL  179

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
             + FS YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P K+I  R T  QLA
Sbjct  180  TAEFSKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQPQKKIGIRTTSCQLA  238


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E   + L   F  YGE+EE  + LDK TGK KG+    ++ ++ A 
Sbjct  255  EYTQRKIFVSNVSPELDPEHLLEFFKQYGEIEEGPMGLDKQTGKPKGFALFVYRSVESAK  314

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K   G +   Q A  G
Sbjct  315  KALEEPHKNFQGHVLHCQKAIDG  337



>ref|XP_011041306.1| PREDICTED: UBP1-associated protein 2A-like [Populus euphratica]
Length=474

 Score =   129 bits (324),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 69/151 (46%), Positives = 91/151 (60%), Gaps = 10/151 (7%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F +DQL  +++ A   H DV   +R +ADQD   RK+F+ GLGW+T  + L + F
Sbjct  94   KLLEPFGKDQLINLLREAADAHRDVAEKIRQVADQDPVHRKIFVHGLGWDTNAEALMNAF  153

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA-----  463
              YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA     
Sbjct  154  KPYGEIEDCKAVCDKVSGKSKGYGFILFKRRSGARKALKEPQKKIGNRMTACQLASIGPV  213

Query  464  --AAGMQggpgggssnnpVDIS---LRKIYV  541
              ++G Q GP   ++     +S   LRKIYV
Sbjct  214  PQSSGGQVGPVAAAAQAQQPVSEYTLRKIYV  244


 Score = 67.0 bits (162),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +  +    KL S FS +GE+EE  + LDKATGK KG+    +K  +GA 
Sbjct  236  EYTLRKIYVSNVAADLDPQKLYSFFSEFGEIEEGPLGLDKATGKPKGFCLFVYKSAEGAK  295

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G M   Q A
Sbjct  296  KALEEPHKSFEGHMLHCQKA  315



>gb|KHG29236.1| Heterogeneous nuclear ribonucleoprotein D0 [Gossypium arboreum]
Length=507

 Score =   129 bits (324),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 63/137 (46%), Positives = 85/137 (62%), Gaps = 0/137 (0%)
 Frame = +2

Query  62   NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRK  241
            NG     S    L  E   K+LE F +DQL  +++ AV +HP+ +  VR +AD D  QRK
Sbjct  106  NGAPKGTSQDEELDDEPFEKLLEPFGKDQLITLIKKAVDKHPEFISLVRELADVDPAQRK  165

Query  242  LFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEP  421
            +F+ GL W+TT + L + F+ YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P
Sbjct  166  IFVHGLSWDTTAETLTAEFAKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQP  225

Query  422  SKQIDGRMTVTQLAAAG  472
             K+I  R T  QLA+ G
Sbjct  226  QKKIGNRTTSCQLASQG  242


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E   +KL   F  +GE+EE  + LDK TGK KG+    ++ I+ A 
Sbjct  256  EYTQRKIFVSNVSAEMDPEKLLEFFKQFGEIEEGPLGLDKHTGKPKGFALFVYRSIESAR  315

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  316  KALEEPHKNFEGHVLHCQKA  335



>ref|XP_002878114.1| hypothetical protein ARALYDRAFT_486125 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54373.1| hypothetical protein ARALYDRAFT_486125 [Arabidopsis lyrata subsp. 
lyrata]
Length=477

 Score =   129 bits (323),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 81/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F+++QL  +++ A  +HPDV   +R +AD+D   RK+F+ GLGW+T T+ L
Sbjct  98   EPIQDLLEPFSKEQLLSLLKEAAEKHPDVANRIREVADEDPVHRKIFVHGLGWDTKTETL  157

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI +K   GA  ALK+P K+I  RMT  QLA+
Sbjct  158  IEAFKQYGEIEDCKAVFDKISGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLAS  217

Query  467  AG  472
             G
Sbjct  218  KG  219


 Score = 62.0 bits (149),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            ++ + TQ+K+++  +G E    KL   FS +GE+EE  + LDK TG+ KG+    +K  +
Sbjct  239  SNSEHTQKKIYVSNVGAELDPQKLLGFFSKFGEIEEGPLGLDKFTGRPKGFCLFVYKSAE  298

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  AL+EP K  +G +   Q A
Sbjct  299  SAKRALEEPHKTFEGHILHCQKA  321



>ref|XP_008801015.1| PREDICTED: UBP1-associated protein 2B-like [Phoenix dactylifera]
Length=491

 Score =   128 bits (322),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 57/118 (48%), Positives = 82/118 (69%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE  +++QL  ++++A    P  L  +  +AD D   RKLF+ GLGW+TT+D LR+ F
Sbjct  61   KLLEPLSKEQLISLLRSAAASDPATLAEIHRLADLDPAHRKLFVHGLGWDTTSDGLRAAF  120

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            + YGE+E+  V++DKA+G+SKGYGF+ F+H   A  AL +P K ID RMT  QLA+AG
Sbjct  121  ARYGEIEDCRVVVDKASGRSKGYGFLLFRHRRSARRALCQPQKLIDNRMTACQLASAG  178


 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/81 (36%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            QD   RK+++  +       +L + FS YGE+EE  +  D+ TGK KG+    +K ++GA
Sbjct  209  QDNLPRKIYVGNVHSNVDGARLHAFFSKYGEIEEGPIGFDRQTGKPKGFALFVYKTVEGA  268

Query  401  LLALKEPSKQIDGRMTVTQLA  463
              AL+EP+K  +G +   Q A
Sbjct  269  RRALEEPNKNFEGHLLYCQKA  289



>dbj|BAE71253.1| hypothetical protein [Trifolium pratense]
Length=414

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K++E FT++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  16   EPIQKLIEPFTKEQIASLLCEAASKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  75

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  76   INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKRRSGARNALKEPQKKIGNRMTACQLAS  135

Query  467  AG  472
             G
Sbjct  136  IG  137


 Score = 63.9 bits (154),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G +    KL   FS +GE+EE  + LDK TGK KG+    +K  + A 
Sbjct  155  EYTQRKIYVSNVGPDLDGSKLFGFFSRFGEIEEGPLGLDKVTGKPKGFCLFVYKSAESAR  214

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K+ +G +   Q A  G
Sbjct  215  RALEEPHKEFEGHILHCQRAIDG  237



>gb|KJB26171.1| hypothetical protein B456_004G228200 [Gossypium raimondii]
Length=482

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 81/125 (65%), Gaps = 0/125 (0%)
 Frame = +2

Query  98   LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTT  277
            L  E   K+LE F +DQL  +++ AV +HP+ + +VR  AD D + RK+F+ GL W+TT 
Sbjct  101  LDDEPFEKLLEPFGKDQLITLIRRAVDKHPEFISSVREFADADPSHRKIFVHGLSWDTTA  160

Query  278  DKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQ  457
            + L + F  YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P K+I  R T  Q
Sbjct  161  ETLTAEFCKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQPQKKIGNRTTSCQ  220

Query  458  LAAAG  472
            LA+ G
Sbjct  221  LASQG  225


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +  +   +KL   F  YGE+EE  + LDK TGK KG+    ++ ++ A  A
Sbjct  241  TQRKIFVSNVSADLDPEKLLEFFKQYGEVEEGPLGLDKQTGKPKGFALFVYRSVESARKA  300

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G +   Q A  G
Sbjct  301  LEEPHKNFEGHVLHCQKAIDG  321



>gb|ABD28657.1| RNA-binding region RNP-1 (RNA recognition motif) [Medicago truncatula]
 gb|AES81055.2| RNA recognition motif [Medicago truncatula]
Length=490

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K+LE F+++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  84   EPIQKLLEPFSKEQISSLLCEAASKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  143

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  144  INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKRRSGARNALKEPQKKIGNRMTACQLAS  203

Query  467  AG  472
             G
Sbjct  204  IG  205


 Score = 67.4 bits (163),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK++I  +G E    KL   FS +GE+EE  + LDK TGK KG+    +K  + A 
Sbjct  226  EYTQRKIYISNVGPELDAQKLFGFFSRFGEIEEGPLGLDKVTGKPKGFCLFVYKSAESAR  285

