BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C04

Length=368
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009772022.1|  PREDICTED: protein SRG1-like                       134   6e-35   Nicotiana sylvestris
ref|XP_009610881.1|  PREDICTED: protein SRG1-like                       128   8e-33   Nicotiana tomentosiformis
ref|XP_006355578.1|  PREDICTED: protein SRG1-like                       122   1e-30   Solanum tuberosum [potatoes]
ref|XP_007022024.1|  Senescence-related gene 1                          122   1e-30   Theobroma cacao [chocolate]
ref|XP_004233003.1|  PREDICTED: protein SRG1-like                       120   1e-29   
ref|XP_011045559.1|  PREDICTED: protein SRG1                            119   1e-29   Populus euphratica
emb|CBI30803.3|  unnamed protein product                                112   4e-28   Vitis vinifera
ref|XP_002300453.1|  SENESCENCE-RELATED GENE 1 family protein           115   4e-28   Populus trichocarpa [western balsam poplar]
ref|XP_006489681.1|  PREDICTED: protein SRG1-like                       115   5e-28   Citrus sinensis [apfelsine]
gb|KDO54069.1|  hypothetical protein CISIN_1g023533mg                   113   1e-27   Citrus sinensis [apfelsine]
emb|CDP20118.1|  unnamed protein product                                111   1e-27   Coffea canephora [robusta coffee]
ref|XP_007022033.1|  Senescence-related gene 1                          115   3e-27   
ref|XP_002271080.1|  PREDICTED: protein SRG1                            112   5e-27   Vitis vinifera
ref|XP_009772021.1|  PREDICTED: protein SRG1-like                       111   1e-26   Nicotiana sylvestris
gb|KDO41542.1|  hypothetical protein CISIN_1g030400mg                   107   2e-26   Citrus sinensis [apfelsine]
ref|XP_009610877.1|  PREDICTED: protein SRG1-like                       110   2e-26   Nicotiana tomentosiformis
ref|XP_002528471.1|  Naringenin,2-oxoglutarate 3-dioxygenase, put...    110   3e-26   
ref|XP_010273388.1|  PREDICTED: protein SRG1-like                       110   3e-26   Nelumbo nucifera [Indian lotus]
ref|XP_006442328.1|  hypothetical protein CICLE_v10020825mg             110   5e-26   Citrus clementina [clementine]
gb|KDO52129.1|  hypothetical protein CISIN_1g018426mg                   110   5e-26   Citrus sinensis [apfelsine]
ref|XP_006369971.1|  hypothetical protein POPTR_0001s36510g             106   7e-26   
ref|XP_006355623.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    109   7e-26   Solanum tuberosum [potatoes]
ref|XP_006355625.1|  PREDICTED: protein SRG1-like                       109   8e-26   
ref|XP_002269087.1|  PREDICTED: protein SRG1                            109   9e-26   Vitis vinifera
ref|XP_007214442.1|  hypothetical protein PRUPE_ppa024861mg             108   1e-25   Prunus persica
ref|XP_004233005.2|  PREDICTED: codeine O-demethylase-like              108   1e-25   
ref|XP_006442335.1|  hypothetical protein CICLE_v10020844mg             108   2e-25   Citrus clementina [clementine]
gb|KDO54061.1|  hypothetical protein CISIN_1g018035mg                   108   2e-25   Citrus sinensis [apfelsine]
gb|KJB64626.1|  hypothetical protein B456_010G058200                    107   3e-25   Gossypium raimondii
ref|XP_010665636.1|  PREDICTED: protein SRG1-like                       107   3e-25   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011005822.1|  PREDICTED: protein SRG1-like                       107   4e-25   Populus euphratica
ref|XP_002528475.1|  Leucoanthocyanidin dioxygenase, putative           107   4e-25   Ricinus communis
emb|CDP21916.1|  unnamed protein product                                104   5e-25   Coffea canephora [robusta coffee]
ref|XP_007211480.1|  hypothetical protein PRUPE_ppa007597mg             107   6e-25   
gb|KDO52128.1|  hypothetical protein CISIN_1g035879mg                   106   9e-25   Citrus sinensis [apfelsine]
gb|KEH38521.1|  2OG-Fe(II) oxygenase family oxidoreductase              103   1e-24   Medicago truncatula
ref|XP_006477892.1|  PREDICTED: protein SRG1-like                       105   1e-24   
ref|XP_006477805.1|  PREDICTED: protein SRG1-like                       106   1e-24   
emb|CDP20503.1|  unnamed protein product                                105   1e-24   Coffea canephora [robusta coffee]
ref|XP_006477808.1|  PREDICTED: protein SRG1-like                       105   1e-24   Citrus sinensis [apfelsine]
ref|XP_006428589.1|  hypothetical protein CICLE_v10012028mg             104   2e-24   
ref|XP_006432905.1|  hypothetical protein CICLE_v10001623mg             105   2e-24   Citrus clementina [clementine]
gb|KDP21186.1|  hypothetical protein JCGZ_21657                         105   2e-24   Jatropha curcas
ref|XP_011045561.1|  PREDICTED: protein SRG1-like                       105   2e-24   Populus euphratica
ref|XP_006477891.1|  PREDICTED: protein SRG1-like                       105   2e-24   Citrus sinensis [apfelsine]
ref|XP_003546739.1|  PREDICTED: protein SRG1                            105   2e-24   Glycine max [soybeans]
ref|XP_006428590.1|  hypothetical protein CICLE_v10012028mg             105   2e-24   Citrus clementina [clementine]
ref|XP_006355629.1|  PREDICTED: protein SRG1-like                       105   3e-24   
emb|CDP20896.1|  unnamed protein product                                104   3e-24   Coffea canephora [robusta coffee]
emb|CDP17938.1|  unnamed protein product                                102   3e-24   Coffea canephora [robusta coffee]
ref|XP_010095129.1|  Protein SRG1                                       104   3e-24   Morus notabilis
ref|XP_004233861.2|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    108   3e-24   
ref|XP_008226353.1|  PREDICTED: protein SRG1-like                       104   3e-24   Prunus mume [ume]
ref|XP_006489639.1|  PREDICTED: protein SRG1-like                       104   4e-24   Citrus sinensis [apfelsine]
ref|XP_002300451.1|  SENESCENCE-RELATED GENE 1 family protein           104   5e-24   Populus trichocarpa [western balsam poplar]
gb|KDP32875.1|  hypothetical protein JCGZ_12167                         104   6e-24   Jatropha curcas
ref|XP_002519761.1|  Flavonol synthase/flavanone 3-hydroxylase, p...    103   6e-24   Ricinus communis
ref|XP_009799622.1|  PREDICTED: protein SRG1-like                       103   6e-24   Nicotiana sylvestris
ref|XP_006432907.1|  hypothetical protein CICLE_v10001648mg             103   6e-24   
ref|XP_006494094.1|  PREDICTED: codeine O-demethylase-like isofor...    103   1e-23   Citrus sinensis [apfelsine]
ref|XP_010272749.1|  PREDICTED: protein SRG1-like                       103   1e-23   
ref|XP_006442327.1|  hypothetical protein CICLE_v10020829mg             103   1e-23   
ref|XP_006432906.1|  hypothetical protein CICLE_v10001648mg             103   1e-23   Citrus clementina [clementine]
ref|XP_003638414.1|  SRG1-like protein                                  103   1e-23   
ref|XP_010059078.1|  PREDICTED: uncharacterized protein LOC104446988    105   1e-23   
ref|XP_006432912.1|  hypothetical protein CICLE_v10001626mg             102   1e-23   
ref|XP_009610880.1|  PREDICTED: protein SRG1-like                       103   1e-23   Nicotiana tomentosiformis
ref|XP_007209291.1|  hypothetical protein PRUPE_ppa007716mg             103   1e-23   
ref|XP_009376721.1|  PREDICTED: protein SRG1-like isoform X2            102   2e-23   Pyrus x bretschneideri [bai li]
ref|XP_006432901.1|  hypothetical protein CICLE_v10001620mg             102   2e-23   Citrus clementina [clementine]
ref|XP_009376720.1|  PREDICTED: protein SRG1-like isoform X1            102   2e-23   Pyrus x bretschneideri [bai li]
gb|KJB64632.1|  hypothetical protein B456_010G058700                    102   2e-23   Gossypium raimondii
ref|XP_006432911.1|  hypothetical protein CICLE_v10001626mg             102   2e-23   Citrus clementina [clementine]
gb|KCW74247.1|  hypothetical protein EUGRSUZ_E02887                     102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010057200.1|  PREDICTED: protein SRG1-like isoform X2            102   2e-23   
ref|XP_010665637.1|  PREDICTED: protein SRG1-like                       102   2e-23   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010057199.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...    102   2e-23   Eucalyptus grandis [rose gum]
ref|XP_010057204.1|  PREDICTED: protein SRG1-like                       102   2e-23   Eucalyptus grandis [rose gum]
gb|AFK39688.1|  unknown                                                 102   3e-23   Lotus japonicus
ref|XP_006432916.1|  hypothetical protein CICLE_v10001622mg             102   3e-23   Citrus clementina [clementine]
ref|XP_008238358.1|  PREDICTED: S-norcoclaurine synthase 1-like         102   3e-23   Prunus mume [ume]
gb|KDO39329.1|  hypothetical protein CISIN_1g018221mg                   102   3e-23   Citrus sinensis [apfelsine]
ref|XP_011460382.1|  PREDICTED: protein SRG1-like                       102   3e-23   Fragaria vesca subsp. vesca
gb|KDP25011.1|  hypothetical protein JCGZ_23994                         102   3e-23   Jatropha curcas
gb|KDP47183.1|  hypothetical protein JCGZ_25692                         102   3e-23   Jatropha curcas
ref|XP_003540518.1|  PREDICTED: protein SRG1-like                       102   3e-23   Glycine max [soybeans]
ref|XP_010057201.1|  PREDICTED: protein SRG1-like                       101   4e-23   Eucalyptus grandis [rose gum]
gb|AFK41350.1|  unknown                                                 101   4e-23   Lotus japonicus
ref|XP_009376717.1|  PREDICTED: protein SRG1-like                       101   4e-23   Pyrus x bretschneideri [bai li]
gb|AFK47220.1|  unknown                                                 101   5e-23   Lotus japonicus
ref|XP_006420337.1|  hypothetical protein CICLE_v10005281mg             101   5e-23   Citrus clementina [clementine]
ref|XP_006471705.1|  PREDICTED: protein SRG1-like                       102   5e-23   
ref|XP_004146011.1|  PREDICTED: protein SRG1-like                       101   5e-23   
ref|XP_008366518.1|  PREDICTED: protein SRG1-like                       101   6e-23   
ref|XP_011460383.1|  PREDICTED: protein SRG1-like                       101   6e-23   Fragaria vesca subsp. vesca
ref|XP_007022032.1|  Senescence-related gene 1                          101   6e-23   
ref|XP_006477806.1|  PREDICTED: protein SRG1-like                       100   9e-23   Citrus sinensis [apfelsine]
ref|XP_006575845.1|  PREDICTED: protein SRG1-like                       100   1e-22   
ref|XP_006442330.1|  hypothetical protein CICLE_v10020843mg             100   1e-22   Citrus clementina [clementine]
ref|XP_010089186.1|  Protein SRG1                                       100   1e-22   
ref|XP_003516325.1|  PREDICTED: protein SRG1                            100   1e-22   Glycine max [soybeans]
ref|XP_009376719.1|  PREDICTED: protein SRG1-like isoform X2            100   1e-22   
ref|XP_004488976.1|  PREDICTED: protein SRG1-like                       100   1e-22   Cicer arietinum [garbanzo]
ref|XP_009376718.1|  PREDICTED: protein SRG1-like isoform X1            100   1e-22   
ref|XP_007149498.1|  hypothetical protein PHAVU_005G075400g             100   2e-22   Phaseolus vulgaris [French bean]
ref|XP_010057196.1|  PREDICTED: protein SRG1-like isoform X2          99.8    2e-22   
ref|XP_010057195.1|  PREDICTED: protein SRG1-like isoform X1            100   2e-22   Eucalyptus grandis [rose gum]
gb|KHG25230.1|  Protein SRG1 -like protein                              100   2e-22   Gossypium arboreum [tree cotton]
ref|XP_010273386.1|  PREDICTED: protein SRG1-like                       100   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_011085301.1|  PREDICTED: protein SRG1-like                     99.8    2e-22   Sesamum indicum [beniseed]
gb|AGL52587.1|  2-oxoglutarate/Fe2+-dependent dioxygenase               100   2e-22   Papaver somniferum
ref|XP_002519766.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  99.8    2e-22   Ricinus communis
ref|XP_006452693.1|  hypothetical protein CICLE_v10008745mg           99.8    2e-22   Citrus clementina [clementine]
ref|XP_007149499.1|  hypothetical protein PHAVU_005G075500g           99.4    3e-22   Phaseolus vulgaris [French bean]
ref|XP_006494099.1|  PREDICTED: protein SRG1-like                     99.4    3e-22   Citrus sinensis [apfelsine]
ref|XP_006355576.1|  PREDICTED: protein SRG1-like                     97.8    3e-22   Solanum tuberosum [potatoes]
gb|KEH27886.1|  2OG-Fe(II) oxygenase family oxidoreductase            99.4    3e-22   Medicago truncatula
gb|KEH27885.1|  flavonol synthase/flavanone 3-hydroxylase             99.4    3e-22   Medicago truncatula
gb|AJI44436.1|  oxoglutarate-dependent dioxygenase 2                  99.4    3e-22   Ocimum basilicum [basil]
gb|KCW74242.1|  hypothetical protein EUGRSUZ_E02880                   99.0    4e-22   Eucalyptus grandis [rose gum]
ref|XP_004490337.1|  PREDICTED: protein SRG1-like                     99.0    4e-22   Cicer arietinum [garbanzo]
ref|XP_008345138.1|  PREDICTED: protein SRG1-like                     99.0    5e-22   
ref|XP_010057202.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  98.6    5e-22   Eucalyptus grandis [rose gum]
ref|XP_003518803.1|  PREDICTED: protein SRG1-like                     98.6    5e-22   Glycine max [soybeans]
gb|KHN29926.1|  Protein SRG1-like protein                             97.1    6e-22   Glycine soja [wild soybean]
ref|XP_010273389.1|  PREDICTED: protein SRG1-like                     98.6    6e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009139101.1|  PREDICTED: protein SRG1-like isoform X1          98.6    6e-22   Brassica rapa
ref|XP_009139110.1|  PREDICTED: protein SRG1-like isoform X2          98.6    6e-22   Brassica rapa
gb|KJB12903.1|  hypothetical protein B456_002G045700                  98.6    7e-22   Gossypium raimondii
ref|XP_002268288.1|  PREDICTED: protein SRG1                          98.2    7e-22   Vitis vinifera
gb|KCW74252.1|  hypothetical protein EUGRSUZ_E02895                   95.9    7e-22   Eucalyptus grandis [rose gum]
ref|XP_007013636.1|  Senescence-related gene 1                        98.2    7e-22   
ref|XP_003614589.1|  SRG1-like protein                                98.2    7e-22   Medicago truncatula
ref|XP_010057213.1|  PREDICTED: protein SRG1-like isoform X1          98.2    8e-22   Eucalyptus grandis [rose gum]
ref|XP_010057215.1|  PREDICTED: protein SRG1-like isoform X2          98.2    9e-22   Eucalyptus grandis [rose gum]
ref|XP_007211481.1|  hypothetical protein PRUPE_ppa007600mg           98.2    9e-22   Prunus persica
ref|XP_007025218.1|  Senescence-related gene 1, putative              97.8    9e-22   
ref|XP_010057217.1|  PREDICTED: protein SRG1-like isoform X2          97.4    1e-21   Eucalyptus grandis [rose gum]
ref|XP_010057216.1|  PREDICTED: protein SRG1-like isoform X1          97.4    1e-21   Eucalyptus grandis [rose gum]
gb|KEH27983.1|  flavonol synthase/flavanone 3-hydroxylase             97.1    1e-21   Medicago truncatula
ref|XP_006389976.1|  hypothetical protein EUTSA_v10018772mg           97.4    2e-21   
ref|XP_003614575.1|  SRG1-like protein                                97.4    2e-21   Medicago truncatula
ref|XP_006302461.1|  hypothetical protein CARUB_v10020553mg           97.1    2e-21   Capsella rubella
gb|KEH27888.1|  2OG-Fe(II) oxygenase family oxidoreductase            97.1    2e-21   Medicago truncatula
ref|XP_006355630.1|  PREDICTED: protein SRG1-like                     97.1    2e-21   Solanum tuberosum [potatoes]
ref|XP_010057210.1|  PREDICTED: protein SRG1-like                     97.1    2e-21   Eucalyptus grandis [rose gum]
gb|KCW74251.1|  hypothetical protein EUGRSUZ_E02892                   97.1    2e-21   Eucalyptus grandis [rose gum]
ref|XP_010041379.1|  PREDICTED: protein SRG1-like                     96.7    2e-21   Eucalyptus grandis [rose gum]
ref|XP_003543178.1|  PREDICTED: protein SRG1                          96.7    2e-21   Glycine max [soybeans]
ref|XP_003614574.1|  Protein SRG1                                     96.7    2e-21   
ref|XP_009109218.1|  PREDICTED: protein SRG1-like                     96.7    2e-21   Brassica rapa
emb|CDY24858.1|  BnaA08g14520D                                        96.7    3e-21   Brassica napus [oilseed rape]
ref|XP_006355577.1|  PREDICTED: protein SRG1-like                     96.3    3e-21   Solanum tuberosum [potatoes]
ref|XP_006442333.1|  hypothetical protein CICLE_v10020840mg           96.3    3e-21   Citrus clementina [clementine]
ref|XP_010057208.1|  PREDICTED: protein SRG1-like                     96.3    3e-21   Eucalyptus grandis [rose gum]
dbj|BAE99802.1|  SRG1-like protein                                    96.3    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AJI44435.1|  oxoglutarate-dependent flavone 7-O-demethylase        96.3    4e-21   Ocimum basilicum [basil]
ref|NP_194260.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  96.3    4e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007022030.1|  Senescence-related gene 1                        96.3    4e-21   
ref|XP_004233006.1|  PREDICTED: protein SRG1-like                     96.3    4e-21   Solanum lycopersicum
ref|XP_010096601.1|  Protein SRG1                                     95.9    4e-21   
ref|XP_004134919.1|  PREDICTED: protein SRG1-like                     95.9    5e-21   Cucumis sativus [cucumbers]
gb|KEH38520.1|  2OG-Fe(II) oxygenase family oxidoreductase            95.5    5e-21   Medicago truncatula
gb|KEH38519.1|  2OG-Fe(II) oxygenase family oxidoreductase            95.9    5e-21   Medicago truncatula
ref|XP_006442325.1|  hypothetical protein CICLE_v10020838mg           95.9    5e-21   Citrus clementina [clementine]
emb|CDY08970.1|  BnaC08g12000D                                        95.9    6e-21   Brassica napus [oilseed rape]
gb|KDP21184.1|  hypothetical protein JCGZ_21655                       95.9    6e-21   Jatropha curcas
ref|XP_010433658.1|  PREDICTED: protein SRG1-like                     95.5    6e-21   Camelina sativa [gold-of-pleasure]
gb|KDO52127.1|  hypothetical protein CISIN_1g045260mg                 95.5    7e-21   Citrus sinensis [apfelsine]
ref|XP_006477804.1|  PREDICTED: protein SRG1-like                     95.1    8e-21   Citrus sinensis [apfelsine]
ref|NP_173145.1|  Fe(II)/ascorbate oxidase family protein SRG1        95.1    8e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010448451.1|  PREDICTED: protein SRG1-like                     95.1    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008378981.1|  PREDICTED: protein SRG1-like                     93.2    1e-20   
gb|KEH19983.1|  flavonol synthase/flavanone 3-hydroxylase             94.7    1e-20   Medicago truncatula
gb|KEH19984.1|  flavonol synthase/flavanone 3-hydroxylase             94.7    1e-20   Medicago truncatula
gb|KEH16106.1|  flavonol synthase/flavanone 3-hydroxylase             94.7    1e-20   Medicago truncatula
ref|XP_006355575.1|  PREDICTED: protein SRG1-like                     94.7    1e-20   
gb|KEH17521.1|  flavonol synthase/flavanone 3-hydroxylase             94.7    1e-20   Medicago truncatula
gb|KEH17519.1|  flavonol synthase/flavanone 3-hydroxylase             94.7    1e-20   Medicago truncatula
ref|XP_011002641.1|  PREDICTED: protein SRG1-like                     94.7    1e-20   Populus euphratica
gb|KFK43894.1|  hypothetical protein AALP_AA1G187900                  94.7    1e-20   Arabis alpina [alpine rockcress]
gb|KHN29925.1|  Protein SRG1-like protein                             94.4    1e-20   Glycine soja [wild soybean]
ref|XP_006494121.1|  PREDICTED: protein SRG1-like                     91.3    2e-20   
ref|XP_009376708.1|  PREDICTED: protein SRG1-like                     94.4    2e-20   Pyrus x bretschneideri [bai li]
ref|XP_010417451.1|  PREDICTED: protein SRG1-like isoform X1          94.4    2e-20   Camelina sativa [gold-of-pleasure]
gb|KJB51668.1|  hypothetical protein B456_008G228300                  94.4    2e-20   Gossypium raimondii
gb|AJI44437.1|  oxoglutarate-dependent dioxygenase 3                  94.4    2e-20   Ocimum basilicum [basil]
gb|KJB51669.1|  hypothetical protein B456_008G228300                  94.0    2e-20   Gossypium raimondii
gb|KCW54631.1|  hypothetical protein EUGRSUZ_I00575                   94.0    2e-20   Eucalyptus grandis [rose gum]
ref|XP_004294174.1|  PREDICTED: protein SRG1-like                     94.4    2e-20   Fragaria vesca subsp. vesca
gb|AFK43235.1|  unknown                                               94.0    2e-20   Lotus japonicus
emb|CDX86869.1|  BnaA09g22590D                                        93.2    2e-20   
ref|XP_010057205.1|  PREDICTED: protein SRG1-like                     94.0    2e-20   
ref|XP_006452690.1|  hypothetical protein CICLE_v100105992mg          91.3    2e-20   
gb|KDP22220.1|  hypothetical protein JCGZ_26051                       94.0    2e-20   Jatropha curcas
ref|XP_010027975.1|  PREDICTED: protein SRG1-like                     94.0    3e-20   Eucalyptus grandis [rose gum]
ref|XP_004488689.1|  PREDICTED: protein SRG1-like                     94.0    3e-20   Cicer arietinum [garbanzo]
ref|XP_003524845.1|  PREDICTED: protein SRG1-like                     94.0    3e-20   Glycine max [soybeans]
ref|XP_004233001.1|  PREDICTED: protein SRG1-like                     93.6    3e-20   Solanum lycopersicum
ref|XP_006449603.1|  hypothetical protein CICLE_v10015853mg           93.6    3e-20   
ref|XP_008463796.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  93.6    3e-20   Cucumis melo [Oriental melon]
gb|KEH27900.1|  flavonol synthase/flavanone 3-hydroxylase             93.2    3e-20   Medicago truncatula
ref|XP_009376707.1|  PREDICTED: protein SRG1-like                     93.6    3e-20   Pyrus x bretschneideri [bai li]
ref|XP_007025217.1|  Senescence-related gene 1                        93.6    3e-20   
ref|XP_006378697.1|  hypothetical protein POPTR_0010s20850g           93.6    3e-20   Populus trichocarpa [western balsam poplar]
gb|KEH27901.1|  flavonol synthase/flavanone 3-hydroxylase             93.2    4e-20   Medicago truncatula
ref|XP_004301702.1|  PREDICTED: S-norcoclaurine synthase 1-like       93.2    4e-20   Fragaria vesca subsp. vesca
gb|AGL52586.1|  2-oxoglutarate/Fe2+-dependent dioxygenase             93.2    4e-20   Papaver somniferum
gb|KDP20395.1|  hypothetical protein JCGZ_05278                       93.2    5e-20   Jatropha curcas
ref|XP_006355571.1|  PREDICTED: protein SRG1-like                     93.2    5e-20   Solanum tuberosum [potatoes]
ref|XP_002519769.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  93.2    5e-20   
ref|XP_006413319.1|  hypothetical protein EUTSA_v10025577mg           93.2    5e-20   Eutrema salsugineum [saltwater cress]
ref|XP_004513256.1|  PREDICTED: protein SRG1-like                     92.8    5e-20   
emb|CDY52434.1|  BnaA07g39110D                                        92.8    5e-20   Brassica napus [oilseed rape]
ref|XP_010654354.1|  PREDICTED: protein SRG1-like                     92.8    5e-20   Vitis vinifera
ref|XP_011085299.1|  PREDICTED: protein SRG1-like                     92.8    6e-20   Sesamum indicum [beniseed]
ref|XP_007207795.1|  hypothetical protein PRUPE_ppa025000mg           92.4    8e-20   
gb|KHN25971.1|  Protein SRG1                                          94.0    8e-20   Glycine soja [wild soybean]
emb|CDX88453.1|  BnaC06g38970D                                        92.4    9e-20   
gb|KHG08200.1|  S-norcoclaurine synthase 1                            92.4    9e-20   Gossypium arboreum [tree cotton]
ref|XP_002890198.1|  hypothetical protein ARALYDRAFT_889094           92.4    9e-20   
gb|ACU21203.1|  unknown                                               91.7    1e-19   Glycine max [soybeans]
ref|XP_006416751.1|  hypothetical protein EUTSA_v10008010mg           92.0    1e-19   Eutrema salsugineum [saltwater cress]
ref|XP_010107326.1|  Protein SRG1                                     92.0    1e-19   Morus notabilis
ref|XP_006429134.1|  hypothetical protein CICLE_v10011334mg           94.4    1e-19   
gb|KHG12687.1|  S-norcoclaurine synthase 1                            92.0    1e-19   Gossypium arboreum [tree cotton]
gb|KJB51686.1|  hypothetical protein B456_008G228400                  92.0    1e-19   Gossypium raimondii
gb|KHG18773.1|  S-norcoclaurine synthase 1                            92.0    1e-19   Gossypium arboreum [tree cotton]
