BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C05

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_004248326.1|  PREDICTED: serine/threonine-protein kinase D...  57.8    9e-07   Solanum lycopersicum
emb|CDP13698.1|  unnamed protein product                              51.2    1e-04   Coffea canephora [robusta coffee]
ref|XP_009625903.1|  PREDICTED: serine/threonine-protein kinase D...  50.8    2e-04   Nicotiana tomentosiformis



>ref|XP_004248326.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
 ref|XP_010327213.1| PREDICTED: serine/threonine-protein kinase D6PKL2 [Solanum lycopersicum]
Length=613

 Score = 57.8 bits (138),  Expect = 9e-07, Method: Compositional matrix adjust.
 Identities = 46/129 (36%), Positives = 59/129 (46%), Gaps = 43/129 (33%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTPSKTSKNSNSENLRSKEV-----------  387
            MAS P VKSSLE+ N     Q +ER+  R  PS+ SK+ NS +  SKE+           
Sbjct  1    MASTPSVKSSLEKLNKSAGIQAVERNPRRSAPSQVSKSINSGSTTSKELQHNDREVASKQ  60

Query  388  ----------------------LANHLDSSLNLGSIKKPPSGDTKGLPERR-----ADQE  486
                                  L +  DSSL LG++K  PSG    L E +      DQE
Sbjct  61   LMAEATTKKKSNSYQQVGSADLLVDKFDSSLYLGNLKHAPSGAASALCEAKGSQCAVDQE  120

Query  487  KKASGSGTV  513
            KKASG+G +
Sbjct  121  KKASGNGDI  129



>emb|CDP13698.1| unnamed protein product [Coffea canephora]
Length=607

 Score = 51.2 bits (121),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 63/124 (51%), Gaps = 38/124 (31%)
 Frame = +1

Query  256  MASKPGVKSSLERQN-----QTLERSSHRPTP---SKTSKNS-------------NSENL  372
            MAS+ G K SL++QN     +TLE  S +P+P   SKTSK+              N E  
Sbjct  1    MASRSGTKGSLDKQNKAFGIETLEGISRKPSPLLASKTSKSGTASVAQEVPPKQLNIETT  60

Query  373  RSKEV-----------LANHLDSSLNLGSIKK------PPSGDTKGLPERRADQEKKASG  501
             +K++           LA  LD+SL LG+ K+      PP+ +TKG  E+ AD EKK S 
Sbjct  61   ANKKLHNAGQNGLLDSLAGKLDTSLRLGNTKQTQASLSPPATETKGSVEKIADHEKKTSE  120

Query  502  SGTV  513
             GTV
Sbjct  121  HGTV  124



>ref|XP_009625903.1| PREDICTED: serine/threonine-protein kinase D6PK-like isoform 
X1 [Nicotiana tomentosiformis]
Length=631

 Score = 50.8 bits (120),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 64/134 (48%), Gaps = 35/134 (26%)
 Frame = +1

Query  157  FFLSIRE-GYMRWTGVLSDGFG*LEKI*LSVFVSMASKPGVKSSLERQ-----NQTLERS  318
            F LSI E     W   LS+GFG    I  S+F+ MAS P VKSSLE+      +  +E +
Sbjct  11   FILSIFELSCCCWK--LSNGFGRPGCIEESLFILMASTPSVKSSLEKLKKSTGSHAVEGN  68

Query  319  SHRPTPSKTSKNSNSENLRSKE---------------------VLANHLDSSLNLGSIKK  435
            S    PS+ SK+  SE+  SKE                     +L + L+SSL LG++K 
Sbjct  69   SRTSAPSQVSKSGKSESTTSKELRSDDRKVASKQLTAEAGSADLLVDKLNSSLYLGNLKH  128

Query  436  PPSG------DTKG  459
             P G      DTKG
Sbjct  129  APIGAVSMPCDTKG  142



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720