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K+ +G +   Q A  G
Sbjct  286  RALEEPHKEFEGHILHCQKAIDG  308



>ref|XP_010108566.1| Uncharacterized RNA-binding protein [Morus notabilis]
 gb|EXC19709.1| Uncharacterized RNA-binding protein [Morus notabilis]
Length=483

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/146 (44%), Positives = 90/146 (62%), Gaps = 1/146 (1%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   K+LE F ++QL  I++ A  +H DV   ++ IA++D   RK+F+ GLGW+TT + L
Sbjct  113  EPIEKLLEPFGKEQLAYILREAAEKHRDVAHRIKEIAEEDPAHRKIFVYGLGWDTTAETL  172

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  YG++E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT +QLA+
Sbjct  173  TSVFKEYGDIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTSSQLAS  232

Query  467  AG-MQggpgggssnnpVDISLRKIYV  541
             G +             + + RKIYV
Sbjct  233  VGVVPAAASAQPQGPSSEYTQRKIYV  258


 Score = 75.9 bits (185),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 60/119 (50%), Gaps = 5/119 (4%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +KI    T  QL  +    VV  P    A       + TQRK+++  +G E    KL
Sbjct  216  EPQKKIGNRMTSSQLASV---GVV--PAAASAQPQGPSSEYTQRKIYVSNVGAELDPQKL  270

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
               FS YGE+EE  + LDKATG+ KG+    +K +DGA  AL EP K  +G +   Q A
Sbjct  271  TVFFSKYGEIEEGPLGLDKATGRPKGFCLFVYKTVDGARKALAEPHKNFEGNILHCQKA  329



>gb|AEW09371.1| hypothetical protein UMN_7377_01, partial [Pinus radiata]
 gb|AFG51194.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51195.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51196.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51197.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51198.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51199.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51200.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51201.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51202.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51203.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51204.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51205.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51206.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51207.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51208.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51209.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
 gb|AFG51210.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
Length=137

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+L  F+++QL +I+     + P ++  +R +AD+D   RK+F+RGLGW+TT++ L+S+
Sbjct  44   KKLLGPFSKEQLIDIISENAKKDPQLVENIRKLADKDPAHRKIFVRGLGWDTTSEALKSV  103

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            FS YGELEE  VI+DK TGKSKGYGF+TFKH+DG
Sbjct  104  FSQYGELEECTVIVDKGTGKSKGYGFVTFKHMDG  137



>gb|AAM73765.1|AF403292_1 RNA-binding protein AKIP1 [Vicia faba]
Length=515

 Score =   128 bits (322),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + ++E FT++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  108  EPIKDLVEPFTKEQIATLLCEAAAKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  167

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DKA+GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  168  INAFSQYGEIEDCKAVTDKASGKSKGYGFILFKKRSGARNALKEPQKKIGNRMTACQLAS  227

Query  467  AG  472
             G
Sbjct  228  IG  229


 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 64/123 (52%), Gaps = 5/123 (4%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSI-ADQDTTQRKLFIRGLGWETTTDK  283
            E  +KI    T  QL  I   A    P    AV+ +    + TQRK++I  +G E    K
Sbjct  211  EPQKKIGNRMTACQLASIGPVAQTPQP----AVQLVQPGSEYTQRKIYISNVGPELDPHK  266

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L + FS +GE+EE  + LDKATGK KG+    +K  + A  +L+EP K+ +G +   Q A
Sbjct  267  LFAYFSRFGEIEEGPLGLDKATGKPKGFCLFVYKSAESARRSLEEPHKEFEGHILHCQRA  326

Query  464  AAG  472
              G
Sbjct  327  IDG  329



>dbj|BAE71267.1| hypothetical protein [Trifolium pratense]
Length=482

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K++E FT++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  84   EPIQKLIEPFTKEQIASLLCEAASKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  143

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  144  INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKRRSGARNALKEPQKKIGNRMTACQLAS  203

Query  467  AG  472
             G
Sbjct  204  IG  205


 Score = 64.3 bits (155),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 62/124 (50%), Gaps = 7/124 (6%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDT--TQRKLFIRGLGWETTTD  280
            E  +KI    T  QL  I    V + P     V  +  Q +  TQRK+++  +G +    
Sbjct  187  EPQKKIGNRMTACQLASI--GPVQQTPQ---PVPQLVPQGSEYTQRKIYVSNVGPDLDGS  241

Query  281  KLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQL  460
            KL   FS +GE+EE  + LDK TGK KG+    +K  + A  AL+EP K+ +G +   Q 
Sbjct  242  KLFGFFSRFGEIEEGPLGLDKVTGKPKGFCLFVYKSAESARRALEEPHKEFEGHILHCQR  301

Query  461  AAAG  472
            A  G
Sbjct  302  AIDG  305



>gb|KHG10711.1| Heterogeneous nuclear ribonucleoprotein A/B [Gossypium arboreum]
Length=497

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 77/119 (65%), Gaps = 0/119 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E   K+LE F +DQL  +++ AV  HPD + +VR  AD D   RK+F+ GL W+TT + L
Sbjct  117  EPVEKLLEPFAKDQLITLIKKAVENHPDFISSVREFADADPAHRKIFVHGLSWDTTAETL  176

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
             + FS YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P K+I  R T  QLA
Sbjct  177  TAEFSKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQPQKKIGIRTTSCQLA  235


 Score = 63.5 bits (153),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 32/83 (39%), Positives = 44/83 (53%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E     L   F  YGE+EE  + LDK TGK KG+    ++ +D A 
Sbjct  252  EYTQRKIFVSNVSPELDPGHLLEFFKQYGEIEEGPMGLDKQTGKPKGFALFVYRSVDSAK  311

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K   G +   Q A  G
Sbjct  312  KALEEPHKNFQGHVLHCQKAIDG  334



>gb|AFG51193.1| hypothetical protein UMN_7377_01, partial [Pinus taeda]
Length=137

 Score =   121 bits (304),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 50/94 (53%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +K+L  F+++QL +I+     + P ++  +R +AD+D   RK+F+RGLGW+TT++ L+S+
Sbjct  44   KKLLGPFSKEQLIDIISENAKKDPQLVENIRKLADKDPAHRKIFVRGLGWDTTSETLKSV  103

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDG  397
            FS YGELEE  VI+DK TGKSKGYGF+TFKH+DG
Sbjct  104  FSQYGELEECTVIVDKGTGKSKGYGFVTFKHMDG  137



>ref|XP_003624837.1| RNA-binding protein [Medicago truncatula]
Length=499

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K+LE F+++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  84   EPIQKLLEPFSKEQISSLLCEAASKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  143

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  144  INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKRRSGARNALKEPQKKIGNRMTACQLAS  203

Query  467  AG  472
             G
Sbjct  204  IG  205


 Score = 67.4 bits (163),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK++I  +G E    KL   FS +GE+EE  + LDK TGK KG+    +K  + A 
Sbjct  226  EYTQRKIYISNVGPELDAQKLFGFFSRFGEIEEGPLGLDKVTGKPKGFCLFVYKSAESAR  285

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K+ +G +   Q A  G
Sbjct  286  RALEEPHKEFEGHILHCQKAIDG  308



>ref|XP_011033238.1| PREDICTED: UBP1-associated protein 2C-like [Populus euphratica]
Length=341

 Score =   126 bits (317),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 64/172 (37%), Positives = 102/172 (59%), Gaps = 8/172 (5%)
 Frame = +2

Query  29   MDFMKKRKLEDNGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVR  208
            M+ MKKRK+++    ++ S     + +  R +L+   + QL +++     ++P +   ++
Sbjct  1    MEDMKKRKMDEGS--NNGSGETSTTQDYLRSLLDPLNKSQLVDLLSRLGSQYPSIAEEIK  58

Query  209  SIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKH  388
             +A  D   RKLF+RGL W TT++ L + F  +GE+EE  VI DK TGKS+GYGFIT+KH
Sbjct  59   GLASADPVHRKLFVRGLAWNTTSETLCAAFQMHGEIEEGAVIYDKVTGKSRGYGFITYKH  118