gb|KHN29183.1|  Protein SRG1                                          92.0    1e-19   Glycine soja [wild soybean]
ref|XP_003614581.1|  Protein SRG1                                     91.7    1e-19   Medicago truncatula
ref|XP_003531421.1|  PREDICTED: protein SRG1-like                     91.7    1e-19   Glycine max [soybeans]
ref|XP_008242498.1|  PREDICTED: protein SRG1-like                     91.7    1e-19   
ref|XP_003518805.1|  PREDICTED: protein SRG1                          91.7    1e-19   Glycine max [soybeans]
ref|XP_006435645.1|  hypothetical protein CICLE_v10033449mg           91.7    2e-19   
ref|XP_004490336.1|  PREDICTED: protein SRG1-like                     91.7    2e-19   Cicer arietinum [garbanzo]
ref|XP_006355573.1|  PREDICTED: protein SRG1-like                     91.7    2e-19   
gb|KEH22932.1|  2OG-Fe(II) oxygenase family oxidoreductase            91.7    2e-19   Medicago truncatula
ref|XP_003638391.1|  Protein SRG1                                     88.2    2e-19   
ref|XP_010665638.1|  PREDICTED: protein SRG1-like                     91.7    2e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH38517.1|  2OG-Fe(II) oxygenase family oxidoreductase            91.7    2e-19   Medicago truncatula
ref|XP_009137512.1|  PREDICTED: protein SRG1-like                     91.7    2e-19   Brassica rapa
gb|KHG05552.1|  S-norcoclaurine synthase 1                            91.3    2e-19   Gossypium arboreum [tree cotton]
ref|XP_006305827.1|  hypothetical protein CARUB_v10010858mg           91.7    2e-19   Capsella rubella
ref|XP_011085296.1|  PREDICTED: protein SRG1-like                     91.3    2e-19   
ref|XP_009106564.1|  PREDICTED: protein SRG1                          91.3    2e-19   Brassica rapa
gb|KHN36942.1|  Protein SRG1                                          91.3    2e-19   Glycine soja [wild soybean]
ref|XP_006439037.1|  hypothetical protein CICLE_v10031934mg           91.3    2e-19   Citrus clementina [clementine]
ref|XP_008373604.1|  PREDICTED: S-norcoclaurine synthase 1-like       91.3    2e-19   
ref|XP_006452694.1|  hypothetical protein CICLE_v10010627mg           90.9    2e-19   
ref|XP_006482819.1|  PREDICTED: protein SRG1-like                     91.3    2e-19   Citrus sinensis [apfelsine]
ref|XP_002268794.1|  PREDICTED: protein SRG1-like                     91.3    2e-19   Vitis vinifera
ref|NP_001240998.1|  uncharacterized protein LOC100786574             91.3    3e-19   Glycine max [soybeans]
ref|XP_010057209.1|  PREDICTED: protein SRG1-like                     91.3    3e-19   Eucalyptus grandis [rose gum]
ref|XP_010057212.1|  PREDICTED: protein SRG1-like                     90.9    3e-19   Eucalyptus grandis [rose gum]
ref|XP_009371222.1|  PREDICTED: S-norcoclaurine synthase 1-like       90.9    3e-19   Pyrus x bretschneideri [bai li]
ref|XP_003517890.1|  PREDICTED: protein SRG1-like isoform X1          90.9    3e-19   
ref|XP_010057206.1|  PREDICTED: protein SRG1-like isoform X1          90.9    3e-19   Eucalyptus grandis [rose gum]
ref|XP_002869680.1|  oxidoreductase                                   90.9    3e-19   
ref|XP_009109220.1|  PREDICTED: protein SRG1-like isoform X2          90.5    3e-19   Brassica rapa
gb|KDP23860.1|  hypothetical protein JCGZ_27165                       90.9    3e-19   Jatropha curcas
ref|XP_004233004.1|  PREDICTED: protein SRG1-like                     90.9    3e-19   Solanum lycopersicum
ref|XP_009109219.1|  PREDICTED: protein SRG1-like isoform X1          90.9    3e-19   Brassica rapa
ref|XP_004490335.1|  PREDICTED: protein SRG1-like isoform X2          90.5    4e-19   
ref|XP_010429681.1|  PREDICTED: protein SRG1-like                     90.9    4e-19   Camelina sativa [gold-of-pleasure]
ref|XP_004232992.1|  PREDICTED: protein SRG1                          90.5    4e-19   
ref|XP_011002650.1|  PREDICTED: S-norcoclaurine synthase 1-like       90.5    4e-19   Populus euphratica
emb|CDX81796.1|  BnaC08g38050D                                        90.5    4e-19   
ref|XP_002278096.3|  PREDICTED: protein SRG1-like                     90.5    4e-19   Vitis vinifera
ref|XP_004490334.1|  PREDICTED: protein SRG1-like isoform X1          90.1    5e-19   Cicer arietinum [garbanzo]
ref|XP_009140810.1|  PREDICTED: protein SRG1-like                     90.5    5e-19   
emb|CBI30795.3|  unnamed protein product                              91.7    5e-19   Vitis vinifera
ref|XP_003638405.1|  Protein SRG1                                     90.1    5e-19   
gb|KEH22929.1|  2OG-Fe(II) oxygenase family oxidoreductase            90.1    6e-19   Medicago truncatula
ref|XP_010459259.1|  PREDICTED: protein SRG1-like                     90.1    6e-19   Camelina sativa [gold-of-pleasure]
emb|CDX92689.1|  BnaC07g39470D                                        90.1    6e-19   
ref|XP_006467559.1|  PREDICTED: protein SRG1-like isoform X2          89.7    7e-19   Citrus sinensis [apfelsine]
emb|CDP14579.1|  unnamed protein product                              90.1    7e-19   Coffea canephora [robusta coffee]
gb|KDO69142.1|  hypothetical protein CISIN_1g047368mg                 90.1    7e-19   Citrus sinensis [apfelsine]
ref|XP_006301213.1|  hypothetical protein CARUB_v10021617mg           89.7    7e-19   
ref|XP_006435684.1|  hypothetical protein CICLE_v10033625mg           89.7    8e-19   
gb|KDO69078.1|  hypothetical protein CISIN_1g046496mg                 89.7    8e-19   
ref|XP_007025223.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  89.4    8e-19   
ref|XP_011468464.1|  PREDICTED: protein SRG1-like                     89.4    8e-19   
ref|XP_010498038.1|  PREDICTED: protein SRG1-like                     89.7    9e-19   
ref|XP_010498039.1|  PREDICTED: protein SRG1-like                     89.7    9e-19   
ref|XP_007025222.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  89.7    9e-19   
gb|KDO37893.1|  hypothetical protein CISIN_1g041579mg                 89.4    9e-19   
ref|XP_010476833.1|  PREDICTED: protein SRG1-like                     89.4    9e-19   
ref|XP_006467558.1|  PREDICTED: protein SRG1-like isoform X1          89.7    1e-18   
ref|XP_007039569.1|  S-norcoclaurine synthase 1, putative             89.7    1e-18   
emb|CBI30521.3|  unnamed protein product                              92.0    1e-18   
ref|XP_003614583.1|  Protein SRG1                                     89.4    1e-18   
gb|KEH22931.1|  2OG-Fe(II) oxygenase family oxidoreductase            89.4    1e-18   
ref|XP_006442334.1|  hypothetical protein CICLE_v10023680mg           87.0    1e-18   
gb|KHN19470.1|  Protein SRG1                                          89.4    1e-18   
ref|NP_001242069.1|  uncharacterized protein LOC100777264             89.0    1e-18   
gb|KHM98992.1|  Codeine O-demethylase                                 88.6    1e-18   
ref|XP_006436777.1|  hypothetical protein CICLE_v10031948mg           89.0    1e-18   
gb|KDP21180.1|  hypothetical protein JCGZ_21651                       89.0    2e-18   
ref|NP_177976.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  89.0    2e-18   
ref|XP_006355574.1|  PREDICTED: protein SRG1-like                     89.0    2e-18   
ref|XP_006355624.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  88.6    2e-18   
ref|XP_011085300.1|  PREDICTED: protein SRG1-like                     89.0    2e-18   
ref|XP_007025221.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  89.4    3e-18   
ref|XP_009117729.1|  PREDICTED: protein SRG1                          88.2    3e-18   
gb|KHG24159.1|  S-norcoclaurine synthase 1                            87.8    3e-18   
gb|KFK42230.1|  hypothetical protein AALP_AA2G228500                  88.2    3e-18   
ref|XP_006602603.1|  PREDICTED: protein SRG1-like isoform X2          87.8    3e-18   
gb|KFK33253.1|  hypothetical protein AALP_AA6G350500                  88.2    3e-18   
gb|AFK33687.1|  unknown                                               84.7    3e-18   
ref|XP_010525534.1|  PREDICTED: protein SRG1-like                     87.8    3e-18   
gb|AFK37891.1|  unknown                                               87.4    4e-18   
ref|XP_003552185.2|  PREDICTED: protein SRG1-like isoform X1          88.2    4e-18   
ref|XP_006855491.1|  hypothetical protein AMTR_s00057p00196790        87.8    4e-18   
ref|XP_010537691.1|  PREDICTED: protein SRG1-like isoform X1          87.4    5e-18   
ref|XP_010537692.1|  PREDICTED: protein SRG1-like isoform X2          87.4    5e-18   
ref|XP_003529241.1|  PREDICTED: codeine O-demethylase-like            87.8    5e-18   
emb|CDY21769.1|  BnaA09g45200D                                        87.4    5e-18   
ref|XP_006355570.1|  PREDICTED: protein SRG1-like                     87.4    5e-18   
ref|XP_007223329.1|  hypothetical protein PRUPE_ppa007361mg           87.4    6e-18   
ref|NP_173144.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  87.4    6e-18   
ref|XP_006644154.1|  PREDICTED: protein SRG1-like                     87.4    6e-18   
ref|XP_004492177.1|  PREDICTED: protein SRG1-like                     87.4    6e-18   
gb|KJB64629.1|  hypothetical protein B456_010G058400                  87.0    6e-18   
ref|XP_002269432.1|  PREDICTED: protein SRG1                          87.0    6e-18   
ref|XP_007158816.1|  hypothetical protein PHAVU_002G184400g           87.0    7e-18   
gb|KJB76751.1|  hypothetical protein B456_012G105300                  87.0    7e-18   
ref|XP_011028238.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  87.0    7e-18   
emb|CBI16709.3|  unnamed protein product                              87.0    7e-18   
ref|XP_010053574.1|  PREDICTED: S-norcoclaurine synthase 1-like       87.0    7e-18   
ref|XP_011028237.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  87.0    7e-18   
ref|XP_010459260.1|  PREDICTED: protein SRG1-like                     87.0    7e-18   
ref|XP_008439690.1|  PREDICTED: protein SRG1-like                     87.4    7e-18   
ref|XP_010476835.1|  PREDICTED: protein SRG1                          87.0    7e-18   
emb|CDP18687.1|  unnamed protein product                              85.1    7e-18   
ref|XP_010498040.1|  PREDICTED: protein SRG1-like                     87.0    8e-18   
ref|XP_003552186.2|  PREDICTED: protein SRG1-like                     87.0    9e-18   
ref|XP_009799621.1|  PREDICTED: protein SRG1-like isoform X2          86.3    1e-17   
ref|XP_004134481.1|  PREDICTED: protein SRG1-like                     86.7    1e-17   
gb|KEH27895.1|  2OG-Fe(II) oxygenase family oxidoreductase            86.7    1e-17   
ref|XP_004159844.1|  PREDICTED: LOW QUALITY PROTEIN: protein SRG1...  86.7    1e-17   
ref|XP_011042009.1|  PREDICTED: protein SRG1-like                     86.3    1e-17   
gb|AFK45966.1|  unknown                                               86.3    1e-17   
gb|KJB76752.1|  hypothetical protein B456_012G105300                  86.3    1e-17   
gb|KJB76753.1|  hypothetical protein B456_012G105300                  86.7    1e-17   
ref|XP_009799618.1|  PREDICTED: protein SRG1-like isoform X1          86.3    1e-17   
ref|XP_002527641.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  86.3    1e-17   
ref|XP_002889198.1|  oxidoreductase                                   85.5    2e-17   
ref|XP_010053577.1|  PREDICTED: S-norcoclaurine synthase 1-like       85.5    2e-17   
gb|KJB64633.1|  hypothetical protein B456_010G058800                  85.5    2e-17   
gb|KEH17542.1|  2OG-Fe(II) oxygenase family oxidoreductase, putative  83.6    2e-17   
gb|KEH22933.1|  2OG-Fe(II) oxygenase family oxidoreductase            85.5    3e-17   
ref|XP_010448855.1|  PREDICTED: protein SRG1-like                     85.5    3e-17   
ref|XP_007009259.1|  2-oxoglutarate and Fe(II)-dependent oxygenas...  85.5    3e-17   
ref|XP_010057207.1|  PREDICTED: protein SRG1-like isoform X2          85.5    3e-17   
gb|KJB25365.1|  hypothetical protein B456_004G188000                  85.5    3e-17   
gb|KJB74014.1|  hypothetical protein B456_011G267300                  84.7    3e-17   
ref|XP_002313472.1|  hypothetical protein POPTR_0009s02780g           85.5    3e-17   
ref|XP_008644315.1|  PREDICTED: S-norcoclaurine synthase 1-like       85.5    3e-17   
gb|KHN29927.1|  Protein SRG1-like protein                             85.1    3e-17   
ref|NP_001239868.1|  uncharacterized protein LOC100780588             84.0    3e-17   
ref|XP_004967582.1|  PREDICTED: S-norcoclaurine synthase 1-like i...  85.1    4e-17   
gb|KJB76103.1|  hypothetical protein B456_012G071800                  85.5    4e-17   
gb|KEH33163.1|  2OG-Fe(II) oxygenase family oxidoreductase            84.7    4e-17   
ref|XP_008240674.1|  PREDICTED: protein SRG1-like                     84.7    4e-17   
emb|CDP08365.1|  unnamed protein product                              85.1    4e-17   
gb|KEH33162.1|  2OG-Fe(II) oxygenase family oxidoreductase            85.1    4e-17   
ref|XP_010540138.1|  PREDICTED: protein SRG1-like                     85.5    4e-17   
gb|KJB74015.1|  hypothetical protein B456_011G267300                  85.1    4e-17   
sp|A2A1A0.1|NCS1_COPJA  RecName: Full=S-norcoclaurine synthase 1;...  84.7    4e-17   
ref|XP_009382428.1|  PREDICTED: S-norcoclaurine synthase 1-like       84.7    5e-17   
ref|XP_008438869.1|  PREDICTED: protein SRG1                          84.7    6e-17   
ref|XP_008223172.1|  PREDICTED: protein SRG1                          84.7    6e-17   
gb|AHW42455.1|  GA2ox5                                                84.3    7e-17   
dbj|BAC42769.1|  SRG1 like protein                                    84.3    7e-17   
ref|XP_007149079.1|  hypothetical protein PHAVU_005G039300g           84.3    7e-17   
ref|XP_009382430.1|  PREDICTED: S-norcoclaurine synthase 1-like       84.3    8e-17   
ref|XP_009109221.1|  PREDICTED: protein SRG1-like                     84.3    8e-17   
ref|XP_002267208.1|  PREDICTED: protein SRG1                          84.3    8e-17   
ref|XP_008803154.1|  PREDICTED: protein SRG1-like                     84.3    8e-17   
ref|XP_010057197.1|  PREDICTED: protein SRG1-like isoform X1          84.0    9e-17   
ref|XP_006355572.1|  PREDICTED: protein SRG1-like                     84.0    9e-17   
sp|D4N502.1|DIOX3_PAPSO  RecName: Full=Codeine O-demethylase          84.0    1e-16   
gb|KHN04712.1|  S-norcoclaurine synthase 1                            83.6    1e-16   
gb|AFN53719.1|  putative Fe(II) oxygenase superfamily protein         86.3    1e-16   
ref|XP_006378698.1|  hypothetical protein POPTR_0010s20860g           83.2    1e-16   
gb|KDP21182.1|  hypothetical protein JCGZ_21653                       83.6    1e-16   
gb|KEH17544.1|  2OG-Fe(II) oxygenase family oxidoreductase            82.8    1e-16   
ref|XP_010476836.1|  PREDICTED: protein SRG1-like                     83.6    2e-16   
ref|XP_002314207.1|  hypothetical protein POPTR_0009s03100g           83.6    2e-16   
ref|XP_002279422.2|  PREDICTED: S-norcoclaurine synthase 1 isofor...  83.2    2e-16   
gb|KEH17543.1|  2OG-Fe(II) oxygenase family oxidoreductase            83.2    2e-16   
gb|KJB72664.1|  hypothetical protein B456_011G188800                  82.4    2e-16   
ref|XP_010034113.1|  PREDICTED: protein SRG1-like                     83.2    2e-16   
ref|XP_010050492.1|  PREDICTED: protein SRG1-like                     83.2    2e-16   
ref|XP_006351628.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  80.9    2e-16   
gb|KDP21181.1|  hypothetical protein JCGZ_21652                       83.2    2e-16   
gb|EYU28157.1|  hypothetical protein MIMGU_mgv1a016759mg              79.7    2e-16   
gb|KJB72663.1|  hypothetical protein B456_011G188800                  82.8    2e-16   
ref|XP_010050489.1|  PREDICTED: protein SRG1-like                     82.8    3e-16   
ref|XP_010057211.1|  PREDICTED: protein SRG1-like                     82.8    3e-16   
gb|KDP21185.1|  hypothetical protein JCGZ_21656                       82.0    3e-16   
ref|XP_010664087.1|  PREDICTED: S-norcoclaurine synthase 1-like       82.4    3e-16   
ref|XP_010919592.1|  PREDICTED: S-norcoclaurine synthase 1-like       82.4    3e-16   
ref|XP_008242510.1|  PREDICTED: protein SRG1-like                     82.4    3e-16   
ref|XP_009117731.1|  PREDICTED: protein SRG1-like                     82.4    3e-16   
ref|XP_010662429.1|  PREDICTED: protein SRG1 isoform X2               82.0    4e-16   
ref|XP_010662431.1|  PREDICTED: protein SRG1 isoform X3               82.0    4e-16   
ref|XP_002267405.1|  PREDICTED: protein SRG1 isoform X1               82.4    4e-16   
emb|CAN60619.1|  hypothetical protein VITISV_010885                   82.0    4e-16   
gb|AFK48283.1|  unknown                                               81.3    5e-16   
emb|CBI33964.3|  unnamed protein product                              81.3    5e-16   
ref|XP_010540139.1|  PREDICTED: protein SRG1-like                     82.4    5e-16   
ref|XP_008802804.1|  PREDICTED: S-norcoclaurine synthase 1-like       82.0    5e-16   
ref|XP_002890197.1|  predicted protein                                81.3    5e-16   
ref|XP_006579891.1|  PREDICTED: codeine O-demethylase-like            80.9    6e-16   
ref|XP_009383076.1|  PREDICTED: S-norcoclaurine synthase 1-like       80.1    6e-16   
ref|XP_010664098.1|  PREDICTED: S-norcoclaurine synthase 1 isofor...  81.6    6e-16   
ref|XP_009382429.1|  PREDICTED: S-norcoclaurine synthase 1-like       81.6    6e-16   
ref|XP_004305191.1|  PREDICTED: protein SRG1-like                     81.6    7e-16   
ref|XP_009610870.1|  PREDICTED: protein SRG1-like                     81.6    7e-16   
gb|KJB69606.1|  hypothetical protein B456_011G034700                  81.6    8e-16   
gb|AHW42458.1|  GA2ox8                                                81.6    8e-16   
gb|AES78791.2|  2OG-Fe(II) oxygenase family oxidoreductase, putative  81.3    8e-16   
ref|XP_004492163.1|  PREDICTED: protein SRG1-like                     81.6    8e-16   
ref|XP_003622573.1|  Protein SRG1                                     81.3    9e-16   
ref|XP_008240663.1|  PREDICTED: protein SRG1-like                     81.3    9e-16   
ref|XP_009338589.1|  PREDICTED: protein SRG1-like                     81.3    9e-16   
ref|XP_009338608.1|  PREDICTED: protein SRG1-like                     81.3    9e-16   
ref|XP_003556637.1|  PREDICTED: protein SRG1-like                     81.3    1e-15   
ref|XP_002279355.1|  PREDICTED: S-norcoclaurine synthase 1            81.3    1e-15   
ref|XP_006595433.1|  PREDICTED: protein SRG1-like                     77.4    1e-15   
gb|KHF98196.1|  Protein SRG1 -like protein                            81.3    1e-15   
emb|CAN69330.1|  hypothetical protein VITISV_016336                   80.9    1e-15   
gb|KHF98860.1|  Protein SRG1 -like protein                            80.9    1e-15   
ref|XP_004302751.1|  PREDICTED: protein SRG1-like                     80.5    2e-15   
emb|CDP12963.1|  unnamed protein product                              79.0    2e-15   
gb|AFK43602.1|  unknown                                               79.3    2e-15   
ref|XP_006432909.1|  hypothetical protein CICLE_v10003168mg           78.2    2e-15   
sp|D4N500.1|DIOX1_PAPSO  RecName: Full=Thebaine 6-O-demethylase       80.5    2e-15   
ref|XP_004296820.1|  PREDICTED: protein SRG1                          80.5    2e-15   
ref|XP_010937784.1|  PREDICTED: protein SRG1-like                     79.3    2e-15   
ref|XP_009382431.1|  PREDICTED: S-norcoclaurine synthase 1-like       80.1    2e-15   
emb|CBI16708.3|  unnamed protein product                              79.7    3e-15   
sp|D4N501.1|DIOX2_PAPSO  RecName: Full=Probable 2-oxoglutarate/Fe...  80.1    3e-15   
ref|XP_009382555.1|  PREDICTED: protein SRG1-like                     80.1    3e-15   
gb|KJB76104.1|  hypothetical protein B456_012G071900                  80.1    3e-15   
emb|CDP06586.1|  unnamed protein product                              80.9    3e-15   
ref|XP_008363900.1|  PREDICTED: S-norcoclaurine synthase 1-like       77.4    3e-15   
ref|NP_194261.1|  2-oxoglutarate (2OG) and Fe(II)-dependent oxyge...  79.7    3e-15   
ref|XP_008240653.1|  PREDICTED: protein SRG1-like isoform X2          79.0    4e-15   
ref|XP_008240648.1|  PREDICTED: protein SRG1-like isoform X1          79.7    4e-15   
ref|XP_011076801.1|  PREDICTED: probable 2-oxoglutarate/Fe(II)-de...  79.7    4e-15   
ref|XP_010050574.1|  PREDICTED: protein SRG1-like                     79.7    4e-15   
gb|KEH23007.1|  2OG-Fe(II) oxygenase family oxidoreductase            79.7    4e-15   
gb|AFK46862.1|  unknown                                               79.7    4e-15   
ref|XP_010259688.1|  PREDICTED: protein SRG1-like                     79.7    4e-15   
gb|KDP30652.1|  hypothetical protein JCGZ_16217                       78.6    4e-15   
ref|XP_009610868.1|  PREDICTED: protein SRG1-like isoform X1          79.3    5e-15   
ref|XP_004302752.1|  PREDICTED: protein SRG1-like                     79.3    5e-15   
emb|CAN72414.1|  hypothetical protein VITISV_032872                   79.7    5e-15   
ref|XP_004134607.1|  PREDICTED: protein SRG1-like                     79.3    5e-15   
ref|XP_003565023.1|  PREDICTED: protein SRG1                          79.3    5e-15   
ref|NP_001042987.1|  Os01g0352100                                     79.0    5e-15   
emb|CDX92690.1|  BnaC07g39480D                                        77.8    6e-15   
gb|ACG42152.1|  flavonol synthase/flavanone 3-hydroxylase             78.6    6e-15   
ref|XP_007207626.1|  hypothetical protein PRUPE_ppa020460mg           79.0    6e-15   
ref|XP_011046705.1|  PREDICTED: protein SRG1-like                     75.1    6e-15   
ref|XP_002532986.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  79.3    7e-15   
emb|CDP08368.1|  unnamed protein product                              79.0    7e-15   
gb|KHG06473.1|  Protein SRG1 -like protein                            79.0    7e-15   
gb|KJB12926.1|  hypothetical protein B456_002G045500                  78.6    8e-15   
ref|XP_002279625.1|  PREDICTED: S-norcoclaurine synthase 1            78.6    9e-15   
ref|XP_002512155.1|  Flavonol synthase/flavanone 3-hydroxylase, p...  77.8    9e-15   
ref|XP_008778925.1|  PREDICTED: protein SRG1-like                     77.8    1e-14   
gb|KEH40722.1|  2OG-Fe(II) oxygenase family oxidoreductase            78.6    1e-14   
ref|XP_008796105.1|  PREDICTED: S-norcoclaurine synthase 1-like       78.6    1e-14   
gb|KJB17211.1|  hypothetical protein B456_002G156200                  78.6    1e-14   
ref|XP_009382554.1|  PREDICTED: protein SRG1-like                     78.6    1e-14   
gb|EPS71522.1|  hypothetical protein M569_03236                       78.2    1e-14   
gb|KJB17210.1|  hypothetical protein B456_002G156200                  78.6    1e-14   
ref|XP_002270646.2|  PREDICTED: protein SRG1-like                     79.3    1e-14   
ref|XP_004971189.1|  PREDICTED: protein SRG1-like                     78.2    1e-14   
ref|XP_008387794.1|  PREDICTED: protein SRG1-like                     78.2    1e-14   
ref|XP_009149139.1|  PREDICTED: protein SRG1-like                     78.2    1e-14   
ref|XP_002270514.1|  PREDICTED: protein SRG1-like                     77.8    2e-14   
ref|XP_007153174.1|  hypothetical protein PHAVU_003G013200g           77.8    2e-14   
ref|XP_007029342.1|  Senescence-related gene 1                        77.8    2e-14   
ref|XP_003632980.1|  PREDICTED: protein SRG1-like                     77.8    2e-14   
ref|XP_009773005.1|  PREDICTED: protein SRG1-like                     75.9    2e-14   
ref|XP_009352238.1|  PREDICTED: protein SRG1-like                     77.8    2e-14   
ref|NP_001042986.1|  Os01g0351800                                     77.4    2e-14   
ref|XP_002279404.1|  PREDICTED: S-norcoclaurine synthase 1            77.4    2e-14   
ref|XP_004967580.1|  PREDICTED: S-norcoclaurine synthase 1-like       77.4    2e-14   
gb|EAY73950.1|  hypothetical protein OsI_01835                        77.4    2e-14   
ref|XP_006489112.1|  PREDICTED: protein SRG1-like                     77.4    2e-14   
ref|XP_006419614.1|  hypothetical protein CICLE_v10005225mg           77.4    2e-14   
ref|XP_006355628.1|  PREDICTED: protein SRG1-like                     77.4    2e-14   
gb|KJB15029.1|  hypothetical protein B456_002G1561001                 75.5    3e-14   
ref|XP_010047720.1|  PREDICTED: protein SRG1-like                     77.4    3e-14   