Query  389  IDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            ++ A  AL  PS+ ID RM V  LA  G+        ++   D++ RK+Y+G
Sbjct  119  MESAQSALGAPSRLIDSRMAVCNLACEGL------TGASTTPDLAQRKLYIG  164


 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 51/80 (64%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  E +++ L + F  YG++EE  V  DK T +S+G+GF+T+K ++ + 
Sbjct  155  DLAQRKLYIGGLSPEISSEMLLNFFGRYGDIEEGSVAYDKDTNESRGFGFVTYKTVEASK  214

Query  404  LALKEPSKQIDGRMTVTQLA  463
             A+ +P K   GR  + +LA
Sbjct  215  KAIDDPHKLFGGRTIIVKLA  234



>ref|XP_003624838.1| RNA-binding protein [Medicago truncatula]
 gb|AES81056.1| RNA recognition motif [Medicago truncatula]
Length=492

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 60/122 (49%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K+LE F+++Q+  ++  A  +H DV   +R IAD D + RK+F+ GLGW+TT+  L
Sbjct  84   EPIQKLLEPFSKEQISSLLCEAASKHRDVADRIRKIADGDASHRKIFVHGLGWDTTSATL  143

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + FS YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  144  INAFSQYGEIEDCKAVTDKVSGKSKGYGFILFKRRSGARNALKEPQKKIGNRMTACQLAS  203

Query  467  AG  472
             G
Sbjct  204  IG  205


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK++I  +G E    KL   FS +GE+EE  + LDK TGK KG+    +K  + A 
Sbjct  226  EYTQRKIYISNVGPELDAQKLFGFFSRFGEIEEGPLGLDKVTGKPKGFCLFVYKSAESAR  285

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K+ +G +   Q A  G
Sbjct  286  RALEEPHKEFEGHILHCQKAIDG  308



>ref|XP_001782704.1| predicted protein [Physcomitrella patens]
 gb|EDQ52469.1| predicted protein, partial [Physcomitrella patens]
Length=84

 Score =   120 bits (300),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 54/84 (64%), Positives = 65/84 (77%), Gaps = 0/84 (0%)
 Frame = +2

Query  221  QDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGA  400
            +D   RKLF+RGL WET++  LR  F  YGE+EEA VI DK TGKS+G+GF+TFKH+D A
Sbjct  1    KDPVHRKLFVRGLAWETSSVALREAFEQYGEVEEACVITDKGTGKSRGFGFVTFKHMDSA  60

Query  401  LLALKEPSKQIDGRMTVTQLAAAG  472
              ALKEPSK IDGR+TV  LA+AG
Sbjct  61   QRALKEPSKNIDGRITVCNLASAG  84



>ref|XP_004289264.1| PREDICTED: UBP1-associated protein 2B-like [Fragaria vesca subsp. 
vesca]
Length=481

 Score =   128 bits (321),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 82/122 (67%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F++DQL  +++ A   H DV   +R +AD+D   RK+F+ GLGW+TT + L
Sbjct  105  EPIQDLLEPFSKDQLVSLLKEAAESHRDVSDRIRKVADEDPIHRKIFVHGLGWDTTAETL  164

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F+ YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  165  TSVFTEYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARRALKQPQKKIGNRMTACQLAS  224

Query  467  AG  472
             G
Sbjct  225  LG  226


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 41/117 (35%), Positives = 59/117 (50%), Gaps = 1/117 (1%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLG-AVRSIADQDTTQRKLFIRGLGWETTTDKLRS  292
            +KI    T  QL  +   A    P     A +S    + TQRK+++  +G +    KL  
Sbjct  211  KKIGNRMTACQLASLGPAATPTGPGPAAVAAQSQPVSEYTQRKIYVSNVGADLDPQKLLV  270

Query  293  LFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
             FS +GE+EE  + LDKATG+ KG+    +K  + A  AL+EP K  DG +   Q A
Sbjct  271  FFSRFGEIEEGPLGLDKATGRPKGFCLFVYKSPESAKRALEEPHKNFDGHILHCQKA  327



>gb|KHG16393.1| Heterogeneous nuclear ribonucleoprotein D0 [Gossypium arboreum]
Length=484

 Score =   127 bits (320),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 59/125 (47%), Positives = 80/125 (64%), Gaps = 0/125 (0%)
 Frame = +2

Query  98   LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTT  277
            L  E   K+LE F +DQL  +++ AV +HP+ + +VR  AD D   RK+F+ GL W+TT 
Sbjct  101  LDDEPFEKLLEPFGKDQLITLIRRAVDKHPEFISSVREFADGDPAHRKIFVHGLSWDTTA  160

Query  278  DKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQ  457
            + L + F  YGE+EE   + D+ +GKSKGY FI FKH  GA  ALK+P K+I  R T  Q
Sbjct  161  ETLTAEFCKYGEIEECKAVTDRVSGKSKGYAFILFKHRSGARRALKQPQKKIGNRTTSCQ  220

Query  458  LAAAG  472
            LA+ G
Sbjct  221  LASQG  225


 Score = 63.9 bits (154),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 46/81 (57%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +  +   +KL   F  YGE+EE  + LDK TGK KG+    ++ ++ A  A
Sbjct  241  TQRKIFVSNVSADLDPEKLLEFFKQYGEVEEGPMGLDKQTGKPKGFALFVYRSVESARKA  300

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G +   Q A  G
Sbjct  301  LEEPHKNFEGHVLHCQKAIDG  321



>ref|XP_002307930.1| RNA recognition motif-containing family protein [Populus trichocarpa]
 gb|EEE91453.1| RNA recognition motif-containing family protein [Populus trichocarpa]
Length=474

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F +DQL  +++ A   H DV   +R +ADQD   RK+F+ GLGW+T  + L + F
Sbjct  91   KLLEPFGKDQLINLLREAADGHRDVADKIRQVADQDPVHRKIFVHGLGWDTNAEALINAF  150

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK TGKSKGYGFI FK   GA  ALKEP K+I  RM   QLA+ G
Sbjct  151  KPYGEIEDCKAVCDKVTGKSKGYGFILFKKRSGARNALKEPQKKIGNRMAACQLASTG  208


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +G      KL S FS +GE+EE  + LDKATGK KG+    +K ++ A 
Sbjct  233  EYTLRKIYVSNVGANLDPQKLMSFFSEFGEIEEGPLGLDKATGKPKGFCLFVYKTVESAK  292

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  293  KALEEPHKSFEGHILHCQKAVDG  315



>ref|XP_010554751.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
Length=484

 Score =   127 bits (320),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F++DQL  ++++A  +HPDV   +R +AD D   RK+F+ GLGW+T  D L
Sbjct  106  EPIQDLLEPFSKDQLVILLKDAAEKHPDVANRIRKVADADPVHRKIFVHGLGWDTKADAL  165

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+  V+ DK +GKSKGYGFI FK   G   ALK+P K+I  RMT  QLA+
Sbjct  166  IEAFKQYGEIEDCKVVADKISGKSKGYGFILFKSRSGTRNALKQPQKKIGNRMTACQLAS  225

Query  467  AG  472
             G
Sbjct  226  VG  227


 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/80 (41%), Positives = 47/80 (59%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G E    KL + FS YGE+EE  + LDK TG+ KG+    +K   GA 
Sbjct  248  EYTQRKIYVSNVGAELDPQKLMAFFSRYGEIEEGPLGLDKVTGRPKGFCLFVYKSPKGAK  307

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  308  KALEEPHKNFEGHVLHCQKA  327



>ref|XP_009419696.1| PREDICTED: UBP1-associated protein 2A-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419697.1| PREDICTED: UBP1-associated protein 2A-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419698.1| PREDICTED: UBP1-associated protein 2A-like [Musa acuminata subsp. 
malaccensis]
 ref|XP_009419699.1| PREDICTED: UBP1-associated protein 2A-like [Musa acuminata subsp. 
malaccensis]
Length=453

 Score =   127 bits (319),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 65/148 (44%), Positives = 93/148 (63%), Gaps = 5/148 (3%)
 Frame = +2

Query  98   LSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTT  277
            L  E  RK+LE F +DQL E+++ A +R+P +L  + S AD D   RK+F+ GLGW+ TT
Sbjct  86   LDRESIRKLLEPFGKDQLIELLKEAALRNPSLLSQIASAADSDPVHRKIFVHGLGWDATT  145

Query  278  DKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQ  457
            + L + F+TYG ++E  V+ D+ATG+ KGYGF+ F+    A  AL EP K+I  RMT  Q
Sbjct  146  EVLAAAFTTYGVIDECKVVTDRATGRCKGYGFVLFRTRAAAQRALLEPQKKIGNRMTSCQ  205

Query  458  LAAAGMQggpgggssnnpVDISLRKIYV  541
            LA+ G  G  G        +++ RKI+V
Sbjct  206  LASFGPPGAQGPAP-----EVTGRKIFV  228


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 40/128 (31%), Positives = 61/128 (48%), Gaps = 11/128 (9%)
 Frame = +2

Query  95   RLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETT  274
            R  LE  +KI    T  QL      A    P   G        + T RK+F+  +G    
Sbjct  188  RALLEPQKKIGNRMTSCQL------ASFGPPGAQGPA-----PEVTGRKIFVSNIGEHVN  236

Query  275  TDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVT  454
             ++LR+ F+ +GE+EE  +  DK TGK +G+    +K ++G   AL+EP K  +G     
Sbjct  237  PERLRAFFAKFGEIEEGPLGYDKTTGKLRGFAIFVYKTVEGCRKALEEPKKFFEGCELSC  296

Query  455  QLAAAGMQ  478
            Q A  G++
Sbjct  297  QRAVEGLK  304



>gb|KHN38428.1| Putative RNA-binding protein [Glycine soja]
Length=496

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE FT++QL  +V  AV   P+ + +VR IAD D   RK+F+ GLGW+ T + L S+
Sbjct  131  EKLLEPFTKEQLHSLVTQAVDMFPEFVDSVRRIADVDPAHRKIFVHGLGWDATAETLTSV  190

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DK +GKSKGY FI FKH D A  ALK P K+I  R T  QLA+AG
Sbjct  191  FGKYGEIEDCKAVTDKVSGKSKGYAFILFKHRDDARKALKHPQKKIGNRTTSCQLASAG  249


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E    KL   F  +GE+E+  + LDK TGK KG+    +K ++ A 
Sbjct  263  EYTQRKIFVSNVSAEIDPQKLLEFFKQFGEVEDGPLGLDKNTGKPKGFALFVYKSVESAK  322

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP+K  +G     Q A  G
Sbjct  323  KALEEPNKNYEGHTLYCQKAVDG  345



>ref|XP_006575610.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like 
isoform X1 [Glycine max]
 ref|XP_006575611.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like 
isoform X2 [Glycine max]
Length=496

 Score =   127 bits (319),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE FT++QL  +V  AV   P+ + +VR IAD D   RK+F+ GLGW+ T + L S+
Sbjct  131  EKLLEPFTKEQLHSLVTQAVDMFPEFVDSVRRIADVDPAHRKIFVHGLGWDATAETLTSV  190

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DK +GKSKGY FI FKH D A  ALK P K+I  R T  QLA+AG
Sbjct  191  FGKYGEIEDCKAVTDKVSGKSKGYAFILFKHRDDARKALKHPQKKIGNRTTSCQLASAG  249


 Score = 65.1 bits (157),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 46/83 (55%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +  E    KL   F  +GE+E+  + LDK TGK KG+    +K ++ A 
Sbjct  263  EYTQRKIFVSNVSAEIDPQKLLEFFKQFGEVEDGPLGLDKNTGKPKGFALFVYKSVESAK  322

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP+K  +G     Q A  G
Sbjct  323  KALEEPNKNYEGHTLYCQKAVDG  345



>ref|XP_007205101.1| hypothetical protein PRUPE_ppa004648mg [Prunus persica]
 gb|EMJ06300.1| hypothetical protein PRUPE_ppa004648mg [Prunus persica]
Length=498

 Score =   127 bits (319),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F++DQL  +++ A   H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  109  EPIQNLLEPFSKDQLIALLREAADTHGDVSDRIRKVADEDPIHRKIFVHGLGWDTNAETL  168

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLAA
Sbjct  169  TSVFKEYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKQPQKKIGNRMTACQLAA  228

Query  467  AG  472
             G
Sbjct  229  IG  230


 Score = 62.8 bits (151),  Expect = 2e-08, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 45/78 (58%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+++  +G +    KL   FS +GE+EE  + LDK TG+ KG+    +K  + A  A
Sbjct  257  TQRKIYVSNVGADLEPQKLLMFFSRFGEIEEGPLGLDKMTGRPKGFCLFVYKSPESAKRA  316

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP K  DG +   Q A
Sbjct  317  LEEPHKNFDGHILHCQKA  334



>gb|KDO57339.1| hypothetical protein CISIN_1g011975mg [Citrus sinensis]
Length=393

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE F++DQL  +++ A   H DV   VR +AD+D   RK+F+ GLGW+T  + L   F 
Sbjct  93   LLEPFSKDQLVNLLREAAENHRDVASRVRQVADEDPVHRKIFVHGLGWDTKAETLIDAFK  152

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+ G
Sbjct  153  QYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTACQLASIG  209


 Score = 74.3 bits (181),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL + FS YGE+EE  + +DKATGK KG+    +K +D A 
Sbjct  244  EYTQRKIFVSNVGSELEPQKLLAFFSKYGEIEEGPLGIDKATGKPKGFCLFVYKTVDAAK  303

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  304  KALEEPHKNFEGHILNCQRAIDG  326



>ref|XP_006836157.1| hypothetical protein AMTR_s00101p00040700 [Amborella trichopoda]
 gb|ERM99010.1| hypothetical protein AMTR_s00101p00040700 [Amborella trichopoda]
Length=441

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 60/145 (41%), Positives = 92/145 (63%), Gaps = 5/145 (3%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  +K+LE F +DQL +I++   V++P  +  +   A+ D + RK+F+ GLGW+ T + L
Sbjct  81   EKVKKLLEPFGKDQLVDILREISVKNPSFISKINKAAEHDPSHRKIFVHGLGWDATNEAL  140

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  +G +E+  V+ DK TG++KGYGFI FKH  GA  ALK+P K+I  R+T  QLA+
Sbjct  141  ISIFKKFGTIEDCKVVSDKLTGRAKGYGFILFKHRSGARKALKQPQKKIGNRLTSCQLAS  200

Query  467  AGMQggpgggssnnpVDISLRKIYV  541
            AG        + +   D++ +KIYV
Sbjct  201  AG-----PVPTQHPGPDLTGKKIYV  220


 Score = 60.1 bits (144),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/85 (34%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D T +K+++  +  + T  KL + FS +GE+EE  + LDK TGK +G+    +K  +   
Sbjct  212  DLTGKKIYVSNVASDITPQKLYAFFSRFGEIEEGPLGLDKVTGKPRGFAIFVYKSPESVK  271

Query  404  LALKEPSKQIDGRMTVTQLAAAGMQ  478
              L+EP K  +G     Q A  GM+
Sbjct  272  KVLEEPFKNFEGHNLHCQKAVEGMK  296



>ref|XP_010542227.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
 ref|XP_010542300.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
 ref|XP_010542366.1| PREDICTED: UBP1-associated protein 2A-like [Tarenaya hassleriana]
Length=480

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 58/122 (48%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E    +LE F++DQL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T  D L
Sbjct  107  EPIENLLEPFSKDQLVSLLKKAAEKHSDVANKIRKVADEDPVHRKIFVHGLGWDTKADTL  166

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   ++DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  167  IEAFKQYGEIEDCKAVVDKISGKSKGYGFILFKSRSGARNALKQPQKKIGSRMTACQLAS  226

Query  467  AG  472
             G
Sbjct  227  IG  228


 Score = 67.4 bits (163),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 32/80 (40%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G E    KL + FS+YGE+EE  + LDK TG+ KG+    +K  + A 
Sbjct  249  EHTQRKIYVSNVGAELDPQKLFAFFSSYGEIEEGPLGLDKVTGRPKGFCLFVYKSPESAR  308