>ref|XP_009772022.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=365

 Score =   134 bits (337),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 70/115 (61%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +2

Query  44   IMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-------PSAPAQREIPVI  202
            +ME ++++ TLGGTL VP VQELA  SPE VP RY RDD D        S      IP+I
Sbjct  1    MMEENLAT-TLGGTLAVPSVQELATDSPEKVPARYVRDDQDFSPIKSSTSISFSDNIPII  59

Query  203  NMSNLLQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            NM +LL GD  ELKKLD ACK+WGFFQLI+HGVS SL+EK K DT+DF NLPM+E
Sbjct  60   NMESLLLGDEIELKKLDSACKDWGFFQLINHGVSGSLVEKVKKDTQDFFNLPMDE  114



>ref|XP_009610881.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=357

 Score =   128 bits (322),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 68/115 (59%), Positives = 82/115 (71%), Gaps = 8/115 (7%)
 Frame = +2

Query  44   IMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQRE-------IPVI  202
            +ME ++++ TLGGTL VP VQELAK SPE VP RY RDD D S             IP+I
Sbjct  1    MMEENLAA-TLGGTLAVPSVQELAKDSPEKVPARYLRDDQDFSPIKSSHFISFSDNIPII  59

Query  203  NMSNLLQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            NM +LL GD  ELKKLD ACK+ GFFQ+I+HGVS SL+EK K DT+DF NLPM++
Sbjct  60   NMESLLLGDEIELKKLDSACKDGGFFQVINHGVSGSLVEKVKKDTQDFFNLPMDQ  114



>ref|XP_006355578.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   122 bits (307),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 62/104 (60%), Positives = 74/104 (71%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD----LDPSAPA--QREIPVINMSNLLQGDSE  235
            LGG+L VP VQ+LAK SPE VP RY RDD    L P         IP+INM +LL+GD  
Sbjct  12   LGGSLPVPSVQQLAKGSPENVPARYLRDDDHLLLVPPMMKFDHYNIPIINMESLLRGDEF  71

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E  KLD AC+EWGFFQ+I+HGVS +L+EK K DT+DF NLP+EE
Sbjct  72   EFNKLDSACREWGFFQVINHGVSGTLVEKVKKDTQDFFNLPLEE  115



>ref|XP_007022024.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13549.1| Senescence-related gene 1 [Theobroma cacao]
Length=351

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 4/106 (4%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-PSAPAQ-REIPVINMSNLLQGDS-  232
            S   LG +L VPCVQELAK++   +PPRY R DL+  + PA   EIPVI+M +LL  +S 
Sbjct  3    SKVVLGNSLLVPCVQELAKETMTTLPPRYLRPDLEQTTVPADGLEIPVIDMKSLLCDESM  62

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL KLD ACKEWGFFQL++HGVSSSL+EK KT+ +DF NLPMEE
Sbjct  63   DSELAKLDYACKEWGFFQLVNHGVSSSLMEKTKTEIQDFFNLPMEE  108



>ref|XP_004233003.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=366

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 73/104 (70%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD----LDPSAPA--QREIPVINMSNLLQGDSE  235
            LGG+L VP VQ+L K SPE VP RY RDD    L P         IP+INM +LL+GD  
Sbjct  12   LGGSLPVPSVQQLTKSSPENVPARYRRDDDQLLLVPPMMKFDHYNIPIINMESLLRGDEI  71

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E  KLD AC+EWGFFQ+I+HGVS +L+EK K DT+DF NLP+EE
Sbjct  72   EFNKLDSACREWGFFQVINHGVSGTLVEKVKKDTQDFFNLPLEE  115



>ref|XP_011045559.1| PREDICTED: protein SRG1 [Populus euphratica]
Length=355

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 60/105 (57%), Positives = 75/105 (71%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDS--  232
            LG +L VPCVQELAK +P  +PPRY R D D     PS  +  EIPV++M  LL  +S  
Sbjct  8    LGSSLIVPCVQELAKVNPAAIPPRYIRPDQDQPTIIPSCASVNEIPVVDMRRLLDQESMD  67

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL KL +AC++WGFFQL++H VS+SL+EK KTD +DF NLPMEE
Sbjct  68   SELAKLHLACRDWGFFQLVNHEVSASLLEKVKTDVQDFFNLPMEE  112



>emb|CBI30803.3| unnamed protein product [Vitis vinifera]
Length=181

 Score =   112 bits (279),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 9/108 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD  229
            +LGG+L VPCVQELAK++   VPPRY R + DP       +  +    PVI+ + L+ GD
Sbjct  8    SLGGSLPVPCVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHAPVIDFNRLVSGD  67

Query  230  S--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   EL KL  ACKEWGFFQL +HGV S+L+EK K + ++F NLPMEE
Sbjct  68   SMDSELDKLHYACKEWGFFQLTNHGVISTLVEKVKVEVQEFFNLPMEE  115



>ref|XP_002300453.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85258.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=355

 Score =   115 bits (288),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/105 (55%), Positives = 73/105 (70%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDS--  232
             G +L VPCVQELAK +   +PPRY R D D     PS  +  EIPV++M  LL  +S  
Sbjct  8    FGSSLIVPCVQELAKVNTAAIPPRYIRPDQDQPTIIPSCASVNEIPVVDMQRLLDQESMD  67

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL KL +AC++WGFFQL++H VS+SL+EK KTD +DF NLPMEE
Sbjct  68   SELAKLHLACRDWGFFQLVNHEVSASLLEKVKTDVQDFFNLPMEE  112



>ref|XP_006489681.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=362

 Score =   115 bits (288),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/107 (56%), Positives = 75/107 (70%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD-  229
            S T+G +L VP +QELAK +P IVP R+  +D D     S+  Q  IPVI+M  LL GD 
Sbjct  5    STTMGSSLVVPLIQELAKNTPTIVPSRFTVNDEDHVPLISSSEQVLIPVIDMQKLLSGDF  64

Query  230  -SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KLD AC+EWGFFQL++HGVSSSL+EK K + ++F NLPMEE
Sbjct  65   MDSELGKLDHACREWGFFQLVNHGVSSSLVEKVKVEIQEFFNLPMEE  111



>gb|KDO54069.1| hypothetical protein CISIN_1g023533mg [Citrus sinensis]
Length=281

 Score =   113 bits (282),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/107 (55%), Positives = 75/107 (70%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD-  229
            S T+G +L VP +QELAK +P IVP R+  +D D     S+  Q  IPVI+M  LL GD 
Sbjct  5    STTMGSSLVVPLIQELAKNTPTIVPSRFTVNDEDHVPLISSSEQVLIPVIDMQKLLSGDF  64

Query  230  -SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KLD AC+EWGFFQL++HGVSSSL+EK K + ++F NLPM+E
Sbjct  65   MDSELGKLDHACREWGFFQLVNHGVSSSLVEKVKVEIQEFFNLPMKE  111



>emb|CDP20118.1| unnamed protein product [Coffea canephora]
Length=194

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 73/107 (68%), Gaps = 9/107 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDSE-  235
            LGG+L+VP VQ+L K++P  VP RY R D D      +  +  +IPV++M NL     E 
Sbjct  8    LGGSLKVPFVQDLTKENPSSVPTRYIRPDNDQYPTISNGGSFHQIPVVDMQNLFSSAEEV  67

Query  236  ---ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL+KL  ACKEWGFFQLI+HGVSSSL+EK K++ +DF NLPM E
Sbjct  68   SDLELQKLHSACKEWGFFQLINHGVSSSLVEKLKSEVQDFFNLPMAE  114



>ref|XP_007022033.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13558.1| Senescence-related gene 1 [Theobroma cacao]
Length=639

 Score =   115 bits (288),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/103 (58%), Positives = 72/103 (70%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDS--EE  238
            G +L VP VQELAK+S   +PPRY R DL+      A    EIPVI+M  L+  +S   E
Sbjct  294  GSSLLVPSVQELAKKSIATIPPRYLRPDLEKPIVSDASLMSEIPVIDMEGLVSKESMDSE  353

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD ACKEWGFFQLI+HG+S SL+EK KT+ +DF NLPMEE
Sbjct  354  LAKLDFACKEWGFFQLINHGMSLSLVEKVKTEIQDFFNLPMEE  396


 Score =   107 bits (268),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/103 (55%), Positives = 70/103 (68%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDS--EE  238
            G +L VP VQEL K+S   +PPRY R  L+      A +  EI VI+M  L+  +S   E
Sbjct  9    GSSLLVPSVQELGKKSIATIPPRYLRPYLEKPIVSDAGSMSEIRVIDMEGLVSKESMDSE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD ACKEWGFFQLI+HG+S SL+EK KT+ +DF NLPMEE
Sbjct  69   LAKLDFACKEWGFFQLINHGMSLSLVEKVKTEIQDFFNLPMEE  111



>ref|XP_002271080.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=354

 Score =   112 bits (281),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 73/108 (68%), Gaps = 9/108 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD  229
            +LGG+L VPCVQELAK++   VPPRY R + DP       +  +    PVI+ + L+ GD
Sbjct  8    SLGGSLPVPCVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHAPVIDFNRLVSGD  67

Query  230  S--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   EL KL  ACKEWGFFQL +HGV S+L+EK K + ++F NLPMEE
Sbjct  68   SMDSELDKLHYACKEWGFFQLTNHGVISTLVEKVKVEVQEFFNLPMEE  115



>ref|XP_009772021.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=358

 Score =   111 bits (278),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 57/110 (52%), Positives = 77/110 (70%), Gaps = 3/110 (3%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPA-QREIPVINMSNLLQ  223
            M     +  LGG+++VP VQELAKQ    +P RY RDD D S  +  +E+PVI+M +L  
Sbjct  1    MAMEAHTTELGGSMKVPSVQELAKQKLVTIPSRYVRDDQDRSISSLDKEVPVIDMQHLNS  60

Query  224  GDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             DS   EL+KL  A K+WGFFQLI+HGVSSS++EK K++ ++F NLP+EE
Sbjct  61   TDSMNLELQKLHFAAKDWGFFQLINHGVSSSVVEKMKSEIQEFFNLPLEE  110



>gb|KDO41542.1| hypothetical protein CISIN_1g030400mg [Citrus sinensis]
Length=178

 Score =   107 bits (268),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS-  232
              +GG+L VPCVQEL K    +VPPRY R D D    +      +IPVI+M +LL  +S 
Sbjct  2    AKIGGSLLVPCVQELVKNPMLVVPPRYIRPDQDSPINSDDTLISQIPVIDMQSLLSEESM  61

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL KLD ACKEWGFFQL++HGVSS+ +EK K + + F NL MEE
Sbjct  62   DSELAKLDFACKEWGFFQLVNHGVSSAFLEKLKKEVQGFFNLSMEE  107



>ref|XP_009610877.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=364

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 78/115 (68%), Gaps = 9/115 (8%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP------SAPAQREIPVINM  208
            ME + SS  +G +L+VP VQELAKQ    VPPRY RDD++       S+    ++PVI+M
Sbjct  1    MEEAASSRKIGSSLKVPSVQELAKQQLA-VPPRYIRDDIETPVLTSNSSSILPQVPVIDM  59

Query  209  SNLLQ--GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              LL    D  EL++L  ACKEWGFFQL++HGVSSSL+E  K++ + F +LP+EE
Sbjct  60   EKLLAIGNDDSELQRLHFACKEWGFFQLVNHGVSSSLVENVKSEIRAFFDLPLEE  114



>ref|XP_002528471.1| Naringenin,2-oxoglutarate 3-dioxygenase, putative [Ricinus communis]
 gb|EEF33888.1| Naringenin,2-oxoglutarate 3-dioxygenase, putative [Ricinus communis]
Length=317

 Score =   110 bits (274),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 56/104 (54%), Positives = 72/104 (69%), Gaps = 5/104 (5%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR---EIPVINMSNLLQGDS--E  235
            +LG +L VPCVQELAK S E +PPRY R D D     Q    E+PVI+M  LL  +S   
Sbjct  7    SLGSSLLVPCVQELAKLSLESIPPRYVRQDQDQPINVQNQNVEVPVIDMERLLSQESMHS  66

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KL  AC++WGFFQL++H VS+SL+EK K + ++F NLPME+
Sbjct  67   ELAKLHCACRDWGFFQLVNHQVSASLLEKMKIEVQEFFNLPMEK  110



>ref|XP_010273388.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=366

 Score =   110 bits (275),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 60/116 (52%), Positives = 76/116 (66%), Gaps = 11/116 (9%)
 Frame = +2

Query  44   IMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP------SAPAQREIPVIN  205
            +M  +    TLG ++ VPCVQELAKQ   IVPPRY R    P      S P    IPVI+
Sbjct  4    LMIMATKQWTLGSSILVPCVQELAKQHLVIVPPRYVRSQHPPIISNPDSIPT---IPVID  60

Query  206  MSNLLQGDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            M +LL  +S   EL +L  ACK+WGFFQL++HGVSSSL+EK K + ++F NLP+EE
Sbjct  61   MQSLLSEESMDSELSRLHAACKDWGFFQLVNHGVSSSLVEKTKLEIQEFFNLPLEE  116



>ref|XP_006442328.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
 gb|ESR55568.1| hypothetical protein CICLE_v10020825mg [Citrus clementina]
Length=356

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGD-  229
              +GG+L VPCVQELAK +  +VPPRY R D D +          ++PVI+M +LL  + 
Sbjct  2    AKVGGSLSVPCVQELAKNATLVVPPRYIRADQDATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  230  -SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KLD ACKEWGFFQ+++HGVSS+ +EK K + ++F NL MEE
Sbjct  62   MDSELAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEE  108



>gb|KDO52129.1| hypothetical protein CISIN_1g018426mg [Citrus sinensis]
Length=356

 Score =   110 bits (274),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 7/107 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGD-  229
              +GG+L VPCVQELAK +  +VPPRY R D D +          ++PVI+M +LL  + 
Sbjct  2    AKVGGSLSVPCVQELAKNATLVVPPRYIRADQDATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  230  -SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KLD ACKEWGFFQ+++HGVSS+ +EK K + ++F NL MEE
Sbjct  62   MDSELAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEE  108



>ref|XP_006369971.1| hypothetical protein POPTR_0001s36510g [Populus trichocarpa]
 gb|ERP66540.1| hypothetical protein POPTR_0001s36510g [Populus trichocarpa]
Length=186

 Score =   106 bits (265),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 58/111 (52%), Positives = 69/111 (62%), Gaps = 8/111 (7%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQRE------IPVINMSNLL  220
            +   TLG +L VPCVQELAK+SP  VP RY R D DP      E      IPVI+M  L+
Sbjct  1    MEPATLGKSLLVPCVQELAKESPATVPTRYLRLDQDPPIINNNEVASLPQIPVIDMRRLV  60

Query  221  QGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              +    EL K+D ACKEWGFFQLI+HGV  SL+ K K   ++  NLPMEE
Sbjct  61   SEEQMDLELDKMDRACKEWGFFQLINHGVDDSLVNKVKEGIQELFNLPMEE  111



>ref|XP_006355623.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase-like 
[Solanum tuberosum]
Length=361

 Score =   109 bits (272),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 57/107 (53%), Positives = 75/107 (70%), Gaps = 5/107 (5%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD--PSAPAQREIPVINMSNLL---QG  226
            SS  LG TL+VP V ELAKQ    +P RY RDDL+   S+    ++PVI+M  LL     
Sbjct  5    SSRNLGTTLKVPSVCELAKQELATIPSRYIRDDLEKISSSILLPQVPVIDMEKLLIIGDH  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D+ EL++L  ACKEWGFFQ+++HGVSSSL+EK K++ + F +LPMEE
Sbjct  65   DNSELERLHFACKEWGFFQVVNHGVSSSLLEKVKSEIRAFFDLPMEE  111



>ref|XP_006355625.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   109 bits (272),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/107 (51%), Positives = 76/107 (71%), Gaps = 8/107 (7%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQ---  223
            S  LGG+L+VP VQELAKQ    VPPRY RDD++  + +      ++PVI+M  LL+   
Sbjct  6    SRKLGGSLKVPNVQELAKQQLAAVPPRYIRDDIENQSYSSIVILPQVPVIDMKKLLEIGD  65

Query  224  -GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPM  361
              D  EL++L +ACKEWGFFQL++HGV+SSL++K K++ K F +LPM
Sbjct  66   IDDDSELERLHLACKEWGFFQLVNHGVNSSLMKKVKSEIKAFFDLPM  112



>ref|XP_002269087.1| PREDICTED: protein SRG1 [Vitis vinifera]
 emb|CBI30797.3| unnamed protein product [Vitis vinifera]
Length=366

 Score =   109 bits (272),  Expect = 9e-26, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 72/108 (67%), Gaps = 9/108 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD  229
            +LGG+L VP VQELAK++   VPPRY R + DP       +  +   +PVI+   L+ GD
Sbjct  8    SLGGSLMVPSVQELAKKTLTTVPPRYLRPEQDPPFLSDSSTTCSSIHVPVIDFHRLVSGD  67

Query  230  --SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL KL  ACK+WGFFQL +HGVSS+L+E+ K + ++F NLPMEE
Sbjct  68   VLDSELDKLHYACKDWGFFQLTNHGVSSTLVERVKVEVQEFFNLPMEE  115



>ref|XP_007214442.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
 gb|EMJ15641.1| hypothetical protein PRUPE_ppa024861mg [Prunus persica]
Length=362

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 71/117 (61%), Gaps = 10/117 (9%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAP------AQREIPVINM  208
            ME   S    GG+L VP VQELAK+    +PPRY +              +  EIP I+M
Sbjct  1    MEEKASRSLYGGSLIVPSVQELAKKHIITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDM  60

Query  209  SNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              LL  DS     EL KL  ACKEWGFFQL++HGVSSSL+EK KT+ +DF NLPMEE
Sbjct  61   HKLLSQDSIDSESELAKLHFACKEWGFFQLVNHGVSSSLMEKIKTEVQDFFNLPMEE  117



>ref|XP_004233005.2| PREDICTED: codeine O-demethylase-like [Solanum lycopersicum]
Length=361

 Score =   108 bits (271),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 57/112 (51%), Positives = 79/112 (71%), Gaps = 6/112 (5%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPA--QREIPVINMSNLL  220
            ME S SS  +G TL+VP V+ELAKQ    +P RY RDDL+ ++ +    ++PVI+M  LL
Sbjct  1    MEES-SSRKIGSTLKVPSVRELAKQELAAIPSRYIRDDLEKTSCSILMPQVPVIDMEKLL  59

Query  221  ---QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                 D+ EL++L  ACKEWGFFQ+++HGVSS L+EK K++ + F +LPMEE
Sbjct  60   IIGDHDTAELERLHFACKEWGFFQVVNHGVSSLLLEKVKSEIRAFFDLPMEE  111



>ref|XP_006442335.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
 gb|ESR55575.1| hypothetical protein CICLE_v10020844mg [Citrus clementina]
Length=355

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS-  232
              +GG+L VPCVQEL K    +VPPRY R D D    +      +IPVI+M +LL  +S 
Sbjct  2    AKIGGSLLVPCVQELVKNPMLVVPPRYIRPDQDSPINSDDTLISQIPVIDMQSLLSEESM  61

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL KLD ACKEWGFFQL++HGVSS+ +EK K + + F NL MEE
Sbjct  62   DSELAKLDFACKEWGFFQLVNHGVSSAFLEKLKKEVQGFFNLSMEE  107



>gb|KDO54061.1| hypothetical protein CISIN_1g018035mg [Citrus sinensis]
Length=362

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 57/105 (54%), Positives = 70/105 (67%), Gaps = 6/105 (6%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD--S  232
             +GG+L VPCVQ+LAK+    VPP+Y R D +     +A     +PVI+MS LL  D   
Sbjct  7    NMGGSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLLSADFMD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL K   ACKEWGFFQLI+HGVS+SLIEK K +  +F NLPMEE
Sbjct  67   SELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEE  111



>gb|KJB64626.1| hypothetical protein B456_010G058200 [Gossypium raimondii]
 gb|KJB64627.1| hypothetical protein B456_010G058200 [Gossypium raimondii]
Length=360

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 59/103 (57%), Positives = 71/103 (69%), Gaps = 8/103 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDSEE  238
            LG +L VP VQELAK   + VPPRY R D D     P+ P   ++PVINM  L     EE
Sbjct  10   LGSSLLVPNVQELAKNPLKEVPPRYVRTDEDSPIISPTNPLP-QVPVINMQKL--SSKEE  66

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L++L  ACKEWGFFQLI+HGVS SL+EK K +T++F NLPMEE
Sbjct  67   LEQLHYACKEWGFFQLINHGVSPSLVEKMKMETQEFFNLPMEE  109



>ref|XP_010665636.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=364

 Score =   107 bits (268),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 73/106 (69%), Gaps = 7/106 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQRE-------IPVINMSNLLQGD  229
            TLG ++ VP VQELAK++ E VP  Y + + DP+     E       +P INM  LL GD
Sbjct  10   TLGKSILVPSVQELAKENLETVPETYIQLNQDPTIKLGGEDELNDLKVPTINMKALLAGD  69

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            + EL++L  AC+EWGFFQLI+HGV +SL+E+ K +TK+F NLP+EE
Sbjct  70   NIELERLHSACQEWGFFQLINHGVDTSLVEELKLETKEFFNLPLEE  115



>ref|XP_011005822.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=356

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 57/108 (53%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQRE------IPVINMSNLLQGD  229
             TLG +L VPCVQELAK+SP  VP RY R D DP      E      IPVI+M  L+ G+
Sbjct  4    ATLGKSLAVPCVQELAKESPATVPARYLRLDQDPPIINNNEMASLPQIPVIDMQRLVSGE  63

Query  230  SE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL K+D ACKEWG FQLI+HGV  SL+ + K   ++  NLPMEE
Sbjct  64   QMDIELDKMDRACKEWGVFQLINHGVDDSLVNEVKEGIQELFNLPMEE  111



>ref|XP_002528475.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
 gb|EEF33892.1| Leucoanthocyanidin dioxygenase, putative [Ricinus communis]
Length=364

 Score =   107 bits (267),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 55/97 (57%), Positives = 66/97 (68%), Gaps = 5/97 (5%)
 Frame = +2

Query  92   VPCVQELAKQSPEIVPPRYFRDDLDPSAPA---QREIPVINMSNLLQGDS--EELKKLDI  256
            VPCVQEL K+    VPPRY R D D S  A     E+PVI+M  L   DS   EL KL +
Sbjct  19   VPCVQELVKEPMATVPPRYIRPDQDYSIAAPGDDGEVPVIDMQRLYDPDSIDSELAKLHL  78

Query  257  ACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ACK+WGFFQL++HG+SSSL+EK K + +DF NLPM E
Sbjct  79   ACKDWGFFQLVNHGISSSLLEKMKMEVQDFFNLPMAE  115



>emb|CDP21916.1| unnamed protein product [Coffea canephora]
Length=187

 Score =   104 bits (259),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDD-LDPSAPAQREIPVINMSNLLQGDSE--EL  241
             LG +L+VP VQELAK+    VPPRY R D       +  EIPVI+M  LL  +S   EL
Sbjct  7    NLGSSLKVPYVQELAKEKFASVPPRYIRPDPTKLHGASTEEIPVIDMQRLLSDESVNPEL  66

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  ACKEWGFFQLI+HGVSSSL++K K + + F NL +EE
Sbjct  67   EKLHFACKEWGFFQLINHGVSSSLVDKLKLEMQKFFNLMIEE  108



>ref|XP_007211480.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
 gb|EMJ12679.1| hypothetical protein PRUPE_ppa007597mg [Prunus persica]
Length=362

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 59/116 (51%), Positives = 70/116 (60%), Gaps = 10/116 (9%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAP------AQREIPVINM  208
            ME   S    GG+L VP VQELAK+    +PPRY +              +  EIP I+M
Sbjct  1    MEEKASRSFYGGSLIVPSVQELAKKPVITIPPRYIQPHHHHHQQDQVIFNSDAEIPFIDM  60

Query  209  SNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPME  364
              LL  DS     EL KL  ACKEWGFFQL++HGVSSSL+EK KT+ +DF NLPME
Sbjct  61   HKLLSQDSIDSESELAKLHFACKEWGFFQLVNHGVSSSLMEKIKTEVQDFFNLPME  116



>gb|KDO52128.1| hypothetical protein CISIN_1g035879mg [Citrus sinensis]
Length=356

 Score =   106 bits (264),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = +2

Query  80   GTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGDS--EE  238
            G+L VPCVQELAK    +VPPRY R D D +          ++PVI+M +LL  +S   E
Sbjct  6    GSLSVPCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSE  65

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD ACKEWGFFQ+++HGVSS+ +EK K +  +F NL MEE
Sbjct  66   LAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEE  108



>gb|KEH38521.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=174

 Score =   103 bits (256),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLL--QGDSEE  238
            G +L VP VQELAK+    VPPRY +   D      A +  EIPVI+M  LL  +  S E
Sbjct  9    GTSLLVPSVQELAKEKISTVPPRYIQSQHDELVINEANSILEIPVIDMKKLLSLEYGSLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL +ACK+WGFFQL++H VSSSL+EK K +T+DF NLPM E
Sbjct  69   LSKLHLACKDWGFFQLVNHDVSSSLVEKVKLETQDFFNLPMSE  111



>ref|XP_006477892.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=272

 Score =   105 bits (261),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 69/106 (65%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDD----LDPSAPAQREIPVINMSNLLQGDS-  232
              +GG+L VPCVQEL K    +VPPRY   D    L+       +IPVI+M +LL  +S 
Sbjct  2    AKIGGSLLVPCVQELVKNPMLVVPPRYICPDEDSPLNSDDTLISQIPVIDMQSLLSEESM  61

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL KLD ACKEWGFFQL++HGVSS+ +EK K + K F NL MEE
Sbjct  62   DSELAKLDFACKEWGFFQLVNHGVSSAFLEKVKKEVKGFFNLSMEE  107



>ref|XP_006477805.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=431

 Score =   106 bits (264),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (67%), Gaps = 7/103 (7%)
 Frame = +2

Query  80   GTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGDS--EE  238
            G+L VPCVQELAK    +VPPRY R D D +          ++PVI+M +LL  +S   E
Sbjct  81   GSLSVPCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSE  140

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD ACKEWGFFQ+++HGVSS+ +EK K +  +F NL MEE
Sbjct  141  LAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEE  183



>emb|CDP20503.1| unnamed protein product [Coffea canephora]
Length=360

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 57/101 (56%), Positives = 70/101 (69%), Gaps = 3/101 (3%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD-LDPSAPAQREIPVINMSNLLQGDS--EELK  244
            LGG+L+VP VQELAK+    VPPRY R D       +  EIPVI+M  LL  +S   EL+
Sbjct  8    LGGSLKVPYVQELAKEKFASVPPRYIRPDPTKLHGVSTEEIPVIDMQRLLSDESVNPELE  67

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KL  ACKEWGFFQLI+HGVSSSL++K K + + F NL +EE
Sbjct  68   KLHFACKEWGFFQLINHGVSSSLVDKLKLEMQKFFNLRIEE  108



>ref|XP_006477808.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score =   105 bits (263),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS--E  235
            +GG+L VPCVQEL K    +VPPRY R D D    +      +IPVI+M +LL  +S   
Sbjct  4    IGGSLLVPCVQELVKNPMLVVPPRYIRPDQDSPLNSDDTLISQIPVIDMQSLLSEESMDS  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD ACK+WGFFQL++HGVSS+ +EK K + + F NL MEE
Sbjct  64   ELAKLDSACKDWGFFQLVNHGVSSAFLEKLKKEVQGFFNLSMEE  107



>ref|XP_006428589.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 gb|ESR41829.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=283

 Score =   104 bits (260),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD--S  232
             +G +L VPCVQ+LAK+    VPP+Y R D +     +A     +PVI+MS LL  D   
Sbjct  7    NMGRSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLLSADFMD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL K   ACKEWGFFQLI+HGVS+SLIEK K +  +F NLPMEE
Sbjct  67   SELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEE  111



>ref|XP_006432905.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
 ref|XP_006494091.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR46145.1| hypothetical protein CICLE_v10001623mg [Citrus clementina]
Length=359

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 72/107 (67%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEI-VPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            S  +G +L  P + ELA   P I VPPRY R ++D         + ++ PVI+M  LL G
Sbjct  5    STAIGSSLVEPSILELANNKPLITVPPRYVRPEIDHPLIRNDDSSAQQFPVIDMHKLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD ACKEWGFFQL++HG+SSSL+EK + + +DF NLP++E
Sbjct  65   DDSELEKLDRACKEWGFFQLMNHGMSSSLVEKVRVEIQDFFNLPIDE  111



>gb|KDP21186.1| hypothetical protein JCGZ_21657 [Jatropha curcas]
Length=364

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/113 (50%), Positives = 73/113 (65%), Gaps = 6/113 (5%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSN  214
            ME       LG +L VPCVQELAK+    VPPRY R D D    +      ++P+I+MS 
Sbjct  1    MEMEPELTKLGTSLLVPCVQELAKEPLTNVPPRYLRLDQDSPIVSNSAYLPQVPIIDMSK  60

Query  215  LLQGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L   +S   EL +LD ACKEWGFFQLI+HGVSSSL+E  K + ++F NLP++E
Sbjct  61   LFSQESMDFELDRLDRACKEWGFFQLINHGVSSSLVENVKVEIQEFFNLPVDE  113



>ref|XP_011045561.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=359

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/106 (53%), Positives = 70/106 (66%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDS-  232
             +LG +L VPCVQELAK     VPPRY R D +    A      E+PVI+M  LL  ++ 
Sbjct  6    SSLGSSLLVPCVQELAKDPLVAVPPRYLRYDQEHPIIASHDPVSEVPVIDMQRLLDQETM  65

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL +L +ACK WGFFQL++H VSSSL++K KT  +DF NLPMEE
Sbjct  66   DSELGRLHLACKTWGFFQLVNHCVSSSLLDKMKTQLQDFFNLPMEE  111



>ref|XP_006477891.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score =   105 bits (262),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 71/107 (66%), Gaps = 7/107 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGD-  229
              +GG+L VPCVQELAK    +VPPRY R D + +          ++PVI+M +LL  + 
Sbjct  2    AKVGGSLSVPCVQELAKNDTLVVPPRYIRPDQNATTIISDDALVSKLPVIDMQSLLSEEL  61

Query  230  -SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KLD ACK+WGFFQ+++HGVSS+ +EK K + ++F NL MEE
Sbjct  62   MDSELAKLDSACKDWGFFQMVNHGVSSAFLEKVKKEVQEFFNLSMEE  108



>ref|XP_003546739.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN47490.1| Protein SRG1 [Glycine soja]
Length=353

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 57/100 (57%), Positives = 71/100 (71%), Gaps = 3/100 (3%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDS--EELKK  247
            LG +L VP VQELAKQ+   VP RY +   +  A +  EIP+I+M +LL  +S   EL K
Sbjct  8    LGTSLLVPSVQELAKQNLSTVPHRYIQPQ-NEEAISIPEIPIIDMQSLLSVESCSSELAK  66

Query  248  LDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L +ACKEWGFFQLI+HGVSSSL+EK K + +DF NLPM E
Sbjct  67   LHLACKEWGFFQLINHGVSSSLLEKVKLEIQDFFNLPMSE  106



>ref|XP_006428590.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
 ref|XP_006480427.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 gb|ESR41830.1| hypothetical protein CICLE_v10012028mg [Citrus clementina]
Length=362

 Score =   105 bits (261),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD--S  232
             +G +L VPCVQ+LAK+    VPP+Y R D +     +A     +PVI+MS LL  D   
Sbjct  7    NMGRSLPVPCVQDLAKKPLTNVPPQYIRADQESPFICNADLAANVPVIDMSKLLSADFMD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL K   ACKEWGFFQLI+HGVS+SLIEK K +  +F NLPMEE
Sbjct  67   SELHKFHHACKEWGFFQLINHGVSNSLIEKMKVEIPNFFNLPMEE  111



>ref|XP_006355629.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=366

 Score =   105 bits (261),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREI-------PVINMSNLLQ  223
            S  LGG+L+VP VQELAKQ    VPPRY R++ D +      I       PVI+M  +  
Sbjct  6    SRKLGGSLKVPNVQELAKQQLSGVPPRYIRNNDDENQLYNSSILLPHQLPPVIDMEIIKD  65

Query  224  GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPM  361
             D  EL +  +ACKEWGFFQL++HGVSSSL+EK K++ + F NLPM
Sbjct  66   DDETELNRFHLACKEWGFFQLVNHGVSSSLMEKVKSEIQAFFNLPM  111



>emb|CDP20896.1| unnamed protein product [Coffea canephora]
Length=307

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/102 (55%), Positives = 69/102 (68%), Gaps = 3/102 (3%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDD-LDPSAPAQREIPVINMSNLLQGDSE--EL  241
             LG +L+VP VQELAK+    VPPRY R D       +  EIPVI+M  LL  +S   EL
Sbjct  7    NLGSSLKVPYVQELAKEKFASVPPRYIRPDPTKLHGVSTEEIPVIDMQRLLSDESVNPEL  66

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  ACKEWGFFQLI+HGVSSSL++K K + + F NL +EE
Sbjct  67   EKLHFACKEWGFFQLINHGVSSSLVDKLKLEMQKFFNLTIEE  108



>emb|CDP17938.1| unnamed protein product [Coffea canephora]
Length=178

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 56/101 (55%), Positives = 69/101 (68%), Gaps = 3/101 (3%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD-LDPSAPAQREIPVINMSNLLQGDS--EELK  244
            LG +L+VP VQELAKQ    VPPRY R D       +  EIPVI+M  LL  +S   EL+
Sbjct  8    LGRSLKVPYVQELAKQKFASVPPRYIRPDPTKLHGVSTEEIPVIDMQRLLSDESLNPELE  67

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KL  ACKEWGFFQLI+HGVSSSL++K + + + F NL +EE
Sbjct  68   KLHCACKEWGFFQLINHGVSSSLVDKLELEIQKFFNLTIEE  108



>ref|XP_010095129.1| Protein SRG1 [Morus notabilis]
 gb|EXB58295.1| Protein SRG1 [Morus notabilis]
Length=367

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 77/117 (66%), Gaps = 10/117 (9%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEI--VPPRYFRDDLDPS----APAQREIPVINM  208
            M  + S   LGG+L VP VQELAK++  +  VP RY R D DP+      +  ++PVI+M
Sbjct  1    MAEATSIAKLGGSLAVPSVQELAKETTTLKAVPERYVRRDQDPTFIPNITSLPQVPVIDM  60

Query  209  SNLLQGDSE----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +NLL  + +    EL+KL +A KEWGFFQLI+HGVSS ++E  KT  K+  NLPMEE
Sbjct  61   NNLLSLEKDVLQSELQKLHLASKEWGFFQLINHGVSSLVVEGVKTGIKELFNLPMEE  117



>ref|XP_004233861.2| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC101257141 
[Solanum lycopersicum]
Length=1114

 Score =   108 bits (269),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 75/104 (72%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR--EIPVINMSNLLQ----GDSE  235
            LGG+L+VP VQELAKQ    VP RY RDD++  + +    ++PVI+M  LL+     D  
Sbjct  9    LGGSLKVPNVQELAKQQLAAVPSRYMRDDIENQSYSSILPQVPVIDMKKLLEIGDIDDDS  68

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL +L +ACKEWGFFQL++HGV+SSL++K K++ + F +LPMEE
Sbjct  69   ELVRLHLACKEWGFFQLVNHGVNSSLMKKVKSEIRAFFDLPMEE  112


 Score = 93.2 bits (230),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 56/118 (47%), Positives = 72/118 (61%), Gaps = 12/118 (10%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREI-------PVIN  205
            M     S  LGG+L+V  VQELAKQ    VP RY R + D +      I       PVI+
Sbjct  754  MMEEARSRKLGGSLKVSNVQELAKQQLAGVPSRYIRVNDDENQLYNSSILLPHELAPVID  813

Query  206  MSNLLQ----GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            M  LL+    GD+E L +  +ACKE GFFQL++HGVSSSL+EK K++ + F +LPMEE
Sbjct  814  MKKLLKIIKDGDTE-LNRFHLACKEXGFFQLVNHGVSSSLMEKVKSEIRAFFDLPMEE  870