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  309  KALEEPHKNFEGHVLHCQRA  328



>ref|XP_011040665.1| PREDICTED: UBP1-associated protein 2B-like [Populus euphratica]
Length=472

 Score =   127 bits (318),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 59/118 (50%), Positives = 76/118 (64%), Gaps = 0/118 (0%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F +DQL  +++ A   H DV   +R +ADQD   RK+F+ GLGW+T  + L + F
Sbjct  89   KLLEPFGKDQLINLLREAADGHLDVADKIRQVADQDPVHRKIFVHGLGWDTNAEALVNAF  148

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
              YGE+E+   + DK TGKSKGYGFI FK   GA  ALKEP K+I  RM   QLA+ G
Sbjct  149  KPYGEIEDCKAVCDKVTGKSKGYGFILFKKRSGARKALKEPQKKIGNRMAACQLASIG  206


 Score = 65.5 bits (158),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + T RK+++  +G      KL S FS +GE+EE  + LDKATGK KG+    +K ++ A 
Sbjct  231  EYTLRKIYVSNVGANLDPQKLMSFFSEFGEIEEGPLGLDKATGKPKGFCLFVYKTVESAK  290

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  291  KALEEPHKSFEGHILHCQKAVDG  313



>ref|XP_003545465.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like 
isoform X1 [Glycine max]
 ref|XP_006595801.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like 
isoform X2 [Glycine max]
 ref|XP_006595802.1| PREDICTED: nuclear polyadenylated RNA-binding protein 4-like 
isoform X3 [Glycine max]
Length=494

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 78/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             K+LE FT++QL  +V  AV   P+ + +VR +AD D   RK+F+ GLGW+ T D L ++
Sbjct  130  EKLLEPFTKEQLHSLVTQAVDMFPEFVDSVRRLADVDPAHRKIFVHGLGWDATADTLTAV  189

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DK +GKSKGY FI FKH D A  ALK P K+I  R T  QLA+AG
Sbjct  190  FGKYGEIEDCKAVTDKVSGKSKGYAFILFKHRDDARKALKHPQKKIGNRTTSCQLASAG  248


 Score = 64.7 bits (156),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 44/81 (54%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +  E    KL   F  +GE+E+  + LDK TGK KG+    +K ++ A  A
Sbjct  264  TQRKIFVSNVNAEIDPQKLLEFFKQFGEVEDGPLGLDKNTGKPKGFALFVYKSVESAKKA  323

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G     Q A  G
Sbjct  324  LEEPHKNYEGHTLYCQKAVDG  344



>ref|XP_008245997.1| PREDICTED: UBP1-associated protein 2A-like [Prunus mume]
Length=469

 Score =   126 bits (317),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 58/119 (49%), Positives = 79/119 (66%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +LE F++DQL  +++ A   H DV   +R +AD+D   RK+F+ GLGW+T  + L S+
Sbjct  83   QNLLEPFSKDQLIALLREAADTHGDVSDRIRKVADEDPIHRKIFVHGLGWDTNAETLTSV  142

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLAA G
Sbjct  143  FKEYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKQPQKKIGNRMTACQLAAIG  201


 Score = 61.2 bits (147),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G +    KL   FS +GE+EE  + LDK TG+ KG+    +K  + A 
Sbjct  226  EYTQRKIYVSNVGADLEPQKLLMFFSRFGEIEEGPLGLDKMTGRPKGFCLFVYKSPESAK  285

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  286  RALEEPHKNFEGHILHCQKA  305



>ref|XP_009116386.1| PREDICTED: UBP1-associated protein 2A [Brassica rapa]
 ref|XP_009116387.1| PREDICTED: UBP1-associated protein 2A [Brassica rapa]
Length=449

 Score =   126 bits (316),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F+++QL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T T+ L
Sbjct  74   EPIQDLLEPFSKEQLLNLLKEAAEKHHDVANRIREVADEDPVHRKIFVHGLGWDTKTETL  133

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  134  IEAFKEYGEIEDCKAVFDKVSGKSKGYGFILFKSRSGARNALKQPQKKIGSRMTACQLAS  193

Query  467  AG  472
             G
Sbjct  194  KG  195


 Score = 63.9 bits (154),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            ++ + TQ+K+++  +G E    KL + FS +GE+EE  + LDK TG+ KG+    +K  +
Sbjct  217  SNSEHTQKKIYVSNVGAELDPQKLLAFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSAE  276

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  AL+EP K  +G +   Q A
Sbjct  277  SAKKALEEPHKSFEGHILHCQKA  299



>emb|CDX72106.1| BnaC08g27680D [Brassica napus]
Length=455

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F+++QL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T T+ L
Sbjct  80   EPIQDLLEPFSKEQLLNLLKEAAEKHHDVANRIREVADEDPVHRKIFVHGLGWDTKTETL  139

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  140  IEAFKEYGEIEDCKAVFDKVSGKSKGYGFILFKSRSGARNALKQPQKKIGSRMTACQLAS  199

Query  467  AG  472
             G
Sbjct  200  KG  201


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            ++ + TQ+K+++  +G E    KL + FS +GE+EE  + LDK TG+ KG+    +K  +
Sbjct  223  SNSEHTQKKIYVSNVGAELDPQKLLAFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSAE  282

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  AL+EP K  +G +   Q A
Sbjct  283  SAKKALEEPHKSFEGHILHCQKA  305



>ref|XP_009800639.1| PREDICTED: UBP1-associated protein 2C-like [Nicotiana sylvestris]
Length=363

 Score =   125 bits (314),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 72/186 (39%), Positives = 110/186 (59%), Gaps = 20/186 (11%)
 Frame = +2

Query  29   MDFMKKRKLED--NGVVSDPSFLPRLSLEDARKILESFTRDQLFEIVQNAVVRHPDVLGA  202
            M+ +KKRKL++  N   SD +    LS+E+ R +L+ F + QL +++     ++P +   
Sbjct  1    MEELKKRKLDEMANNGQSDSNSTSSLSVEELRSLLDHFAKPQLVDLLAKLGSQYPSIAEE  60

Query  203  VRSIADQDTTQ------------RKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKA  346
            ++S+A  + +             RKLF+RGL W TT++ L + F+ +GE+EE  VI DK 
Sbjct  61   IKSVASAEQSNNKDSVASADPALRKLFVRGLAWNTTSETLCAAFTEHGEIEEGAVITDKV  120

Query  347  TGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISL  526
            TG S+GYGFIT+K ++ A +ALK PSK IDGRM V  LA  G+       S+    D + 
Sbjct  121  TGVSRGYGFITYKDVESAQMALKAPSKMIDGRMAVCNLACEGL------SSTTVTADQAQ  174

Query  527  RKIYVG  544
            RK+Y+G
Sbjct  175  RKLYIG  180


 Score = 75.5 bits (184),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 53/80 (66%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D  QRKL+I GL  +TT++ L S FS +GE+EE  V  +K T  S+G+GF+T+K ++GA 
Sbjct  171  DQAQRKLYIGGLSSDTTSEMLLSFFSRHGEIEEGSVAYNKDTKTSRGFGFVTYKTVEGAK  230

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL +P + + GR    +LA
Sbjct  231  KALNDPQRILGGRNLTVKLA  250



>ref|XP_009386889.1| PREDICTED: UBP1-associated protein 2B-like [Musa acuminata subsp. 
malaccensis]
Length=479

 Score =   126 bits (316),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 63/156 (40%), Positives = 91/156 (58%), Gaps = 15/156 (10%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE  +RDQL  +++ A   +P  L  +R +AD D   RKLF+ GLGW+TT + LR+ F+
Sbjct  58   LLEPLSRDQLVGLLRTAAASNPATLAEIRRVADLDPAHRKLFVHGLGWDTTAEGLRAAFA  117

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG---  472
            +YG++++  VI+DKA+G+SKGYGF+ F+H   A  AL+ P K I+ RMT  QLA++G   
Sbjct  118  SYGDIDDCRVIVDKASGRSKGYGFVLFRHRSSARRALRCPQKVIENRMTSCQLASSGPSA  177