 Score = 85.5 bits (210),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 47/110 (43%), Positives = 65/110 (59%), Gaps = 3/110 (3%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-PSAPAQREIPVINMSNLLQ  223
            ME +      G +L VP VQELAKQ    +P RY R + + P       +PVI++  L+ 
Sbjct  371  MESTPEKLYFGKSLLVPSVQELAKQHLTNIPARYVRPEQETPVISTGASVPVIDLQKLIS  430

Query  224  GDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            GDS   EL++L  AC++WGF Q+I+HGV+ SL+E  K +      LPMEE
Sbjct  431  GDSMDSELQELHSACQQWGFLQVINHGVTPSLLEDFKREVIQLFKLPMEE  480



>ref|XP_008226353.1| PREDICTED: protein SRG1-like [Prunus mume]
Length=363

 Score =   104 bits (260),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 57/123 (46%), Positives = 74/123 (60%), Gaps = 20/123 (16%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR------------E  190
            ME   S    GG+L VP VQELAK+    +PPRY    + P  P Q+            E
Sbjct  1    MEEKTSGSFYGGSLIVPSVQELAKKPITAIPPRY----IQPHHPEQQDHVMFNPDHDHAE  56

Query  191  IPVINMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLP  358
            +P I+M  LL  +S     EL +L  ACKEWGFFQL++HGVSSSL++K KT+++DF NL 
Sbjct  57   MPFIDMQKLLSQESTDSESELARLHFACKEWGFFQLVNHGVSSSLVDKVKTESQDFFNLA  116

Query  359  MEE  367
            ME+
Sbjct  117  MED  119



>ref|XP_006489639.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=356

 Score =   104 bits (260),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 56/107 (52%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQ--GDS  232
            TLG +L VP VQEL K+    +PPRY R D DP    +    +++P+I+M  LL   GDS
Sbjct  7    TLGSSLAVPYVQELVKEPLTAIPPRYLRPDQDPPFACNTNLSQQLPIIDMDKLLSDSGDS  66

Query  233  --EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL+ L +AC++WGFFQLI+HGVSSSLIEK K +  +F  LPMEE
Sbjct  67   THSELENLHMACRDWGFFQLINHGVSSSLIEKLKQEIPEFFKLPMEE  113



>ref|XP_002300451.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
 gb|EEE85256.1| SENESCENCE-RELATED GENE 1 family protein [Populus trichocarpa]
Length=359

 Score =   104 bits (259),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 56/105 (53%), Positives = 69/105 (66%), Gaps = 6/105 (6%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDS--  232
            +LG +L VPCVQELAK     VPPRY R D +    A      E+PVI+M  LL  ++  
Sbjct  7    SLGSSLLVPCVQELAKDLLVAVPPRYIRYDQEHPIIASHDPVSEVPVIDMQRLLDQETMD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL +L  ACK WGFFQL++H VSSSL++K KT  +DF NLPMEE
Sbjct  67   SELGRLHFACKTWGFFQLVNHCVSSSLLDKMKTQLQDFFNLPMEE  111



>gb|KDP32875.1| hypothetical protein JCGZ_12167 [Jatropha curcas]
Length=359

 Score =   104 bits (259),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 53/101 (52%), Positives = 69/101 (68%), Gaps = 2/101 (2%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGD--SEELK  244
            TLG +L VP VQELAK+    +PPRY R D+     +  ++PVI+MS L   +    EL 
Sbjct  8    TLGSSLIVPSVQELAKEPLTDLPPRYLRPDIGSPIISSIQVPVIDMSKLFSQEFMDIELD  67

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            K   ACK+WGFFQLI+HGVSSSL+EK K + ++F NLPM+E
Sbjct  68   KFHHACKDWGFFQLINHGVSSSLVEKLKVEIQEFFNLPMDE  108



>ref|XP_002519761.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42734.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=360

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 56/114 (49%), Positives = 75/114 (66%), Gaps = 7/114 (6%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMS  211
            ME  +++ TLG +L VP VQELA +S   VP RY R D DP     S+ +  ++PVI+M 
Sbjct  1    MESKVTALTLGSSLPVPSVQELANKSLATVPTRYVRSDQDPPFIPTSSSSSSQVPVIDME  60

Query  212  NLL--QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             LL  Q    EL++   ACK+WGFFQLI+HGVS SL+EK K + ++F NLP +E
Sbjct  61   KLLSEQFMDAELERFHHACKDWGFFQLINHGVSLSLVEKLKIEVQNFFNLPTDE  114



>ref|XP_009799622.1| PREDICTED: protein SRG1-like [Nicotiana sylvestris]
Length=360

 Score =   103 bits (258),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP--SAPAQREIPVINMSNLL  220
            ME + SS  +G TL+VP VQEL KQ    VPPRY RDD++   ++    ++PVI+M  LL
Sbjct  1    MEEAASSRKIGSTLKVPSVQELIKQQVA-VPPRYIRDDIEMPMTSSILPQVPVIDMEKLL  59

Query  221  Q--GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPM  361
                D  EL++L  AC +WGFFQL++HGVSSSL+EK K + + F +LP+
Sbjct  60   AIGNDGSELERLHFACVDWGFFQLVNHGVSSSLVEKVKLEIRAFFDLPL  108



>ref|XP_006432907.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46147.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=283

 Score =   103 bits (256),  Expect = 6e-24, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + ELA   P   VPPRY R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHTLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD ACKEWGFFQL++HGVSSSL+EK K + ++F NLP++E
Sbjct  65   DDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDE  111



>ref|XP_006494094.1| PREDICTED: codeine O-demethylase-like isoform X1 [Citrus sinensis]
Length=359

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + ELA   P   VPPRY R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHTLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD ACKEWGFFQL++HGVSSSL+EK K + ++F NLP++E
Sbjct  65   DDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDE  111



>ref|XP_010272749.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 69/108 (64%), Gaps = 9/108 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD  229
             LG +L VP VQELAK     +PPRY     +P       SAP  +++PVI+M  L   +
Sbjct  7    VLGSSLLVPSVQELAKDPMNTLPPRYVHPGQEPPSNPTSTSAPIVQDLPVIDMQALFSAE  66

Query  230  S--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   EL +LD AC++WGFFQ ++HGVSSSL+EK K+   +F NLPMEE
Sbjct  67   SMDSELARLDTACRDWGFFQFVNHGVSSSLLEKLKSKIHEFFNLPMEE  114



>ref|XP_006442327.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
 gb|ESR55567.1| hypothetical protein CICLE_v10020829mg [Citrus clementina]
Length=356

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 7/103 (7%)
 Frame = +2

Query  80   GTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGDS--EE  238
            G+L V CVQELAK    +VPPRY R D D +          ++PVI+M +LL  +S   E
Sbjct  6    GSLSVHCVQELAKNPTLVVPPRYIRPDQDATTIISDDALVSKLPVIDMQSLLSEESMDSE  65

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD ACKEWGFFQ+++HGVSS+ +EK K +  +F NL MEE
Sbjct  66   LAKLDSACKEWGFFQMVNHGVSSAFLEKVKKEVHEFFNLSMEE  108



>ref|XP_006432906.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
 gb|ESR46146.1| hypothetical protein CICLE_v10001648mg [Citrus clementina]
Length=356

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/107 (49%), Positives = 72/107 (67%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + ELA   P   VPPRY R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGNSLVEPSILELANNLPLTTVPPRYVRPEIDHPLIRNDDSSAQQLPVIDMHTLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD ACKEWGFFQL++HGVSSSL+EK K + ++F NLP++E
Sbjct  65   DDSELEKLDHACKEWGFFQLMNHGVSSSLVEKVKAEIQEFFNLPIDE  111



>ref|XP_003638414.1| SRG1-like protein [Medicago truncatula]
Length=400

 Score =   103 bits (257),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 56/103 (54%), Positives = 69/103 (67%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLL--QGDSEE  238
            G +L VP VQELAK+    VPPRY +   D      A +  EIPVI+M  LL  +  S E
Sbjct  9    GTSLLVPSVQELAKEKISTVPPRYIQSQHDELVINEANSILEIPVIDMKKLLSLEYGSLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL +ACK+WGFFQL++H VSSSL+EK K +T+DF NLPM E
Sbjct  69   LSKLHLACKDWGFFQLVNHDVSSSLVEKVKLETQDFFNLPMSE  111



>ref|XP_010059078.1| PREDICTED: uncharacterized protein LOC104446988 [Eucalyptus grandis]
Length=741

 Score =   105 bits (263),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 57/119 (48%), Positives = 76/119 (64%), Gaps = 8/119 (7%)
 Frame = +2

Query  32   VGHHIMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMS  211
            V  +++ER      LGG+L VP VQELAK++   +PPRY R DLD    +  ++PVI++S
Sbjct  368  VVSNVIERDREKSKLGGSLPVPSVQELAKEAITKLPPRYIRTDLD-HGTSLLQVPVIDLS  426

Query  212  NLLQGDSE-------ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             L   D         EL+KL  ACK+WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  427  KLSSSDGNLGALTESELEKLHSACKDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  485


 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD------PSAPAQREIPVINMSNLLQGDSE  235
            LG +L VPCVQELAK +   VPPRY R D D             ++PVI+M+ L     +
Sbjct  8    LGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTKLSSSHDD  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+KL +AC++WGFFQLI+HGVS +L+E+ K   ++F  LPMEE
Sbjct  68   LVESELEKLHVACRDWGFFQLINHGVSCTLMEEVKLGIQEFFKLPMEE  115



>ref|XP_006432912.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
 gb|ESR46152.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
Length=283

 Score =   102 bits (254),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + +LA   P   VPPR+ R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLVEPSILDLANNQPLTTVPPRFVRPEIDHPLIRNDDTSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD  CKEWGFFQLI+HGVSSSL+EK K + +DF NLP++E
Sbjct  65   DDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_009610880.1| PREDICTED: protein SRG1-like [Nicotiana tomentosiformis]
Length=355

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 72/104 (69%), Gaps = 4/104 (4%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-APAQREIPVINMSNLLQGDSE--  235
            +G L  +++VP VQELAKQ    +P RY RDD D S + + +E+PVI++  L   D    
Sbjct  5    TGELEDSMKVPSVQELAKQKLVTIPSRYVRDDQDRSISSSDKEVPVIDLQRLNSTDHSMN  64

Query  236  -ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPME  364
             EL+KL  A K+WGFFQLI+HGVSSS++EK K++ + F NLP+E
Sbjct  65   LELQKLHFAAKDWGFFQLINHGVSSSVVEKMKSEIQKFFNLPLE  108



>ref|XP_007209291.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
 gb|EMJ10490.1| hypothetical protein PRUPE_ppa007716mg [Prunus persica]
Length=358

 Score =   103 bits (256),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 73/109 (67%), Gaps = 6/109 (6%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIPVINMSNLLQ--  223
            +S   LGG+L V  VQ LA  + + +PPRY R +++    S     +IPV++MS L+   
Sbjct  6    LSRKDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSMEDSLQIPVVDMSKLIGDP  65

Query  224  -GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             G  EEL KL +ACK+WGFFQLI+HGVS  +IEK K+DTK+F  LP+EE
Sbjct  66   LGHGEELAKLHLACKDWGFFQLINHGVSEEVIEKIKSDTKEFFQLPLEE  114



>ref|XP_009376721.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFR---DDLDPSAPAQREIPVINMSNLLQGDS----E  235
            GG+L VP VQEL K+    +PPRY +    ++  S     +IP I+M  LL  +S     
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQPHHQEIISSDHHAHQIPSIDMQKLLSQESTISEA  72

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL +L  AC+EWGFFQL++HGVSSSL+EK KT+T++F NLPMEE
Sbjct  73   ELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEE  116



>ref|XP_006432901.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
 gb|ESR46141.1| hypothetical protein CICLE_v10001620mg [Citrus clementina]
Length=359

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEI-VPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDSE  235
            +G +L  P + ELA   P I +PPRY R ++D         + +++PVI+M  LL GD  
Sbjct  8    IGSSLVEPSILELAHNKPLITIPPRYVRPEMDHPLIRTDDSSAQQLPVIDMHKLLSGDDS  67

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL+KLD ACKEWGF QL++HGVSSSL+EK K + +DF NLP++E
Sbjct  68   ELEKLDRACKEWGFCQLMNHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_009376720.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=360

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFR---DDLDPSAPAQREIPVINMSNLLQGDS----E  235
            GG+L VP VQEL K+    +PPRY +    ++  S     +IP I+M  LL  +S     
Sbjct  13   GGSLLVPSVQELVKKPILTIPPRYIQPHHQEIISSDHHAHQIPSIDMQKLLSQESTISEA  72

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL +L  AC+EWGFFQL++HGVSSSL+EK KT+T++F NLPMEE
Sbjct  73   ELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEE  116



>gb|KJB64632.1| hypothetical protein B456_010G058700 [Gossypium raimondii]
Length=358

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 6/104 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSE  235
              LG +L VP VQEL+K+  + VPPRY R D DP  P+      ++PVI+M  L     E
Sbjct  6    AKLGRSLLVPSVQELSKKPLKEVPPRYIRTDEDPPFPSHPNPLPQVPVIDMHKLF--SRE  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E+++L  ACKEWGFFQLI+H VS+SL+EK K + ++F  LPMEE
Sbjct  64   EIERLHHACKEWGFFQLINHEVSTSLVEKVKMEVQEFFKLPMEE  107



>ref|XP_006432911.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
 gb|ESR46151.1| hypothetical protein CICLE_v10001626mg [Citrus clementina]
Length=359

 Score =   102 bits (255),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + +LA   P   VPPR+ R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLVEPSILDLANNQPLTTVPPRFVRPEIDHPLIRNDDTSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD  CKEWGFFQLI+HGVSSSL+EK K + +DF NLP++E
Sbjct  65   DDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDE  111



>gb|KCW74247.1| hypothetical protein EUGRSUZ_E02887 [Eucalyptus grandis]
Length=311

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LGG+L VP VQELAK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGGSLPVPSVQELAKEAITELPPRYIRTDLD-HGTSVLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>ref|XP_010057200.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=364

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LGG+L VP VQELAK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGGSLPVPSVQELAKKAITELPPRYIRTDLD-HGTSLLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>ref|XP_010665637.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=366

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 72/107 (67%), Gaps = 9/107 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP---------SAPAQREIPVINMSNLLQG  226
            LG ++ VP VQELA++S E VP RY + + +P         S     ++P+I+M  L+ G
Sbjct  10   LGKSILVPSVQELAQKSLESVPERYIQLNQEPIILGADDELSNHNDFQVPIIDMKTLVSG  69

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL K+  ACKEWGFFQLI+HG+ +SL+EK K +T++F NLP+EE
Sbjct  70   DVLELDKMHSACKEWGFFQLINHGIDASLVEKFKLETQEFFNLPLEE  116



>ref|XP_010057199.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
isoform X1 [Eucalyptus grandis]
 gb|KCW74245.1| hypothetical protein EUGRSUZ_E02882 [Eucalyptus grandis]
Length=372

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LGG+L VP VQELAK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGGSLPVPSVQELAKKAITELPPRYIRTDLD-HGTSLLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>ref|XP_010057204.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=372

 Score =   102 bits (254),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 53/102 (52%), Positives = 71/102 (70%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LGG+L VP VQELAK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGGSLPVPSVQELAKEAITELPPRYIRTDLD-HGTSVLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>gb|AFK39688.1| unknown [Lotus japonicus]
Length=356

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEEL  241
            LG +L VP VQELAKQ    VP +Y R + +P   +      ++PVI+ + L   D  EL
Sbjct  9    LGTSLAVPSVQELAKQPITKVPEQYVRPNQEPPVISNTTSLPQVPVIDFNKLFSDDGAEL  68

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD ACKEWGFFQLI+HGV+ SL+EK K D + F NLP +E
Sbjct  69   EKLDHACKEWGFFQLINHGVNHSLVEKMKMDVQKFFNLPKDE  110



>ref|XP_006432916.1| hypothetical protein CICLE_v10001622mg [Citrus clementina]
 gb|ESR46156.1| hypothetical protein CICLE_v10001622mg [Citrus clementina]
Length=359

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + +LA   P   VPPR+ R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD  CKEWGFFQLI+HGVSSSL+EK K + +DF NLP++E
Sbjct  65   DDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_008238358.1| PREDICTED: S-norcoclaurine synthase 1-like [Prunus mume]
Length=369

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 54/120 (45%), Positives = 77/120 (64%), Gaps = 6/120 (5%)
 Frame = +2

Query  26   TCVGHHIMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIP  196
            + +G  +    +S   LGG+L V  VQ LA  + + +PPRY R +++    S     +IP
Sbjct  6    SILGVRMETEVLSRKDLGGSLPVENVQALASNNLKEIPPRYIRPEIEHEEVSMEDSLQIP  65

Query  197  VINMSNLLQ---GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            V++MS L+    G  +EL KL +ACK+WGFFQLI+HGVS  +IEK K+DTK+F  LP+EE
Sbjct  66   VVDMSKLMGDPLGHGDELAKLHLACKDWGFFQLINHGVSEEVIEKIKSDTKEFFQLPLEE  125



>gb|KDO39329.1| hypothetical protein CISIN_1g018221mg [Citrus sinensis]
Length=359

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + +LA   P   VPPR+ R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLVEPSILDLANNQPLTTVPPRFVRLEIDHPLIRNDDTSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD  CKEWGFFQLI+HGVSSSL+EK K + +DF NLP++E
Sbjct  65   DDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_011460382.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=367

 Score =   102 bits (254),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 72/105 (69%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQGDS--  232
            +G +L VPCVQEL K+    VP RY R D DP     +A +  ++PVI+M+ LL  ++  
Sbjct  8    IGSSLPVPCVQELGKEPFTTVPHRYVRPDQDPPFVSETATSLLQVPVIDMNKLLSDETMP  67

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL+KL +AC++WGFFQLI+HGV  +L+E  K+  K+F +LPMEE
Sbjct  68   AELQKLHLACRQWGFFQLINHGVGETLLESVKSGIKEFFSLPMEE  112



>gb|KDP25011.1| hypothetical protein JCGZ_23994 [Jatropha curcas]
Length=344

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSEELKKL  250
             LG +L VP VQELAK   +++PPRY R + D S  +  EIPV++M  LL  +SE L KL
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESD-SGVSVMEIPVVDMQKLLSQESE-LDKL  60

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              AC+ WGFFQL++H V  SL+EK K + KD  NL MEE
Sbjct  61   HYACRHWGFFQLVNHEVEHSLLEKIKKEVKDLFNLSMEE  99



>gb|KDP47183.1| hypothetical protein JCGZ_25692 [Jatropha curcas]
Length=344

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 52/99 (53%), Positives = 66/99 (67%), Gaps = 2/99 (2%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSEELKKL  250
             LG +L VP VQELAK   +++PPRY R + D S  +  EIPV++M  LL  +SE L KL
Sbjct  3    NLGSSLIVPSVQELAKVQTDVIPPRYIRQESD-SGVSVMEIPVVDMQKLLSQESE-LDKL  60

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              AC+ WGFFQL++H V  SL+EK K + KD  NL MEE
Sbjct  61   HYACRHWGFFQLVNHEVEYSLLEKIKKEVKDLFNLSMEE  99



>ref|XP_003540518.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN19469.1| Protein SRG1 [Glycine soja]
Length=359

 Score =   102 bits (253),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 56/113 (50%), Positives = 77/113 (68%), Gaps = 10/113 (9%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFR---DDL-----DPSAPAQREIPVINMSN  214
            I++  L  +L VP VQELAKQ+   VP RY +   +D+     + ++ +  EIPVI+M N
Sbjct  4    INTKPLATSLLVPSVQELAKQNFSSVPQRYIQHQHEDMVLICEETNSTSSLEIPVIDMHN  63

Query  215  LL--QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LL  + ++ EL KL +ACKEWGFFQLI+HGVS SL++K K + +DF NLPM E
Sbjct  64   LLSIEAENSELDKLHLACKEWGFFQLINHGVSPSLLKKLKLEIQDFFNLPMSE  116



>ref|XP_010057201.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74244.1| hypothetical protein EUGRSUZ_E02881 [Eucalyptus grandis]
Length=359

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/110 (49%), Positives = 72/110 (65%), Gaps = 14/110 (13%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR--------EIPVINMSNLLQGD  229
            LGG+L VPCVQELAK++   VPPRY R D D   P  R        ++PVI+M+ L    
Sbjct  8    LGGSLPVPCVQELAKEAITEVPPRYVRTDQD--HPFMRDDHGSLLLQVPVIDMNKLSSSH  65

Query  230  SE----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             +    EL+KL +AC++WGFFQLI+HGVS +L+E+ K   ++F  LPMEE
Sbjct  66   DDLVESELEKLHVACRDWGFFQLINHGVSCTLVEEVKLGIQEFFKLPMEE  115



>gb|AFK41350.1| unknown [Lotus japonicus]
Length=356

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 52/102 (51%), Positives = 67/102 (66%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEEL  241
            LG +L VP VQELAKQ    VP +Y R + +P   +      ++PVI+ + L   D  EL
Sbjct  9    LGTSLAVPSVQELAKQPITKVPEQYVRPNQEPPVISNTTSLPQVPVIDFNKLFSDDGVEL  68

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD ACKEWGFFQLI+HGV+ SL+EK K D + F NLP +E
Sbjct  69   EKLDHACKEWGFFQLINHGVNHSLVEKMKMDVQKFFNLPKDE  110



>ref|XP_009376717.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=363

 Score =   101 bits (252),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 75/114 (66%), Gaps = 8/114 (7%)
 Frame = +2

Query  50   ERSISSGTL-GGTLQVPCVQELAKQSPEIVPPRY---FRDDLDPSAPAQREIPVINMSNL  217
            E++ +  +L GG+L VP VQEL ++    +PPRY      ++  S     +IP I+M  L
Sbjct  6    EKAFAGKSLYGGSLPVPSVQELVQKPILTIPPRYVQPLHQEIISSDHHAHQIPSIDMQKL  65

Query  218  LQGDSE----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L  +S     EL +L  AC+EWGFFQL++HGVSSSL+EK KT+T++F NLPMEE
Sbjct  66   LSQESTISEPELARLHFACQEWGFFQLVNHGVSSSLLEKMKTETQEFFNLPMEE  119



>gb|AFK47220.1| unknown [Lotus japonicus]
Length=317

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/103 (52%), Positives = 69/103 (67%), Gaps = 4/103 (4%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDSEE  238
             LG +L VP VQELAKQ    VP RY R   +     +  +  ++PVIN+  LL  D+ E
Sbjct  8    NLGTSLVVPSVQELAKQPMTKVPERYLRPIQEQPRLSNTHSLPQVPVINLQKLLSEDATE  67

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KLD A KEWGFFQLI+HGV+ SL+E  K+D +DF NLP+EE
Sbjct  68   LEKLDCAGKEWGFFQLINHGVNPSLVEALKSDVEDFFNLPIEE  110



>ref|XP_006420337.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
 gb|ESR33577.1| hypothetical protein CICLE_v10005281mg [Citrus clementina]
Length=356

 Score =   101 bits (251),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 54/107 (50%), Positives = 72/107 (67%), Gaps = 8/107 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQ--GDS  232
             LG +L+VP VQEL K+    +PP+Y R D DP    +    +++P+I+M  LL   GDS
Sbjct  7    VLGSSLEVPYVQELVKEPLTAIPPQYLRPDQDPPFACNTNLSQQLPIIDMDKLLSDSGDS  66

Query  233  --EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL+ L +AC++WGFFQLI+HGVSSSLIEK K +  +F  LPMEE
Sbjct  67   THSELENLHMACRDWGFFQLINHGVSSSLIEKLKQEIPEFFKLPMEE  113



>ref|XP_006471705.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=473

 Score =   102 bits (254),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 51/107 (48%), Positives = 71/107 (66%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + +LA   P   VPPR+ R ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLVEPSILDLANNQPLTTVPPRFVRPEIDHPLIRNDDTSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD  CKEWGFFQLI+HGVSSSL+EK K + +DF NLP++E
Sbjct  65   DDSELEKLDNTCKEWGFFQLINHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_004146011.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004169920.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=362

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 68/111 (61%), Gaps = 5/111 (5%)
 Frame = +2

Query  50   ERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDL---DPSAPAQREIPVINMSNLL  220
            E+ I +   G ++ VP VQELAK     +P RY R DL    P A A  +IPVI+MSN  
Sbjct  4    EKKIHTLRFGSSILVPSVQELAKHPITEIPHRYIRPDLLHHSPIASAASQIPVIDMSNFR  63

Query  221  QGDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D+   EL +L  ACK WGFFQL+ HGVS SL+E+ K +T+    LP+EE
Sbjct  64   SNDTMDSELSRLHSACKNWGFFQLVKHGVSDSLMERMKMETQKLFQLPIEE  114



>ref|XP_008366518.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=365

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 75/121 (62%), Gaps = 14/121 (12%)
 Frame = +2

Query  47   MERSISS--GTLGGTLQVPCVQELAKQSPEIVPPRYFR--------DDLDPSAPAQREIP  196
            ME++ S+     GG+L VP VQE  K+    +PPRY +        + +  S     +IP
Sbjct  1    MEKTTSARKSLYGGSLHVPSVQEFVKKPILTIPPRYLQPHYQDGEHEMIINSDHHAHQIP  60

Query  197  VINMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPME  364
             I+M  LL  +S     EL +L  ACKEWGFFQL++HGVSSS++EK KT+T++F NLPME
Sbjct  61   SIDMQKLLSQZSTNSEAELARLHFACKEWGFFQLVNHGVSSSVLEKMKTETQEFFNLPME  120

Query  365  E  367
            E
Sbjct  121  E  121



>ref|XP_011460383.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
 ref|XP_011460384.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=331

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 9/107 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR-------EIPVINMSNLLQGDS  232
            LG +L VPCVQELAKQ    VP RY R D DPS  ++        ++PVI+M+ LL  ++
Sbjct  7    LGSSLPVPCVQELAKQPLTTVPQRYVRPDQDPSFISEMATSLPVPQVPVIDMNKLLSDET  66

Query  233  --EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL+K  +AC +WGFFQLI+HGV   L+E  K+  K+F +LPMEE
Sbjct  67   MPAELQKFHLACGQWGFFQLINHGVGEPLLESVKSGIKEFFSLPMEE  113



>ref|XP_007022032.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13557.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 59/124 (48%), Positives = 73/124 (59%), Gaps = 27/124 (22%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDS--EE  238
            G +L VP VQELAK+S   +PPRY R DL+      A +  EIPVI+M  L+  +S   E
Sbjct  9    GSSLPVPSVQELAKKSIATIPPRYLRPDLEKPIVSDAGSMSEIPVIDMEGLVSKESMDSE  68

Query  239  LKKLDIACKEWGFFQ---------------------LISHGVSSSLIEKXKTDTKDFLNL  355
            L KLD ACKEWGFFQ                     LI+HG+S SL+EK KT+ +DF NL
Sbjct  69   LAKLDFACKEWGFFQVCLALYICHLNPYSILVSCEYLINHGMSLSLVEKVKTEIQDFFNL  128

Query  356  PMEE  367
            P+EE
Sbjct  129  PVEE  132



>ref|XP_006477806.1| PREDICTED: protein SRG1-like [Citrus sinensis]
 ref|XP_006477807.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score =   100 bits (250),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS--E  235
            +G +L VPCVQEL K    +VP RY R D D    +      +IPVI+M +LL  +S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDILISQIPVIDMQSLLSKESMDS  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD ACKEWGFFQL++HG+S++ +EK K + + F NL MEE
Sbjct  64   ELAKLDFACKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEE  107



>ref|XP_006575845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=316

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 50/110 (45%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSA---PAQREIPVINMSNL  217
            M+  I++      L VP V ELAKQ   IVP RY   + DP +       ++PVI+++ L
Sbjct  1    MDPQIANKLGTSLLLVPSVHELAKQPMTIVPERYIHPNQDPPSVEFATSHQVPVIDLNKL  60

Query  218  LQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L  D  EL+K D+ACKEWGFFQLI+HG++ S +EK K   ++F +LPM+E
Sbjct  61   LSEDENELEKFDLACKEWGFFQLINHGINPSTLEKVKISVEEFFSLPMKE  110



>ref|XP_006442330.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
 gb|ESR55570.1| hypothetical protein CICLE_v10020843mg [Citrus clementina]
Length=355

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS--E  235
            +G +L VPCVQEL K    +VP RY R D D    +      +IPVI+M +LL  +S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDTLISQIPVIDMQSLLSEESMDS  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD ACKEWGFFQL++HG+S++ +EK K + + F NL MEE
Sbjct  64   ELAKLDFACKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEE  107



>ref|XP_010089186.1| Protein SRG1 [Morus notabilis]
 gb|EXC36144.1| Protein SRG1 [Morus notabilis]
Length=293

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 55/104 (53%), Positives = 67/104 (64%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFR-DDLDPSAP---AQREIPVINMSNLL---QGDSE  235
            G +L VP VQEL K+    VP RY R D  D ++    +  EIPVIN  NLL   +    
Sbjct  4    GSSLLVPSVQELVKEPIITVPSRYIRPDQYDKTSNKIISVSEIPVINFQNLLCHGELSES  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL     AC++WGFFQLI+HG+SSSL+EK KTD +DF NLPMEE
Sbjct  64   ELASFHSACRDWGFFQLINHGISSSLVEKIKTDIQDFFNLPMEE  107



>ref|XP_003516325.1| PREDICTED: protein SRG1 [Glycine max]
 gb|KHN03628.1| Protein SRG1 [Glycine soja]
Length=350

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/100 (52%), Positives = 67/100 (67%), Gaps = 3/100 (3%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIPVINMSNLLQGDSEELKK  247
            G +L VP V EL KQ    VP +Y   + DP   S     ++PVI++S LL  D  EL+K
Sbjct  5    GTSLLVPSVHELVKQPITKVPDQYLHPNQDPPDISNTTLPQVPVIDLSKLLSEDVTELEK  64

Query  248  LDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LD ACKEWGFFQLI+HGV+ S++E  K D ++FLNLPME+
Sbjct  65   LDDACKEWGFFQLINHGVNPSMVENVKRDVQEFLNLPMEK  104



>ref|XP_009376719.1| PREDICTED: protein SRG1-like isoform X2 [Pyrus x bretschneideri]
Length=360

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = +2

Query  47   MERSISSG--TLGGTLQVPCVQELAKQSPEIVPPRY---FRDDLDPSAPAQREIPVINMS  211
            ME    +G    GG+L VP VQEL ++    +PPRY      ++  S     +IP I+M 
Sbjct  1    MEEKAFAGKSVYGGSLPVPSVQELVQKPILTIPPRYVQPLHQEIISSDHHTHQIPSIDMQ  60

Query  212  NLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             LL  +S     EL +L  AC+EWGFFQL++HGVSSSL++K KT+T++F NLPMEE
Sbjct  61   KLLSQESTISESELARLHFACQEWGFFQLVNHGVSSSLLDKMKTETQEFFNLPMEE  116



>ref|XP_004488976.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=355

 Score =   100 bits (249),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 53/104 (51%), Positives = 70/104 (67%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLL--QGDSE  235
            G +L VP VQELAK +   VPPRY +       +  +  +  EIPVI+M+NLL  +  S 
Sbjct  9    GTSLLVPSVQELAKDNILTVPPRYIQSQHQDLVITEADHSILEIPVIDMNNLLSLEFGSS  68

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KL +ACK+WGFFQL++HGV+SSL+EK K + +D  NLPM E
Sbjct  69   ELAKLHLACKDWGFFQLVNHGVNSSLVEKVKLEIQDLFNLPMSE  112



>ref|XP_009376718.1| PREDICTED: protein SRG1-like isoform X1 [Pyrus x bretschneideri]
Length=363

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/116 (47%), Positives = 73/116 (63%), Gaps = 9/116 (8%)
 Frame = +2

Query  47   MERSISSG--TLGGTLQVPCVQELAKQSPEIVPPRY---FRDDLDPSAPAQREIPVINMS  211
            ME    +G    GG+L VP VQEL ++    +PPRY      ++  S     +IP I+M 
Sbjct  4    MEEKAFAGKSVYGGSLPVPSVQELVQKPILTIPPRYVQPLHQEIISSDHHTHQIPSIDMQ  63

Query  212  NLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             LL  +S     EL +L  AC+EWGFFQL++HGVSSSL++K KT+T++F NLPMEE
Sbjct  64   KLLSQESTISESELARLHFACQEWGFFQLVNHGVSSSLLDKMKTETQEFFNLPMEE  119



>ref|XP_007149498.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
 gb|ESW21492.1| hypothetical protein PHAVU_005G075400g [Phaseolus vulgaris]
Length=357

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/111 (49%), Positives = 71/111 (64%), Gaps = 8/111 (7%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSA------PAQREIPVINMSNLL  220
            I+    G +L VP VQEL+KQ+   VP RY +   D             EIPVI+M NLL
Sbjct  4    ITKNPSGTSLLVPSVQELSKQNLRTVPQRYIQPHHDQHMLLISQEAHSLEIPVIDMHNLL  63

Query  221  QGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              +S+  EL+KL +ACK+WGFFQL++HGVS SL+EK K + ++F NLPM E
Sbjct  64   SAESKSLELEKLHLACKDWGFFQLVNHGVSISLLEKVKLEIEEFFNLPMSE  114



>ref|XP_010057196.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=279

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 14/110 (13%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR--------EIPVINMSNLLQGD  229
            LGG+L VPCVQELAK++   VPPRY R D D   P  R        ++PVI+M+ L    
Sbjct  8    LGGSLPVPCVQELAKEAITEVPPRYVRTDQD--HPFMRDDHGSLLLQVPVIDMNKLSSSH  65

Query  230  SE----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             +    EL+KL +AC++WGFFQLI+HGV  +L+E+ K   ++F  LPMEE
Sbjct  66   DDLVESELEKLHVACRDWGFFQLINHGVRCTLVEEVKLGIQEFFKLPMEE  115



>ref|XP_010057195.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
 gb|KCW74240.1| hypothetical protein EUGRSUZ_E02879 [Eucalyptus grandis]
Length=359

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/110 (48%), Positives = 71/110 (65%), Gaps = 14/110 (13%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR--------EIPVINMSNLLQGD  229
            LGG+L VPCVQELAK++   VPPRY R D D   P  R        ++PVI+M+ L    
Sbjct  8    LGGSLPVPCVQELAKEAITEVPPRYVRTDQD--HPFMRDDHGSLLLQVPVIDMNKLSSSH  65

Query  230  SE----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             +    EL+KL +AC++WGFFQLI+HGV  +L+E+ K   ++F  LPMEE
Sbjct  66   DDLVESELEKLHVACRDWGFFQLINHGVRCTLVEEVKLGIQEFFKLPMEE  115



>gb|KHG25230.1| Protein SRG1 -like protein [Gossypium arboreum]
Length=358

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 69/108 (64%), Gaps = 7/108 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ-----REIPVINMSNLLQGD  229
            +  +G +L VP VQELAKQ    +P RY R +L+    A       EIPVI+M  L+  +
Sbjct  5    ASNVGSSLLVPSVQELAKQPLSGIPNRYLRPELEQDVVADGGGPVLEIPVIDMQKLVSEE  64

Query  230  --SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              + EL KLD ACKEWGFFQL++HGVS +L+EK  T  +DF NLP EE
Sbjct  65   PMNSELDKLDFACKEWGFFQLVNHGVSLTLLEKVNTQIQDFFNLPKEE  112



>ref|XP_010273386.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
 ref|XP_010273387.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=365

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 71/104 (68%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDS--E  235
            LG ++ VP VQELA++    VPPRY R D DP    +A +   IPVI+++NLL  +S   
Sbjct  8    LGSSIPVPNVQELARKPMVTVPPRYLRPDQDPPVITNANSLPTIPVIDLNNLLSAESMDS  67

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E  +L  ACK+WGFFQL +HGV+SSL+EK K + ++F  LP+EE
Sbjct  68   ESARLHSACKDWGFFQLTNHGVTSSLVEKIKLEIQEFFKLPLEE  111



>ref|XP_011085301.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/105 (50%), Positives = 71/105 (68%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLLQGDS--  232
            LGG+L VP VQELAK+    VPPRY R D     +  +  +  +IPVI+M  LL   S  
Sbjct  5    LGGSLPVPIVQELAKEKLATVPPRYVRPDQHQQTILSTLSSLPQIPVIDMQKLLDKYSVD  64

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL+ L+ AC+EWGFFQLI+HGV S+++EK K + ++F NLP+EE
Sbjct  65   SELEALNHACQEWGFFQLINHGVDSTVVEKMKLEVQEFFNLPIEE  109



>gb|AGL52587.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=378

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 54/109 (50%), Positives = 70/109 (64%), Gaps = 11/109 (10%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-------PSAPAQREIPVINMSNLLQGD-  229
            LGGTL VP VQELAKQS   VP RY RDD D        ++   + +PVIN+  +L  + 
Sbjct  9    LGGTLFVPSVQELAKQSLAEVPARYIRDDHDTLGNNVTATSMMDQSVPVINLQKVLSPEP  68

Query  230  ---SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                 EL++L  ACKEWGFFQ+++HGV + L+EK K+D + F  LPMEE
Sbjct  69   IIGELELERLHSACKEWGFFQVVNHGVDNLLVEKVKSDIEGFFKLPMEE  117



>ref|XP_002519766.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42739.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=366

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 71/108 (66%), Gaps = 6/108 (6%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD  229
            ++  LG +L VP VQELAK+    VP +Y R DL+P    +  A  ++PV++M  LL  D
Sbjct  5    NATKLGSSLPVPSVQELAKELLTQVPLKYVRPDLEPPLLSNTAALLQVPVVDMQKLLSED  64

Query  230  SE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   EL KLD ACKEWGFFQ+I+HG   SL++K K + ++  NLPMEE
Sbjct  65   SVDLELNKLDRACKEWGFFQVINHGAKKSLVDKMKIELRELFNLPMEE  112



>ref|XP_006452693.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
 gb|ESR65933.1| hypothetical protein CICLE_v10008745mg [Citrus clementina]
Length=359

 Score = 99.8 bits (247),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/101 (50%), Positives = 69/101 (68%), Gaps = 6/101 (6%)
 Frame = +2

Query  83   TLQVPCVQELAKQSPEI-VPPRYFRDDLD-----PSAPAQREIPVINMSNLLQGDSEELK  244
            +L  P + ELA   P I +PPRY R ++D         + +++PVI+M  LL GD  EL+
Sbjct  11   SLVEPSILELAHNKPLITIPPRYVRPEMDHPLIRTDDSSAQQLPVIDMHKLLSGDDSELE  70

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGF QL++HGVSSSL+EK K + +DF NLP++E
Sbjct  71   KLDRACKEWGFCQLMNHGVSSSLVEKVKAEIQDFFNLPIDE  111



>ref|XP_007149499.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris]
 gb|ESW21493.1| hypothetical protein PHAVU_005G075500g [Phaseolus vulgaris]
Length=311

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 68/109 (62%), Gaps = 7/109 (6%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  T G +L VP VQELAKQ+   VP RY +          S     EIPVI+M  LL  
Sbjct  4    TKNTSGTSLLVPSVQELAKQNLSTVPQRYIQPQHQEQMVLISQQPNLEIPVIDMQRLLSQ  63

Query  227  DS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +S   EL KL +AC+EWGFFQLI+HGVS SL+EK K + K+F NLPM E
Sbjct  64   ESGNSELDKLHLACQEWGFFQLINHGVSPSLVEKVKLEIKEFFNLPMSE  112



>ref|XP_006494099.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=359

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/107 (47%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +  +L  P + ELA   P   VPPRY R D+D         +  ++PVI+M  L+ G
Sbjct  5    ATVIASSLVEPSILELANNKPLTTVPPRYVRPDIDHPLIRNDESSAEQLPVIDMHKLVSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D  EL+KLD ACK+WGFFQLI+HGV  SL+EK K +T DF +LP++E
Sbjct  65   DDSELEKLDRACKDWGFFQLINHGVRCSLVEKVKAETLDFFDLPIDE  111



>ref|XP_006355576.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=216

 Score = 97.8 bits (242),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 10/103 (10%)
 Frame = +2

Query  89   QVPCVQELAKQSPEIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGDSE-----E  238
            +VP VQELAK+    +P RY RDD D S+ A      +E+PVI+M  L+  +       E
Sbjct  10   EVPSVQELAKKKLVTIPSRYVRDDHDNSSIASNDRNNKEVPVIDMQRLVNSNDHDIMNLE  69

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL  A + WGFFQLI+HGVSSS++EK K +T+ F +LP+EE
Sbjct  70   LNKLHFAAQHWGFFQLINHGVSSSVVEKMKHETQKFYDLPLEE  112



>gb|KEH27886.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=353

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEEL  241
             G +  VP V ELAKQS   VP ++ R + D +         ++PVI++  LL  D+ EL
Sbjct  4    FGTSRLVPSVHELAKQSIVEVPEQFLRPNQDATHVINTDSLPQVPVIDLGKLLGEDATEL  63

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD+ACKEWGFFQ+I+HGV++SLIEK K   K+FL+LP+EE
Sbjct  64   EKLDLACKEWGFFQIINHGVNTSLIEKVKIGIKEFLSLPVEE  105



>gb|KEH27885.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=358

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 54/104 (52%), Positives = 68/104 (65%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR-----EIPVINMSNLL-QGDSE  235
            LG +L VP VQEL KQ    VP RY + + DPS          ++PVI++S LL + D  
Sbjct  9    LGSSLLVPSVQELVKQPITKVPERYLQQNQDPSLVVSSTKSLPQVPVIDLSKLLSEEDET  68

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL+KLD ACKEWGFFQLI+HGV+  L+E  K   +DF NLP+EE
Sbjct  69   ELQKLDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEE  112



>gb|AJI44436.1| oxoglutarate-dependent dioxygenase 2 [Ocimum basilicum]
Length=354

 Score = 99.4 bits (246),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 68/107 (64%), Gaps = 6/107 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDS  232
            + TLG +L+VP VQELAK+    +P RY R D D    P   ++ EIPVI+M  L   DS
Sbjct  5    TKTLGSSLKVPIVQELAKEKLSSIPSRYIRHDKDQLPPPDVSSKSEIPVIDMQKLFDPDS  64

Query  233  --EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               EL KL  AC +WGFFQLI+HGV  S IE  K++ + F NLPM++
Sbjct  65   AESELLKLHDACVQWGFFQLINHGVDPSTIEMMKSEIQGFFNLPMDQ  111



>gb|KCW74242.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=346

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LG +L VP VQE AK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGSSLPVPSVQEFAKEAITELPPRYIRTDLD-HGTSLLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>ref|XP_004490337.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=348

 Score = 99.0 bits (245),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEEL  241
            LG +L VP V ELAKQS   +P +Y + + DP    +  +  ++PVI++S LL  D  EL
Sbjct  4    LGTSLLVPSVHELAKQSILEIPEQYLQSNQDPIVISNTTSLPQVPVIDLSKLLHEDETEL  63

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  ACKEWGFFQLI+H V+ SL+E  K   ++FLN+PMEE
Sbjct  64   EKLHHACKEWGFFQLINHEVNPSLVENVKIGVQEFLNIPMEE  105



>ref|XP_008345138.1| PREDICTED: protein SRG1-like, partial [Malus domestica]
Length=368

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/124 (47%), Positives = 74/124 (60%), Gaps = 17/124 (14%)
 Frame = +2

Query  47   MERSISSG--TLGGTLQVPCVQELAKQSPEIVPPRYFR----------DDLD-PSAPAQR  187
            ME    +G    GG+L VP VQEL K+    +PPRY +           D++  S     
Sbjct  9    MEEKAXAGKSMYGGSLLVPSVQELVKKPIVKIPPRYIQPHHQDGNYQEHDMNINSEHLAD  68

Query  188  EIPVINMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNL  355
            +IP I+M  LL  +S     EL +L  ACKEWGFFQL+ HGVSSSL+EK KT+T++F NL
Sbjct  69   QIPSIDMHKLLSXESTXSEAELARLHFACKEWGFFQLVXHGVSSSLLEKMKTETQEFFNL  128

Query  356  PMEE  367
            PMEE
Sbjct  129  PMEE  132



>ref|XP_010057202.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Eucalyptus grandis]
 gb|KCW74241.1| hypothetical protein EUGRSUZ_E02880 [Eucalyptus grandis]
Length=372