Query  473  ------------MQggpgggssnnpVDISLRKIYVG  544
                         Q         +  D   RKIYVG
Sbjct  178  PSVHHHNPGPHHHQNPNRSPGPASHQDNVSRKIYVG  213


 Score = 70.5 bits (171),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 31/83 (37%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            + QD   RK+++  +  +    +L + FS YGE+EE  +  D+ TGK KGY    +K ++
Sbjct  201  SHQDNVSRKIYVGNVHSDVDGGRLLAFFSQYGEIEEGPIGFDRHTGKPKGYALFVYKTVE  260

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
            GAL AL+EP+K  +G +   Q A
Sbjct  261  GALRALEEPNKNFEGHLLYCQRA  283



>ref|XP_010906042.1| PREDICTED: UBP1-associated protein 2A-like [Elaeis guineensis]
Length=439

 Score =   126 bits (316),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
             ++LE +T+DQL E+++ A +++P +L  + + A+ D   RK+F+ GLGW+ TT+ L S+
Sbjct  74   HRLLEPYTKDQLMELLKEAALKNPSLLSRISASAESDPVHRKIFVHGLGWDATTETLASV  133

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGM  475
            F  YGE+EE  V++D+ TG+SKGYGF+ F+    A  ALKEP K+I  RMT  QLA+ G 
Sbjct  134  FCQYGEIEECRVVVDRNTGRSKGYGFVLFRTRAAARKALKEPQKRIGHRMTSCQLASFG-  192

Query  476  QggpgggssnnpVDISLRKIYV  541
                  G+     D + RKI+V
Sbjct  193  ----PPGAQGPAPDSTGRKIFV  210


 Score = 60.5 bits (145),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D+T RK+F+ G+      ++LR+ F+ +GE+EE  +  D+ TG+ +G+    +K  D   
Sbjct  202  DSTGRKIFVSGIADHINPERLRAFFTRFGEIEEGPLGYDRNTGRLRGFAIFVYKSPDSCK  261

Query  404  LALKEPSKQIDGRMTVTQLAAAGMQ  478
             AL+EP K  +G     Q A  G++
Sbjct  262  KALEEPKKFFEGCELHCQRAVEGLK  286



>ref|XP_008805349.1| PREDICTED: UBP1-associated protein 2A-like [Phoenix dactylifera]
Length=448

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 64/145 (44%), Positives = 92/145 (63%), Gaps = 5/145 (3%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  R +LE F +DQL E+++ A +++P +L  + + A+ D   RK+F+ GLGW+ TT+ L
Sbjct  76   EAIRMLLEPFGKDQLMELLKEAALKNPSLLSRISASAESDPVHRKIFVHGLGWDATTETL  135

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S+F  YGE+EE  V++D+ TG+SKGYGF+ F+    A  ALKEP K+I  RMT  QLA+
Sbjct  136  ASVFCQYGEIEECRVVVDRNTGRSKGYGFVLFRTRAAARKALKEPQKRIGHRMTSCQLAS  195

Query  467  AGMQggpgggssnnpVDISLRKIYV  541
             G  G  G        D + RKI+V
Sbjct  196  FGPPGAQGPAP-----DSTGRKIFV  215


 Score = 60.1 bits (144),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 28/85 (33%), Positives = 48/85 (56%), Gaps = 0/85 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            D+T RK+F+ G+      ++LR+ F+ +GE+EE  +  D+ TG+ +G+    +K  D   
Sbjct  207  DSTGRKIFVSGIADHINPERLRAFFTRFGEVEEGPLGYDRNTGRLRGFAIFVYKSSDSCK  266

Query  404  LALKEPSKQIDGRMTVTQLAAAGMQ  478
             AL+EP K  +G     Q A  G++
Sbjct  267  KALEEPKKFFEGCELHCQRAVEGLK  291



>emb|CDY27186.1| BnaA09g36160D [Brassica napus]
Length=449

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F+++QL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T T+ L
Sbjct  74   EPIQDLLEPFSKEQLLSLLKEAAEKHRDVANRIREVADEDPVHRKIFVHGLGWDTKTETL  133

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT  QLA+
Sbjct  134  IEAFKEYGEIEDCKAVFDKVSGKSKGYGFILFKSRSGARNALKQPQKKIGSRMTACQLAS  193

Query  467  AG  472
             G
Sbjct  194  KG  195


 Score = 63.5 bits (153),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            ++ + TQ+K+++  +G E    KL + FS +GE+EE  + LDK TG+ KG+    +K  +
Sbjct  217  SNSEHTQKKIYVSNVGAELDPQKLLAFFSKFGEIEEGPLGLDKYTGRPKGFCLFVYKSAE  276

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  AL+EP K  +G +   Q A
Sbjct  277  SAKKALEEPHKSFEGHILHCQKA  299



>gb|KDO57341.1| hypothetical protein CISIN_1g011975mg [Citrus sinensis]
Length=453

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE F++DQL  +++ A   H DV   VR +AD+D   RK+F+ GLGW+T  + L   F 
Sbjct  93   LLEPFSKDQLVNLLREAAENHRDVASRVRQVADEDPVHRKIFVHGLGWDTKAETLIDAFK  152

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+ G
Sbjct  153  QYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTACQLASIG  209


 Score = 73.9 bits (180),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL + FS YGE+EE  + +DKATGK KG+    +K +D A 
Sbjct  244  EYTQRKIFVSNVGSELEPQKLLAFFSKYGEIEEGPLGIDKATGKPKGFCLFVYKTVDAAK  303

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  304  KALEEPHKNFEGHILNCQRAIDG  326



>ref|XP_001775204.1| predicted protein [Physcomitrella patens]
 gb|EDQ59940.1| predicted protein, partial [Physcomitrella patens]
Length=167

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 78/103 (76%), Gaps = 6/103 (6%)
 Frame = +2

Query  236  RKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALK  415
            RK+F+RGLGW++TT+ L+++FS +GE+EE  V++DK TGKS+G+GF+TF H+DGA  +LK
Sbjct  1    RKIFVRGLGWDSTTETLKTVFSQFGEVEEGAVVMDKGTGKSRGFGFVTFIHMDGAQRSLK  60

Query  416  EPSKQIDGRMTVTQLAAAGMQggpgggssnnpVDISLRKIYVG  544
            EPSK+IDGRMT  QLA+ G          N   ++S RKIYVG
Sbjct  61   EPSKRIDGRMTDCQLASTG------ALQINPNQEVSTRKIYVG  97


 Score = 59.3 bits (142),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 52/89 (58%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  GAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFI  376
            GA++   +Q+ + RK+++  +  + + D+L + F+ YGE+ E  +  DK TG+S+G+   
Sbjct  79   GALQINPNQEVSTRKIYVGNISLDLSADRLLAFFAGYGEIGEGPLGFDKFTGRSRGFALF  138

Query  377  TFKHIDGALLALKEPSKQIDGRMTVTQLA  463
             +K ++    AL EP K +DG     +LA
Sbjct  139  IYKTVEATKRALLEPIKTLDGIQMYCKLA  167



>ref|XP_008376122.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
 ref|XP_008376123.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
Length=497

 Score =   125 bits (315),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE FT++QL  +++ A   H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  107  EPIQNLLEPFTKEQLMALLREAAXNHGDVADRIRKVADEDPIHRKIFVHGLGWDTNAETL  166

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
              +F  YGE+E+   + DK +GKSKGYGFI FK   GA  AL++P K+I  RMT  QLAA
Sbjct  167  TGVFREYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALQQPQKRIGNRMTACQLAA  226

Query  467  AG  472
             G
Sbjct  227  IG  228


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/120 (33%), Positives = 59/120 (49%), Gaps = 5/120 (4%)
 Frame = +2

Query  116  RKILESFTRDQLFEI----VQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDK  283
            ++I    T  QL  I      NA    P V    +S    + TQRK+++  +G +    K
Sbjct  213  KRIGNRMTACQLAAIGPGPAPNAAAG-PVVAQVAQSQPMSEYTQRKIYVSNVGADLDIQK  271