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 51/102 (50%), Positives = 69/102 (68%), Gaps = 5/102 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREIPVINMSNLLQGDSE----EL  241
            LG +L VP VQE AK++   +PPRY R DLD    +  ++PVI++S L   D +    EL
Sbjct  20   LGSSLPVPSVQEFAKEAITELPPRYIRTDLD-HGTSLLQVPVIDLSKLSSSDGDLTESEL  78

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  AC++WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  79   EKLHSACRDWGFFQLINHGVSFSLLEEVKLGIQEFFKLPMEE  120



>ref|XP_003518803.1| PREDICTED: protein SRG1-like [Glycine max]
 gb|KHN29929.1| Protein SRG1-like protein [Glycine soja]
Length=358

 Score = 98.6 bits (244),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 68/103 (66%), Gaps = 5/103 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLL-QGDSEE  238
            LG +L VP VQELAKQ    VP RY R + DP          ++PVI++S LL + D+ E
Sbjct  9    LGSSLLVPSVQELAKQGITKVPERYVRPNEDPCVEYDTTSLPQVPVIDLSKLLSEDDAAE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KLD ACKEWGFFQLI+HGV+  L+E  K + ++  NLP EE
Sbjct  69   LEKLDHACKEWGFFQLINHGVNPCLVEYMKKNVQELFNLPHEE  111



>gb|KHN29926.1| Protein SRG1-like protein [Glycine soja]
Length=217

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 50/100 (50%), Positives = 68/100 (68%), Gaps = 2/100 (2%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSA--PAQREIPVINMSNLLQGDSEELKK  247
             G ++ VP VQELAKQ+   VP +Y R + D      +   +P+I++S LL  D  EL+K
Sbjct  4    FGTSVLVPSVQELAKQAIINVPEKYLRPNQDSHVIVDSTLTLPLIDLSKLLSEDVTELEK  63

Query  248  LDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+ ACKEWGFFQ+I+HGV  SL+E  K D ++FLNLPME+
Sbjct  64   LNNACKEWGFFQVINHGVIPSLVENVKRDVQEFLNLPMEK  103



>ref|XP_010273389.1| PREDICTED: protein SRG1-like [Nelumbo nucifera]
Length=363

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 70/108 (65%), Gaps = 12/108 (11%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD  229
            T G +L VP VQEL KQ    VPPRY R   DP       S PA   +P+I++ +LL GD
Sbjct  8    TFGKSLLVPSVQELVKQPIVEVPPRYIRVRQDPPIISDDSSFPA---VPIIDIQSLLSGD  64

Query  230  --SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              + EL+++  ACKEWGFFQ+ +HG+SSSL+EK K + +DF  LP EE
Sbjct  65   FVNSELERMHSACKEWGFFQVANHGISSSLLEKVKQEIEDFFQLPSEE  112



>ref|XP_009139101.1| PREDICTED: protein SRG1-like isoform X1 [Brassica rapa]
Length=355

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQS-PEIVPPRYFRDDLDPS---APAQREIPVINMSNLLQGDS-  232
            G    ++ VP VQE+ +++    VPPRY R DLD +   +  + EIP+I+M+ L    S 
Sbjct  6    GIQWSSIIVPSVQEMVEENLITTVPPRYLRSDLDKAEIDSDLRTEIPIIDMNLLCSSTSM  65

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              E+ KLD ACKEWGFFQLI+HG+ SS ++K K++ +DF NLPMEE
Sbjct  66   DSEINKLDFACKEWGFFQLINHGMDSSFLDKVKSEVQDFFNLPMEE  111



>ref|XP_009139110.1| PREDICTED: protein SRG1-like isoform X2 [Brassica rapa]
Length=354

 Score = 98.6 bits (244),  Expect = 6e-22, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 71/106 (67%), Gaps = 6/106 (6%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQS-PEIVPPRYFRDDLDPS---APAQREIPVINMSNLLQGDS-  232
            G    ++ VP VQE+ +++    VPPRY R DLD +   +  + EIP+I+M+ L    S 
Sbjct  6    GIQWSSIIVPSVQEMVEENLITTVPPRYLRSDLDKAEIDSDLRTEIPIIDMNLLCSSTSM  65

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              E+ KLD ACKEWGFFQLI+HG+ SS ++K K++ +DF NLPMEE
Sbjct  66   DSEINKLDFACKEWGFFQLINHGMDSSFLDKVKSEVQDFFNLPMEE  111



>gb|KJB12903.1| hypothetical protein B456_002G045700 [Gossypium raimondii]
Length=361

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 53/115 (46%), Positives = 72/115 (63%), Gaps = 8/115 (7%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR------EIPVINM  208
            MER+  +  +G ++ VP VQELAKQ    +P  Y R +L+  A A        EIPVI+M
Sbjct  1    MERNSKASNVGSSVLVPSVQELAKQPLSAIPDGYLRPELEGDAVAHGGGDQVLEIPVIDM  60

Query  209  SNLLQGDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              L+  +S   E+ KLD ACKEWGFFQL++HGV+  L+EK K + ++   LPMEE
Sbjct  61   QRLVCEESMNSEIHKLDFACKEWGFFQLVNHGVNLRLLEKVKAELEELFKLPMEE  115



>ref|XP_002268288.1| PREDICTED: protein SRG1 [Vitis vinifera]
Length=364

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 66/99 (67%), Gaps = 7/99 (7%)
 Frame = +2

Query  92   VPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQGD--SEELKKL  250
            VPCVQEL K+    VP RY R + D      +  +   +P+I++  LL  D    EL+KL
Sbjct  14   VPCVQELVKEPLTAVPHRYVRPEQDSPVLSNATDSMPHVPIIDLHRLLSADFTHSELEKL  73

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              AC+EWGFFQLI+HGVSSSL+EK K +T++F NLP+EE
Sbjct  74   HRACQEWGFFQLINHGVSSSLVEKVKAETQEFFNLPLEE  112



>gb|KCW74252.1| hypothetical protein EUGRSUZ_E02895 [Eucalyptus grandis]
Length=184

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS------APAQREIPVINMSNLLQGDSE  235
            LGG+L VP VQELAK++   VPPRY R D D S        +  ++PVI++S L   + +
Sbjct  8    LGGSLPVPSVQELAKEAITEVPPRYVRPDQDHSFMHADLGTSLLQVPVIDLSKLSSSNED  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+ L +AC++WGFFQLI+HGV  SL+E+ K   ++F  LPMEE
Sbjct  68   LMESELENLHVACRDWGFFQLINHGVRCSLVEEVKLGIQEFFELPMEE  115



>ref|XP_007013636.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY31255.1| Senescence-related gene 1 [Theobroma cacao]
Length=356

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 52/106 (49%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDS--  232
            LGG+L VPCVQ+L+K+    VPP+Y R D DPS     +    ++PVI+M  L       
Sbjct  8    LGGSLLVPCVQQLSKEPLVKVPPQYVRTDEDPSFISNSSSCLAQVPVIDMQKLHYSKDLK  67

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL++L  ACK WGFFQLI+HGVS++L+EK K + + F NL MEE
Sbjct  68   DTELEQLHHACKHWGFFQLINHGVSTALVEKVKLEIEGFFNLTMEE  113



>ref|XP_003614589.1| SRG1-like protein [Medicago truncatula]
 gb|AES97547.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score = 98.2 bits (243),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 69/102 (68%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEEL  241
             G ++ VP VQELAKQ    +P +Y   + DP    +  + +++PVI++S LL  D+ EL
Sbjct  4    FGSSILVPSVQELAKQPNTEIPEQYLHPNQDPINVSNTTSLQQVPVIDLSKLLSEDATEL  63

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD ACKEWGFFQLI+HGV   L+E  K   ++FL+LP+EE
Sbjct  64   EKLDQACKEWGFFQLINHGVDPLLVENVKIGVQEFLSLPLEE  105



>ref|XP_010057213.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=359

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +2

Query  86   LQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIPVINMSNLLQGDSE--ELKKL  250
            L VP VQ++ K++P  VP RY RDDL+P    A +  ++PVI++  L+  D    ELKKL
Sbjct  12   LHVPWVQDIMKENPTTVPERYVRDDLEPVIMGACSGLQLPVIDLGRLVSEDCAKLELKKL  71

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              ACK+WGFFQLI+H VS  LIEK K  T++  N+PMEE
Sbjct  72   HHACKDWGFFQLINHEVSPKLIEKVKKGTEELFNMPMEE  110



>ref|XP_010057215.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=358

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 51/99 (52%), Positives = 67/99 (68%), Gaps = 5/99 (5%)
 Frame = +2

Query  86   LQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIPVINMSNLLQGDSE--ELKKL  250
            L VP VQ++ K++P  VP RY RDDL+P    A +  ++PVI++  L+  D    ELKKL
Sbjct  12   LHVPWVQDIMKENPTTVPERYVRDDLEPVIMGACSGLQLPVIDLGRLVSEDCAKLELKKL  71

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              ACK+WGFFQLI+H VS  LIEK K  T++  N+PMEE
Sbjct  72   HHACKDWGFFQLINHEVSPKLIEKVKKGTEELFNMPMEE  110



>ref|XP_007211481.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
 gb|EMJ12680.1| hypothetical protein PRUPE_ppa007600mg [Prunus persica]
Length=362

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 57/120 (48%), Positives = 72/120 (60%), Gaps = 14/120 (12%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFR-------DDL--DPSAPAQREIPV  199
            ME   S    GG+L VP VQELAK+    +P RY +       DD+  +P    Q EIP 
Sbjct  1    MEEKRSGSLYGGSLIVPSVQELAKKPITAIPARYIQTRHHEQQDDVMFNPDH-GQAEIPF  59

Query  200  INMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            I+M  LL  +S     EL  L  ACKEWGFFQL++HGVSSSL++K K + +DF NL ME+
Sbjct  60   IDMQKLLSQESTDSESELAMLHFACKEWGFFQLVNHGVSSSLMDKVKIEIQDFFNLAMED  119



>ref|XP_007025218.1| Senescence-related gene 1, putative [Theobroma cacao]
 gb|EOY27840.1| Senescence-related gene 1, putative [Theobroma cacao]
Length=357

 Score = 97.8 bits (242),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/106 (51%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMSNLLQGDS--  232
            LG ++ VP VQE+AK++   VP RY R D DP        + +++PVI+M  LL GD   
Sbjct  8    LGSSIPVPSVQEVAKEALGRVPQRYQRPDQDPPFTSIDTCSPQQVPVIDMLKLLSGDHFM  67

Query  233  -EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL+KL  ACKEWGFFQLI+HGVS SL++K K   +   NLPMEE
Sbjct  68   DVELEKLHYACKEWGFFQLINHGVSKSLVDKVKKGIQGLFNLPMEE  113



>ref|XP_010057217.1| PREDICTED: protein SRG1-like isoform X2 [Eucalyptus grandis]
Length=359

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSE--E  238
            G  L +PCVQ++ K++P  VP RY R DL+P     A +  ++PVI++  L+  D    E
Sbjct  9    GRLLHMPCVQDVLKENPTTVPERYVRSDLEPPMIMDACSGLQVPVIDLGRLVSEDCSKLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LKKL  ACK+WGFFQLI+H VS  LIE+ K  T++  N+PMEE
Sbjct  69   LKKLHHACKDWGFFQLINHEVSPKLIEEVKKGTEELFNMPMEE  111



>ref|XP_010057216.1| PREDICTED: protein SRG1-like isoform X1 [Eucalyptus grandis]
Length=360

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSE--E  238
            G  L +PCVQ++ K++P  VP RY R DL+P     A +  ++PVI++  L+  D    E
Sbjct  9    GRLLHMPCVQDVLKENPTTVPERYVRSDLEPPMIMDACSGLQVPVIDLGRLVSEDCSKLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LKKL  ACK+WGFFQLI+H VS  LIE+ K  T++  N+PMEE
Sbjct  69   LKKLHHACKDWGFFQLINHEVSPKLIEEVKKGTEELFNMPMEE  111



>gb|KEH27983.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=274

 Score = 97.1 bits (240),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEELK  244
              ++ VP VQEL KQ    +P RYF  + D     +  +   +P+I++  LL  DS EL+
Sbjct  5    ASSIIVPSVQELIKQPITEIPERYFHSNQDTIVVTNTTSLPHVPIIDLHKLLSDDSAELE  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD  CKEWGFFQLI+HGV++SL+E  K   + F NLPMEE
Sbjct  65   KLDQTCKEWGFFQLINHGVNTSLVENMKIGVEQFFNLPMEE  105



>ref|XP_006389976.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
 gb|ESQ27262.1| hypothetical protein EUTSA_v10018772mg [Eutrema salsugineum]
Length=356

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAK-QSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDS--EE  238
            +L VPCV E+ K Q+   VPPRY R D + S     +    EIPVI+M  L    +   E
Sbjct  11   SLIVPCVLEMVKEQNLTTVPPRYVRSDQETSENLDDSSMSSEIPVIDMKRLYSVSTMDSE  70

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KLD AC++WGFFQL++HG+ SS ++K +T+ +DF NLPMEE
Sbjct  71   LEKLDFACQDWGFFQLVNHGIDSSFLDKLETEVQDFFNLPMEE  113



>ref|XP_003614575.1| SRG1-like protein [Medicago truncatula]
 gb|AES97533.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=355

 Score = 97.4 bits (241),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEELK  244
              ++ VP VQEL KQ    +P RYF  + D     +  +   +P+I++  LL  DS EL+
Sbjct  5    ASSIIVPSVQELIKQPITEIPERYFHSNQDTIVVTNTTSLPHVPIIDLHKLLSDDSAELE  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD  CKEWGFFQLI+HGV++SL+E  K   + F NLPMEE
Sbjct  65   KLDQTCKEWGFFQLINHGVNTSLVENMKIGVEQFFNLPMEE  105



>ref|XP_006302461.1| hypothetical protein CARUB_v10020553mg [Capsella rubella]
 gb|EOA35359.1| hypothetical protein CARUB_v10020553mg [Capsella rubella]
Length=353

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/106 (48%), Positives = 69/106 (65%), Gaps = 7/106 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGD  229
            G    +L VP VQE+ ++     VPPRY R D D +  +     + EIP+I+MS L   D
Sbjct  5    GAARSSLIVPSVQEMVEEKMITAVPPRYVRSDQDKAEISSETGLRNEIPIIDMSLLSSLD  64

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            SE + KLD ACKEWGFFQL++HG+ S+ +EK K++ +DF N PMEE
Sbjct  65   SE-IDKLDFACKEWGFFQLVNHGMDSTFLEKFKSEIQDFFNFPMEE  109



>gb|KEH27888.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=352

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/100 (49%), Positives = 69/100 (69%), Gaps = 2/100 (2%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR--EIPVINMSNLLQGDSEELKK  247
             G +L VP VQELAK++   VP +Y   + DP   +    ++PVI++S L+  D+ EL+K
Sbjct  4    FGTSLLVPSVQELAKKNTTEVPEQYLHPNQDPIVVSNTTLQVPVIDLSKLVCEDATELEK  63

Query  248  LDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LD ACKEWGFFQLI+HGV+ SL+E  K   ++FLNL ++E
Sbjct  64   LDQACKEWGFFQLINHGVNPSLVENVKIGVQEFLNLSVDE  103



>ref|XP_006355630.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=355

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/96 (51%), Positives = 64/96 (67%), Gaps = 3/96 (3%)
 Frame = +2

Query  89   QVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ--REIPVINMSNLLQGDSE-ELKKLDIA  259
            +VP VQE+AK     +P RY RD+ DPS  +   +E+PVI+M  L+      EL KL IA
Sbjct  17   KVPSVQEMAKTKLVTIPSRYIRDNQDPSIASSNYKEVPVIDMQRLINDSMNLELNKLHIA  76

Query  260  CKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             KEWGFFQLI+HGV+ S++EK K + K   NLP+EE
Sbjct  77   AKEWGFFQLINHGVNFSMMEKMKDEIKKLFNLPLEE  112



>ref|XP_010057210.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74255.1| hypothetical protein EUGRSUZ_E02899 [Eucalyptus grandis]
Length=367

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 67/108 (62%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP------SAPAQREIPVINMSNLLQGDSE  235
            LG +L VP VQELAK+    VPPRY R D D             E+PVI+++NL   D  
Sbjct  8    LGSSLPVPNVQELAKEVIAEVPPRYVRTDQDHPLMDDDHGTLLLEVPVIDLNNLSSSDGN  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+KL  ACK+WGFFQLI+HGVS SL+E+ K   ++F  LPMEE
Sbjct  68   LRESELEKLHTACKDWGFFQLINHGVSCSLVEEVKLGIQEFFKLPMEE  115



>gb|KCW74251.1| hypothetical protein EUGRSUZ_E02892 [Eucalyptus grandis]
Length=359

 Score = 97.1 bits (240),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP------SAPAQREIPVINMSNLLQGDSE  235
            LG +L VPCVQELAK +   VPPRY R D D             ++PVI+M+ L     +
Sbjct  8    LGSSLPVPCVQELAKDAITEVPPRYVRTDQDHPFMGDDHGSLLLQVPVIDMTKLSSSHDD  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+KL +AC++WGFFQLI+HGVS +L+E+ K   ++F  LPMEE
Sbjct  68   LVESELEKLHVACRDWGFFQLINHGVSCTLMEEVKLGIQEFFKLPMEE  115



>ref|XP_010041379.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW44395.1| hypothetical protein EUGRSUZ_L02122 [Eucalyptus grandis]
Length=305

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/99 (51%), Positives = 66/99 (67%), Gaps = 5/99 (5%)
 Frame = +2

Query  86   LQVPCVQELAKQSPEIVPPRYFRDDLDP---SAPAQREIPVINMSNLLQGDSE--ELKKL  250
            L VP VQ++ K++P  VP RY RDDL+P    A +  ++PVI++  L+  D    ELKKL
Sbjct  12   LHVPWVQDMMKENPTTVPERYVRDDLEPVIMGACSGLQLPVIDLGRLVSEDCAKLELKKL  71

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              ACK+WGFF LI+H VS  LIEK K  T++  N+PMEE
Sbjct  72   HHACKDWGFFHLINHEVSPKLIEKVKKGTEELFNMPMEE  110



>ref|XP_003543178.1| PREDICTED: protein SRG1 [Glycine max]
Length=357

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 52/105 (50%), Positives = 68/105 (65%), Gaps = 8/105 (8%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDD------LDPSAPAQREIPVINMSNLL--QGDS  232
            G +L VP V ELAK++   VP RY +        +     +  EIPVI+M  LL  +  S
Sbjct  10   GTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRLLSVESGS  69

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL KL +ACKEWGFFQL++HGV+SSL+EK + +T+DF NLPM E
Sbjct  70   SELDKLHLACKEWGFFQLVNHGVNSSLVEKVRLETQDFFNLPMSE  114



>ref|XP_003614574.1| Protein SRG1 [Medicago truncatula]
 gb|AES97532.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 70/104 (67%), Gaps = 4/104 (4%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSE  235
              LG +L VP VQELAKQ    VP +Y + + DP    +  + +++PVI+++ LL  D+ 
Sbjct  2    SNLGTSLLVPYVQELAKQPNIEVPEQYLQPNQDPINVSNTSSLQQVPVIDLNKLLSEDAT  61

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL+ LD ACKEWGFFQLI+HGV   L+E  K   ++FL+LP+EE
Sbjct  62   ELENLDQACKEWGFFQLINHGVDHLLVENVKIGVQEFLSLPVEE  105



>ref|XP_009109218.1| PREDICTED: protein SRG1-like [Brassica rapa]
Length=358

 Score = 96.7 bits (239),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQS-PEIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+   + VP RY R DLD +  A     + EIPVI+MS L    +   E
Sbjct  12   SIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACEFGLKAEIPVIDMSRLCSSTTMDSE  71

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ++KLD+ACKEWGFFQL++HGV S  ++K K+  +DF NLPMEE
Sbjct  72   IEKLDLACKEWGFFQLVNHGVDSGFLDKFKSQIQDFFNLPMEE  114



>emb|CDY24858.1| BnaA08g14520D [Brassica napus]
Length=358

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 69/103 (67%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQS-PEIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+   + VP RY R DLD +  A     + EIPVI+MS L    +   E
Sbjct  12   SIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACESGLKAEIPVIDMSRLSSSTTMDSE  71

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ++KLD+ACKEWGFFQL++HGV S  ++K K+  +DF NLPMEE
Sbjct  72   IEKLDLACKEWGFFQLVNHGVDSGFLDKFKSQIQDFFNLPMEE  114



>ref|XP_006355577.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=359

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 7/101 (7%)
 Frame = +2

Query  86   LQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ--REIPVINMSNLLQGDSE-----ELK  244
            ++VP VQELAK+    +P RY RDD D S      +++PVI+M  L+  +       EL 
Sbjct  9    MEVPSVQELAKKKLMTIPSRYVRDDQDRSIATSNYKQVPVIDMQRLINSNDHDSMNLELN  68

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KL  A K+WGFFQLI+HGVS S++EK K +T+ F +LP+EE
Sbjct  69   KLHFAAKDWGFFQLINHGVSCSVVEKMKHETQKFFDLPLEE  109



>ref|XP_006442333.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
 gb|ESR55573.1| hypothetical protein CICLE_v10020840mg [Citrus clementina]
Length=355

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 50/104 (48%), Positives = 66/104 (63%), Gaps = 6/104 (6%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLLQGDS--E  235
            +G +L VPCVQEL K    +VP RY R D D    +      +IPVI+M +L   +S   
Sbjct  4    IGSSLLVPCVQELVKNPALVVPDRYIRPDQDSPLISDDTLISQIPVIDMQSLHSEESMDS  63

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD  CKEWGFFQL++HG+S++ +EK K + + F NL MEE
Sbjct  64   ELAKLDFVCKEWGFFQLVNHGMSTAFLEKLKKEVEGFFNLSMEE  107



>ref|XP_010057208.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
Length=365

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 70/108 (65%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS------APAQREIPVINMSNLLQGDSE  235
            LGG+L VP VQELAK++   VPPRY R D D S        +  ++PVI++S L   + +
Sbjct  8    LGGSLPVPSVQELAKEAITEVPPRYVRPDQDHSFMHADLGTSLLQVPVIDLSKLSSSNED  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+ L +AC++WGFFQLI+HGV  SL+E+ K   ++F  LPMEE
Sbjct  68   LMESELENLHVACRDWGFFQLINHGVRCSLVEEVKLGIQEFFELPMEE  115