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L   FS +GE+E+  + LDK TG+ KG+    +K  + A  AL+EP K  +G +   Q A
Sbjct  272  LLMFFSRFGEVEDGPLGLDKLTGRPKGFCLFVYKSAESAKRALEEPHKNFEGHILHCQKA  331



>ref|XP_008376121.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
 ref|XP_008364829.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
 ref|XP_008364830.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
Length=488

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/120 (48%), Positives = 77/120 (64%), Gaps = 0/120 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE FT++QL  ++  A   H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  100  EPIQNLLEPFTKEQLISLLLEAADNHGDVADRIRKVADEDPIHRKIFVHGLGWDTNAETL  159

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
              +F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALK+P KQI  RMT  QLAA
Sbjct  160  TGVFKEYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKQPQKQIGNRMTACQLAA  219


 Score = 60.8 bits (146),  Expect = 9e-08, Method: Compositional matrix adjust.
 Identities = 30/80 (38%), Positives = 46/80 (58%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G +    KL   FS +GE+EE  + LDK TG+ KG+    +K  + A 
Sbjct  245  EYTQRKIYVSNVGADLEPQKLLMFFSRFGEIEEGPLGLDKLTGRPKGFCLFVYKSAESAK  304

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  305  RALEEPHKNFEGHILHCQKA  324



>ref|XP_008362432.1| PREDICTED: UBP1-associated protein 2A-like [Malus domestica]
Length=497

 Score =   125 bits (315),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/122 (47%), Positives = 79/122 (65%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE FT++QL  +++ A   H DV   +R +AD+D   RK+F+ GLGW+T  + L
Sbjct  107  EPIQNLLEPFTKEQLMALLREAAXNHGDVADRIRKVADEDPIHRKIFVHGLGWDTNAETL  166

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
              +F  YGE+E+   + DK +GKSKGYGFI FK   GA  AL++P K+I  RMT  QLAA
Sbjct  167  TGVFREYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALQQPQKRIGNRMTACQLAA  226

Query  467  AG  472
             G
Sbjct  227  IG  228


 Score = 61.2 bits (147),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 40/120 (33%), Positives = 60/120 (50%), Gaps = 5/120 (4%)
 Frame = +2

Query  116  RKILESFTRDQLFEI----VQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDK  283
            ++I    T  QL  I      NA    P V  A +S    + TQRK+++  +G +    K
Sbjct  213  KRIGNRMTACQLAAIGPGPAPNAAAG-PVVAQAAQSQPMSEYTQRKIYVSNVGADLDIQK  271

Query  284  LRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLA  463
            L   FS +GE+E+  + LDK TG+ KG+    +K  + A  AL+EP K  +G +   Q A
Sbjct  272  LLMFFSRFGEVEDGPLGLDKLTGRPKGFCLFVYKSAESAKRALEEPHKNFEGHILHCQKA  331



>ref|XP_010108564.1| Heterogeneous nuclear ribonucleoprotein [Morus notabilis]
 gb|EXC19707.1| Heterogeneous nuclear ribonucleoprotein [Morus notabilis]
Length=465

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 89/142 (63%), Gaps = 1/142 (1%)
 Frame = +2

Query  119  KILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLF  298
            K+LE F ++QL  +++ A  +H DV   +R+IAD+D   RK+F+ GLGW+T  + L S+F
Sbjct  97   KLLEPFGKEQLASLLREAAEKHRDVADRIRNIADEDPAHRKIFVYGLGWDTNVETLTSVF  156

Query  299  STYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAGMQ  478
              +G++E+   + DK +GKSKGYGFI FK   GA  ALK+P K+I  RMT +QLA  G  
Sbjct  157  KEFGQIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKQPQKKIGNRMTSSQLATVGPV  216

Query  479  ggpgggssnnpV-DISLRKIYV  541
                      PV + + RKIYV
Sbjct  217  PVAASAQPQGPVSEYTQRKIYV  238


 Score = 69.3 bits (168),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 57/119 (48%), Gaps = 5/119 (4%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            +KI    T  QL  +    V       G V      + TQRK+++  +G E    KL   
Sbjct  199  KKIGNRMTSSQLATVGPVPVAASAQPQGPV-----SEYTQRKIYVSNVGAELDPQKLTVF  253

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            FS +GE+EE  + LDK TGK KG+    +K  DGA  AL EP K  +G +   Q A  G
Sbjct  254  FSKFGEIEEGPLGLDKFTGKPKGFCLFVYKTSDGARKALAEPHKNFEGHILHCQRAVDG  312



>gb|KDP21974.1| hypothetical protein JCGZ_03187 [Jatropha curcas]
Length=464

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E    +LE F +DQL  +++ A   H DV   +R IAD+D   RK+F+ GLGW+T  + L
Sbjct  79   EPIENLLEPFGKDQLINLLREAADSHRDVADRIRRIADEDPVHRKIFVHGLGWDTNAETL  138

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             + F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  139  LNAFKPYGEIEDCKAVCDKVSGKSKGYGFILFKKRSGARKALKEPQKKIGNRMTACQLAS  198

Query  467  AG  472
             G
Sbjct  199  IG  200


 Score = 67.8 bits (164),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 49/80 (61%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+++  +G +    KL + FS YGE+EE  + LDK +GK KG+    +K+++ A 
Sbjct  218  EYTQRKIYVSNVGADLDPQKLTTFFSNYGEIEEGPLGLDKLSGKPKGFCLFVYKNVESAK  277

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G +   Q A
Sbjct  278  KALEEPHKNFEGHILHCQKA  297



>ref|XP_006481969.1| PREDICTED: protein gar2-like isoform X1 [Citrus sinensis]
Length=474

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE F++DQL  +++ A   H DV   VR +AD+D   RK+F+ GLGW+T  + L   F 
Sbjct  93   LLEPFSKDQLVNLLREAAENHRDVASRVRQVADEDPVHRKIFVHGLGWDTKAETLIDAFK  152

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+ G
Sbjct  153  QYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTACQLASIG  209


 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL + FS YGE+EE  + +DKATGK KG+    +K +D A 
Sbjct  244  EYTQRKIFVSNVGSELEPQKLLAFFSKYGEIEEGPLGIDKATGKPKGFCLFVYKTVDAAK  303

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  304  KALEEPHKNFEGHILNCQKAIDG  326



>gb|KDO57340.1| hypothetical protein CISIN_1g011975mg [Citrus sinensis]
Length=474

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 76/117 (65%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE F++DQL  +++ A   H DV   VR +AD+D   RK+F+ GLGW+T  + L   F 
Sbjct  93   LLEPFSKDQLVNLLREAAENHRDVASRVRQVADEDPVHRKIFVHGLGWDTKAETLIDAFK  152

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+ G
Sbjct  153  QYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTACQLASIG  209


 Score = 73.6 bits (179),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL + FS YGE+EE  + +DKATGK KG+    +K +D A 
Sbjct  244  EYTQRKIFVSNVGSELEPQKLLAFFSKYGEIEEGPLGIDKATGKPKGFCLFVYKTVDAAK  303

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  304  KALEEPHKNFEGHILNCQRAIDG  326



>ref|XP_006430420.1| hypothetical protein CICLE_v10011637mg [Citrus clementina]
 gb|ESR43660.1| hypothetical protein CICLE_v10011637mg [Citrus clementina]
Length=476

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F++DQL  ++  A   H DV   VR +AD+D   RK+F+ GLGW+T  + L
Sbjct  90   EPIQSLLEPFSKDQLVNLLCEAAENHRDVASRVRQVADEDPVHRKIFVHGLGWDTKAETL  149

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  150  IDAFKQYGEIEDCKAVCDKVSGKSKGYGFILFKTRSGARKALKEPQKKIGNRMTACQLAS  209

Query  467  AG  472
             G
Sbjct  210  IG  211


 Score = 73.6 bits (179),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 50/83 (60%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G E    KL + FS YGE+EE  + +DKATGK KG+    +K +D A 
Sbjct  246  EYTQRKIFVSNVGSELEPQKLLAFFSKYGEIEEGPLGIDKATGKPKGFCLFVYKTVDAAK  305

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +   Q A  G
Sbjct  306  KALEEPHKNFEGHILNCQRAIDG  328



>emb|CDM80736.1| unnamed protein product [Triticum aestivum]
Length=475

 Score =   125 bits (314),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/119 (50%), Positives = 80/119 (67%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +LE F ++QL E++++A VRH DVL +VR  AD D  QRK+F+ GLGW+TT D L   
Sbjct  106  QALLEVFPKEQLVELLRDAAVRHGDVLESVRRAADADPAQRKIFVHGLGWDTTVDILTEA  165

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            F  YGE+E+  ++ D+ TGK KGYGFI F  + GA  AL EP K+I  R T  QLA+ G
Sbjct  166  FRPYGEIEDLKLVSDRNTGKCKGYGFILFSRLSGARAALLEPQKKIGNRTTSCQLASLG  224


 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 48/80 (60%), Gaps = 0/80 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            + TQRK+F+  +G +    KL   FS YGE+EE  + LDKATGK KG+    ++ ++ A 
Sbjct  255  EYTQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKATGKPKGFALFVYRTLESAK  314

Query  404  LALKEPSKQIDGRMTVTQLA  463
             AL+EP K  +G M   Q A
Sbjct  315  KALQEPHKSFEGVMLHCQKA  334



>ref|XP_010505869.1| PREDICTED: UBP1-associated protein 2B-like [Camelina sativa]
Length=453

 Score =   124 bits (312),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/117 (50%), Positives = 78/117 (67%), Gaps = 0/117 (0%)
 Frame = +2

Query  122  ILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSLFS  301
            +LE F++DQL  +++ A  RH DV   +R IAD+D   RK+F+ GLGW+T  D L   F 
Sbjct  88   LLEPFSKDQLLILLKEAAERHRDVADRIRIIADEDPVHRKIFVHGLGWDTKADALIEAFK  147

Query  302  TYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
             YGE+E+   ++DK +G+SKGYGFI FK   GA  ALK+P K+I  RMT  QLAA G
Sbjct  148  HYGEIEDCKCVVDKVSGQSKGYGFILFKSRSGARKALKQPQKKIGTRMTACQLAAVG  204


 Score = 57.0 bits (136),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 28/83 (34%), Positives = 45/83 (54%), Gaps = 0/83 (0%)
 Frame = +2

Query  224  DTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGAL  403
            +  QRK+++  +  +    KL   FS +GE+EE  + LDKATG+ KG+    ++  + A 
Sbjct  222  ENVQRKIYVSNVSADLDPRKLLEFFSRFGEIEEGPLGLDKATGRPKGFTLFVYRSAESAK  281

Query  404  LALKEPSKQIDGRMTVTQLAAAG  472
             AL+EP K  +G +     A  G
Sbjct  282  RALEEPHKTFEGHVLHCHKANDG  304



>ref|XP_010060843.1| PREDICTED: UBP1-associated protein 2B-like [Eucalyptus grandis]
 gb|KCW67720.1| hypothetical protein EUGRSUZ_F01459 [Eucalyptus grandis]
Length=491

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/122 (48%), Positives = 77/122 (63%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F++DQL  ++  A  +H DV   +R +AD D   RK+F+ GLGW+ T + L
Sbjct  109  EPIQNLLEPFSKDQLISLLFEAAAQHRDVADRIRQMADVDPVHRKIFVHGLGWDATAETL  168

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
             S F  YGE+E    + DK +GKSKGYGFI FK   GA  ALKEP K+I  RMT  QLA+
Sbjct  169  TSAFKQYGEIENCKAVCDKVSGKSKGYGFILFKSRRGARNALKEPQKKIGNRMTACQLAS  228

Query  467  AG  472
             G
Sbjct  229  IG  230


 Score = 66.2 bits (160),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/81 (38%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+++  +G +    KL   F+ +GE+EE  + LDK+TGK KG+    +K ++ A  A
Sbjct  258  TQRKIYVSNVGADLNPKKLTEFFAKFGEIEEGPLGLDKSTGKPKGFCLFVYKTVESAKKA  317

Query  410  LKEPSKQIDGRMTVTQLAAAG  472
            L+EP K  +G +   Q A  G
Sbjct  318  LEEPHKSFEGHVLHCQKAVDG  338



>ref|NP_001042672.2| Os01g0265800 [Oryza sativa Japonica Group]
 dbj|BAF04586.2| Os01g0265800, partial [Oryza sativa Japonica Group]
Length=524

 Score =   125 bits (313),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 59/119 (50%), Positives = 76/119 (64%), Gaps = 0/119 (0%)
 Frame = +2

Query  116  RKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKLRSL  295
            + +L SF +DQL E++  A + H DVL AV   AD D   RK+F+ GLGW+ T + L   
Sbjct  150  QALLNSFPKDQLVELLSAAALSHEDVLTAVHRAADADPALRKIFVHGLGWDATAETLTEA  209

Query  296  FSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAAAG  472
            FS YGE+E+  V+ D+ATGK KGYGFI F    GA  AL+EP K+I  R T  QLA+ G
Sbjct  210  FSAYGEIEDLRVVTDRATGKCKGYGFILFSRRSGARAALREPQKKIGNRTTACQLASVG  268


 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 0/78 (0%)
 Frame = +2

Query  230  TQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLA  409
            TQRK+F+  +G +    KL   FS YGE+EE  + LDK TGK KG+    +K +D A  A
Sbjct  299  TQRKIFVSNVGADIDPQKLLQFFSKYGEIEEGPLGLDKVTGKPKGFALFVYKTLDSAKKA  358

Query  410  LKEPSKQIDGRMTVTQLA  463
            L+EP KQ +G +   Q A
Sbjct  359  LQEPHKQFEGVVLHCQKA  376



>ref|XP_006402940.1| hypothetical protein EUTSA_v10005930mg [Eutrema salsugineum]
 ref|XP_006402941.1| hypothetical protein EUTSA_v10005930mg [Eutrema salsugineum]
 dbj|BAJ33737.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44393.1| hypothetical protein EUTSA_v10005930mg [Eutrema salsugineum]
 gb|ESQ44394.1| hypothetical protein EUTSA_v10005930mg [Eutrema salsugineum]
Length=479

 Score =   124 bits (312),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/122 (46%), Positives = 80/122 (66%), Gaps = 0/122 (0%)
 Frame = +2

Query  107  EDARKILESFTRDQLFEIVQNAVVRHPDVLGAVRSIADQDTTQRKLFIRGLGWETTTDKL  286
            E  + +LE F+++QL  +++ A  +H DV   +R +AD+D   RK+F+ GLGW+T T+ L
Sbjct  102  EPIKDLLEPFSKEQLLNLLKEAAGKHLDVANRIREVADEDPVHRKIFVHGLGWDTKTETL  161

Query  287  RSLFSTYGELEEAVVILDKATGKSKGYGFITFKHIDGALLALKEPSKQIDGRMTVTQLAA  466
               F  YGE+E+   + DK +GKSKGYGFI +K   GA  ALK+P K+I  RMT  QLA+
Sbjct  162  IEAFKQYGEIEDCKAVFDKVSGKSKGYGFILYKSRSGARNALKQPQKKIGSRMTACQLAS  221

Query  467  AG  472
             G
Sbjct  222  KG  223


 Score = 62.0 bits (149),  Expect = 4e-08, Method: Compositional matrix adjust.
 Identities = 30/83 (36%), Positives = 49/83 (59%), Gaps = 0/83 (0%)
 Frame = +2

Query  215  ADQDTTQRKLFIRGLGWETTTDKLRSLFSTYGELEEAVVILDKATGKSKGYGFITFKHID  394
            ++ + TQ+K+++  +G E    KL + FS +GE+EE  + LDK TG+ KG+    +K  +
Sbjct  243  SNSEHTQKKIYVSNVGAELDPQKLLAFFSRFGEIEEGPLGLDKFTGRPKGFCLFVYKSPE  302

Query  395  GALLALKEPSKQIDGRMTVTQLA  463
             A  AL+EP K  +G +   Q A
Sbjct  303  SAKRALEEPHKTFEGHILHCQKA  325



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 579015689490