>dbj|BAE99802.1| SRG1-like protein [Arabidopsis thaliana]
Length=356

 Score = 96.3 bits (238),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGD  229
            G    ++ VP VQE+ K+     VPPRY R D D +  A     + +IP+I+MS L    
Sbjct  5    GATRSSIIVPSVQEMVKEKVITTVPPRYVRSDQDVAEIAVDSGLRNQIPIIDMSLLCSST  64

Query  230  S--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   E+ KLD ACKEWGFFQL++HG+ SS + K K++ +DF NLPMEE
Sbjct  65   SMDSEIDKLDSACKEWGFFQLVNHGMESSFLNKVKSEVQDFFNLPMEE  112



>gb|AJI44435.1| oxoglutarate-dependent flavone 7-O-demethylase [Ocimum basilicum]
Length=372

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 53/111 (48%), Positives = 73/111 (66%), Gaps = 5/111 (5%)
 Frame = +2

Query  50   ERSIS-SGTLGGTLQVPCVQELAKQSPEIVPPRYFR--DDLDPSAPAQREIPVINMSNLL  220
            ER ++ S  +G +L+VP VQELAK     VP RY R  D  + + P   +IPVI+M  LL
Sbjct  17   ERDMAESKAIGRSLEVPNVQELAKGKLASVPARYVRYSDRENTTLPPLTQIPVIDMQALL  76

Query  221  QGDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              +S   EL  L  ACK+WGFFQLI+HGV ++++EK K + ++F NLP+EE
Sbjct  77   HPNSFEAELNSLHKACKQWGFFQLINHGVEAAVMEKMKLEMQEFFNLPLEE  127



>ref|NP_194260.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
 emb|CAA23071.1| SRG1-like protein [Arabidopsis thaliana]
 emb|CAB81341.1| SRG1-like protein [Arabidopsis thaliana]
 gb|AEE85036.1| 2-oxoglutarate (2OG) and Fe(II)-dependent oxygenase superfamily 
protein [Arabidopsis thaliana]
Length=356

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 51/108 (47%), Positives = 68/108 (63%), Gaps = 8/108 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGD  229
            G    ++ VP VQE+ K+     VPPRY R D D +  A     + +IP+I+MS L    
Sbjct  5    GATRSSIIVPSVQEMVKEKMITTVPPRYVRSDQDVAEIAVDSGLRNQIPIIDMSLLCSST  64

Query  230  S--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            S   E+ KLD ACKEWGFFQL++HG+ SS + K K++ +DF NLPMEE
Sbjct  65   SMDSEIDKLDSACKEWGFFQLVNHGMESSFLNKVKSEVQDFFNLPMEE  112



>ref|XP_007022030.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY13555.1| Senescence-related gene 1 [Theobroma cacao]
Length=375

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 57/124 (46%), Positives = 71/124 (57%), Gaps = 27/124 (22%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSNLLQGDS--EE  238
            G +L VP VQELAK+    +PPRY R DL+     +A +  EIPVI+M  L+  +S    
Sbjct  9    GSSLLVPSVQELAKKPIATIPPRYLRPDLEKPIVSNAGSISEIPVIDMEGLVSKESMDSS  68

Query  239  LKKLDIACKEWGFFQ---------------------LISHGVSSSLIEKXKTDTKDFLNL  355
            L KLD ACKEWGFFQ                     LI+HG+S SL+EK KT+ +DF NL
Sbjct  69   LAKLDFACKEWGFFQVQLALCIYHLNPYSTLVPGEYLINHGMSLSLVEKVKTEIQDFFNL  128

Query  356  PMEE  367
             MEE
Sbjct  129  AMEE  132



>ref|XP_004233006.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=359

 Score = 96.3 bits (238),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 68/101 (67%), Gaps = 7/101 (7%)
 Frame = +2

Query  86   LQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ--REIPVINMSNLLQGDSE-----ELK  244
            ++VP VQELAK+    +P RY RDD D S  +   +E+PVI+M  L+  +       EL 
Sbjct  9    MEVPSVQELAKKKLVSIPSRYVRDDQDRSIASSIYKEVPVIDMQRLINFNDHDSMNLELN  68

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KL +A K+WGFFQLI+HGVS S++EK K +T+ F +LP+EE
Sbjct  69   KLHLAAKDWGFFQLINHGVSCSVVEKMKDETQKFFDLPLEE  109



>ref|XP_010096601.1| Protein SRG1 [Morus notabilis]
 gb|EXB65269.1| Protein SRG1 [Morus notabilis]
Length=359

 Score = 95.9 bits (237),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/104 (46%), Positives = 65/104 (63%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPS--APAQREIPVINMSNLLQGDSE  235
            G +L VP VQE+ +  P+ VP RY +D      LD +       +IPVI+ S L+ GD +
Sbjct  10   GKSLPVPSVQEIVRNDPKFVPERYIQDHKNRPVLDSTTFGSDSSDIPVIDFSLLISGDED  69

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD ACKEWGFFQ+I+HGV+  ++ K K     F +LP+EE
Sbjct  70   ELNKLDFACKEWGFFQIINHGVAVMVLSKMKAAVAAFFDLPLEE  113



>ref|XP_004134919.1| PREDICTED: protein SRG1-like [Cucumis sativus]
 ref|XP_004155625.1| PREDICTED: protein SRG1-like [Cucumis sativus]
Length=358

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 56/112 (50%), Positives = 64/112 (57%), Gaps = 5/112 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS---APAQREIPVINMSNL  217
            ME   S   L   L VPCVQEL K S   VP RY R D DP      A  E+PVI+M  L
Sbjct  1    METLSSKLLLRDPLPVPCVQELVKSSLSTVPLRYVRPDQDPPFEFTDASAEVPVIDMHKL  60

Query  218  LQGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               + E  EL KL  ACK+WGFFQ+I+HGVS  LIE  K+  +   NLPM E
Sbjct  61   FSNNFENSELDKLHHACKDWGFFQVINHGVSDVLIENVKSGIQSLFNLPMVE  112



>gb|KEH38520.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=278

 Score = 95.5 bits (236),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLL--QGDSEE  238
            G +L VP VQELAK+    VP RY +   +      A +  EIPVI+M  LL  +  S E
Sbjct  9    GTSLLVPSVQELAKEKISTVPARYIQSQHEELVINEANSILEIPVIDMKKLLSLEYGSLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL +ACK+WGFFQL++H VSSSL+EK K +  DF NLPM E
Sbjct  69   LSKLHLACKDWGFFQLVNHDVSSSLLEKVKMEIMDFFNLPMSE  111



>gb|KEH38519.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=358

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/103 (51%), Positives = 66/103 (64%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLL--QGDSEE  238
            G +L VP VQELAK+    VP RY +   +      A +  EIPVI+M  LL  +  S E
Sbjct  9    GTSLLVPSVQELAKEKISTVPARYIQSQHEELVINEANSILEIPVIDMKKLLSLEYGSLE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL +ACK+WGFFQL++H VSSSL+EK K +  DF NLPM E
Sbjct  69   LSKLHLACKDWGFFQLVNHDVSSSLLEKVKMEIMDFFNLPMSE  111



>ref|XP_006442325.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|ESR55565.1| hypothetical protein CICLE_v10020838mg [Citrus clementina]
 gb|KDO39141.1| hypothetical protein CISIN_1g018510mg [Citrus sinensis]
Length=355

 Score = 95.9 bits (237),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQREI----PVINMSNLLQGDS--EE  238
            GG+L VP VQELA+     VPPRY R + D    +   +    PVI+M +LL  +S   E
Sbjct  5    GGSLLVPSVQELAENPMVAVPPRYIRPEQDAPVISDNTLISKFPVIDMQSLLSEESVDSE  64

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L  LD AC+EWGFFQL++HGVS +L++K K + ++F NL MEE
Sbjct  65   LANLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEE  107



>emb|CDY08970.1| BnaC08g12000D [Brassica napus]
Length=358

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 70/103 (68%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQS-PEIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+   + VP RY R DLD +  A     + EIPVI+MS L    +   E
Sbjct  12   SIIVPSVQEMVKEKLIKKVPQRYVRSDLDKAEIACDSGLKAEIPVIDMSRLCSSTTMDSE  71

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ++KLD+ACKEWGFFQL++HGV S  ++K K++ ++F NLPMEE
Sbjct  72   IEKLDLACKEWGFFQLVNHGVDSGFLDKFKSEIQNFFNLPMEE  114



>gb|KDP21184.1| hypothetical protein JCGZ_21655 [Jatropha curcas]
Length=369

 Score = 95.9 bits (237),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 70/109 (64%), Gaps = 7/109 (6%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAP-----AQREIPVINMSNLLQG  226
            +   LG T+ VP V+ELAK+    +PPRY   D  P +      +  +IPVI+M+ LL  
Sbjct  9    AKSRLGSTVLVPSVKELAKEQFISIPPRYVHHDQQPPSTVIDTNSLPQIPVIDMAKLLSQ  68

Query  227  D--SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +    EL+K   AC++WGFFQL++HGVS+ L+EK K +T+ F NLPME+
Sbjct  69   EFMDSELQKFHHACRDWGFFQLVNHGVSTELLEKVKVETEKFFNLPMEK  117



>ref|XP_010433658.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=353

 Score = 95.5 bits (236),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 71/106 (67%), Gaps = 7/106 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGD  229
            G    ++ VP VQE+ K++    VPPRY R   D +  +     + +IP+I+MS L   D
Sbjct  5    GVTRRSIIVPSVQEMVKENIITAVPPRYVRSGQDKAEISSETGLRNQIPIIDMSLLSSLD  64

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            SE ++KLD ACKEWGFFQL++HG+ S+ +EK K++ +DF NLPMEE
Sbjct  65   SE-IEKLDFACKEWGFFQLVNHGMDSTFLEKFKSEIQDFFNLPMEE  109



>gb|KDO52127.1| hypothetical protein CISIN_1g045260mg [Citrus sinensis]
Length=355

 Score = 95.5 bits (236),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDS--EE  238
            GG+L VP V+ELA+     VPPRY R   D    +      + PVI+M +LL  +S   E
Sbjct  5    GGSLLVPSVKELAENPMVAVPPRYIRPKQDAPVISDNTLISKFPVIDMESLLSEESMDSE  64

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD AC+EWGFFQL++HGVS +L++K K + ++F NL MEE
Sbjct  65   LAKLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEE  107



>ref|XP_006477804.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=355

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDS--EE  238
            GG+L VP V+ELA+     VPPRY R   D    +      + PVI+M +LL  +S   E
Sbjct  5    GGSLLVPSVKELAENPMVAVPPRYIRPKQDAPVISDNTLISKFPVIDMESLLSEESMDSE  64

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KLD AC+EWGFFQL++HGVS +L++K K + ++F NL MEE
Sbjct  65   LAKLDFACREWGFFQLVNHGVSLALVDKVKKEIQEFFNLSMEE  107



>ref|NP_173145.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
 sp|Q39224.1|SRG1_ARATH RecName: Full=Protein SRG1; Short=AtSRG1; AltName: Full=Protein 
SENESCENCE-RELATED GENE 1 [Arabidopsis thaliana]
 gb|AAD50032.1|AC007651_27 SRG1 Protein [Arabidopsis thaliana]
 emb|CAA55654.1| SRG1 [Arabidopsis thaliana]
 gb|AAK82564.1| F6I1.30/F6I1.30 [Arabidopsis thaliana]
 gb|AAM98100.1| At1g17020/F6I1.30 [Arabidopsis thaliana]
 gb|AEE29531.1| Fe(II)/ascorbate oxidase family protein SRG1 [Arabidopsis thaliana]
Length=358

 Score = 95.1 bits (235),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQ-SPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+ +   VPPRY R D     +D     + EIP+I+M  L    +   E
Sbjct  11   SILVPSVQEMVKEKTITTVPPRYVRSDQDKTEVDDDFDVKIEIPIIDMKRLCSSTTMDSE  70

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ++KLD ACKEWGFFQL++HG+ SS ++K K++ +DF NLPMEE
Sbjct  71   VEKLDFACKEWGFFQLVNHGIDSSFLDKVKSEIQDFFNLPMEE  113



>ref|XP_010448451.1| PREDICTED: protein SRG1-like [Camelina sativa]
Length=354

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/107 (50%), Positives = 70/107 (65%), Gaps = 8/107 (7%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSP-EIVPPRYFRDD-LDPSAPA-----QREIPVINMSNLLQG  226
            G    ++ VP VQEL K+     VPPRY R   +D +  A     + +IP+I+MS L   
Sbjct  5    GVTRRSIIVPSVQELVKEDMITAVPPRYVRSSQVDKAEVAVDSDLRNQIPIIDMSLLSSL  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            DSE + KLD ACKEWGFFQL++HG+ SS +EK K++ +DF NLPMEE
Sbjct  65   DSE-IDKLDFACKEWGFFQLVNHGMDSSFLEKFKSEIQDFFNLPMEE  110



>ref|XP_008378981.1| PREDICTED: protein SRG1-like [Malus domestica]
Length=196

 Score = 93.2 bits (230),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 53/123 (43%), Positives = 69/123 (56%), Gaps = 16/123 (13%)
 Frame = +2

Query  47   MERSISSGT--LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----------SAPAQRE  190
            ME   S+G    G +L VP VQEL K+    +PPRY +               S     +
Sbjct  1    MEEKASAGKSMYGSSLLVPSVQELVKKPVTTIPPRYIQHHHQDGNQEHEMTINSDYHAHQ  60

Query  191  IPVINMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLP  358
            IP I++  LL  +S     EL +L  ACKEWGFFQL++HGVSSSL+ K +T+ +DF NLP
Sbjct  61   IPSIDVQKLLSQESTISDSELARLHFACKEWGFFQLVNHGVSSSLVGKIRTEIQDFFNLP  120

Query  359  MEE  367
             EE
Sbjct  121  TEE  123



>gb|KEH19983.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=357

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLL-QGDSEE  238
            LG +L VP VQEL KQ    VP RY + + +PS  +      ++PVI++  LL + D  E
Sbjct  9    LGTSLLVPSVQELVKQPIAKVPERYVQQNQEPSVVSSTISLPQVPVIDLKKLLSEEDGTE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+K D ACKEWGFFQLI+HGV+  L+E  K   +DF NLP+EE
Sbjct  69   LEKFDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEE  111



>gb|KEH19984.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=362

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLL-QGDSEE  238
            LG +L VP VQEL KQ    VP RY + + +PS  +      ++PVI++  LL + D  E
Sbjct  14   LGTSLLVPSVQELVKQPIAKVPERYVQQNQEPSVVSSTISLPQVPVIDLKKLLSEEDGTE  73

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+K D ACKEWGFFQLI+HGV+  L+E  K   +DF NLP+EE
Sbjct  74   LEKFDHACKEWGFFQLINHGVNPLLVENFKKLVQDFFNLPVEE  116



>gb|KEH16106.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=352

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/99 (49%), Positives = 64/99 (65%), Gaps = 4/99 (4%)
 Frame = +2

Query  83   TLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELKKL  250
            ++  P VQELAKQ    VP +Y + + DP   +      +IP+IN   LL  D+ EL+KL
Sbjct  5    SILAPSVQELAKQGITKVPKQYLQPNQDPIVVSNTTSLPQIPIINFDKLLCEDATELEKL  64

Query  251  DIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D ACKEWGFFQLI+HGV+ SL+E  K   + F NLP+EE
Sbjct  65   DHACKEWGFFQLINHGVNPSLVENVKIRVEQFFNLPVEE  103



>ref|XP_006355575.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=358

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 8/101 (8%)
 Frame = +2

Query  89   QVPCVQELAKQSPEIVPPRYFRDDLDPSAPA---QREIPVINMSNLLQGDSE-----ELK  244
            +VP VQE+AK     +P RY RD+ D S  A    +E+PVI+M  L+          EL 
Sbjct  15   KVPSVQEMAKNKLVTIPSRYVRDNQDRSFVASSNNKEVPVIDMQRLINSSDHDSMNLELN  74

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KL  A KEWGFFQLI+HGV+S L+EK K + K+  NLP+EE
Sbjct  75   KLHFAAKEWGFFQLINHGVNSLLVEKMKNEIKELFNLPLEE  115



>gb|KEH17521.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=359

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEEL  241
             G +L VP VQELAK+    VP +Y   + DP    +  + +++PVI++S LL  D+ EL
Sbjct  4    FGTSLLVPSVQELAKKPIIEVPEQYLYPNQDPIVLSNTSSLQQVPVIDLSKLLCEDASEL  63

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD ACK+WGFFQLI+HGVS SL+E  K   ++F++ P+EE
Sbjct  64   QKLDQACKQWGFFQLINHGVSPSLVENLKIGVQEFMSRPVEE  105



>gb|KEH17519.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 70/102 (69%), Gaps = 4/102 (4%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEEL  241
             G +L VP VQELAK+    VP +Y   + DP    +  + +++PVI++S LL  D+ EL
Sbjct  4    FGTSLLVPSVQELAKKPIIEVPEQYLYPNQDPIVLSNTSSLQQVPVIDLSKLLCEDASEL  63

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KLD ACK+WGFFQLI+HGVS SL+E  K   ++F++ P+EE
Sbjct  64   QKLDQACKQWGFFQLINHGVSPSLVENLKIGVQEFMSRPVEE  105



>ref|XP_011002641.1| PREDICTED: protein SRG1-like [Populus euphratica]
Length=370

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDSE  235
            T G +L VP VQE+ ++  E +  RY ++  D +     +P   EIP+IN S L+ GD +
Sbjct  17   TWGKSLPVPSVQEMVRKDHEFLSERYIQEHKDRAVATNLSPTTSEIPIINFSLLINGDED  76

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E +KLD ACKEWGFFQ+ +HGV   +++K K     F  LP+EE
Sbjct  77   ERRKLDTACKEWGFFQITNHGVPEKVLKKMKAAVAAFYELPLEE  120



>gb|KFK43894.1| hypothetical protein AALP_AA1G187900 [Arabis alpina]
Length=358

 Score = 94.7 bits (234),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 50/101 (50%), Positives = 66/101 (65%), Gaps = 10/101 (10%)
 Frame = +2

Query  92   VPCVQELAKQS-PEIVPPRYFRDD------LDPSAPAQREIPVINMSNLLQGDS--EELK  244
            VPCVQE+ ++     VPPRY R D      +D S     EIP+I+M  L    S   E++
Sbjct  14   VPCVQEMVEEKLITTVPPRYVRSDQAKTEVIDGSG-LNTEIPIIDMKRLCSAVSMDSEVQ  72

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGFFQL++HG+  SL++K K++ +DF NLPMEE
Sbjct  73   KLDFACKEWGFFQLVNHGIDPSLLDKFKSEIQDFFNLPMEE  113



>gb|KHN29925.1| Protein SRG1-like protein [Glycine soja]
Length=354

 Score = 94.4 bits (233),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/101 (49%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELK  244
            G +  VP VQELAKQ    VP RY   + DP   +      ++P+I++  LL  D  EL+
Sbjct  5    GTSCLVPSVQELAKQPIIEVPERYVHANQDPHILSNTISLPQVPIIDLHQLLSEDPSELE  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGFFQLI+HGV   ++E  K   ++F NLPMEE
Sbjct  65   KLDHACKEWGFFQLINHGVDPPVVENMKIGVQEFFNLPMEE  105



>ref|XP_006494121.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=137

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 64/101 (63%), Gaps = 6/101 (6%)
 Frame = +2

Query  65   SGTLGGTLQVPCVQELAKQSPEI-VPPRYFRDDLDP-----SAPAQREIPVINMSNLLQG  226
            +  +G +L  P + ELA   P I VPPRY   ++D         + +++PVI+M  LL G
Sbjct  5    ATVIGSSLAEPSILELANNQPLITVPPRYVHPEIDHPLIRNDDSSTQQLPVIDMHRLLSG  64

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFL  349
            D  EL+KLD ACK+WGFFQL++HGVSSSL+EK K   K  L
Sbjct  65   DDSELEKLDHACKDWGFFQLMNHGVSSSLVEKVKARFKTSL  105



>ref|XP_009376708.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=367

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 54/126 (43%), Positives = 74/126 (59%), Gaps = 22/126 (17%)
 Frame = +2

Query  47   MERSISSGT--LGGTLQVPCVQELAKQSPEIVPPRYFRD-------------DLDPSAPA  181
            M++  S+G    GG+L VP VQE  K+    +P RY +              + D  AP 
Sbjct  1    MDKKASAGKSLYGGSLHVPSVQEFVKKPILTIPTRYLQPHDQDGNQEHEMIINSDHHAP-  59

Query  182  QREIPVINMSNLLQGDS----EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFL  349
              +IP I+M  LL  +S     EL +L  ACKEWGFFQ+++H VSSS++EK KT+T++F 
Sbjct  60   --QIPSIDMQKLLSQESTDSEAELARLHFACKEWGFFQMVNHDVSSSVLEKMKTETQEFF  117

Query  350  NLPMEE  367
            NLPMEE
Sbjct  118  NLPMEE  123



>ref|XP_010417451.1| PREDICTED: protein SRG1-like isoform X1 [Camelina sativa]
 ref|XP_010417452.1| PREDICTED: protein SRG1-like isoform X2 [Camelina sativa]
Length=357

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 66/103 (64%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAK-QSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDS--EE  238
            +L VP V E+ K ++   VPPRY   D D +     +    EIPVI+M  L    +   E
Sbjct  11   SLIVPSVLEMVKDKNFTTVPPRYVLSDQDKTEILDDSSLNSEIPVIDMKRLCSVSTMDSE  70

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            LKKLD AC+EWGFFQL+ HG+ SSL+EK +T+ +DF NLPMEE
Sbjct  71   LKKLDFACQEWGFFQLVKHGIDSSLLEKLETEVRDFFNLPMEE  113



>gb|KJB51668.1| hypothetical protein B456_008G228300 [Gossypium raimondii]
Length=355

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD---PSAPAQREIPVINMSNL  217
            ME  + S  +  +L V  VQ LA ++   +P RY R +++    S    ++IPVI+MS L
Sbjct  1    METKVQSTDMLYSLPVENVQALASKNLNRIPSRYIRPEVEFDVVSIDESQQIPVIDMSKL  60

Query  218  LQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               D  E KKL  ACK+WGFFQLI+HGV+  +IEK KTDT++F NLP+EE
Sbjct  61   DHHD--EQKKLHQACKDWGFFQLINHGVADEVIEKMKTDTQEFFNLPLEE  108



>gb|AJI44437.1| oxoglutarate-dependent dioxygenase 3 [Ocimum basilicum]
Length=348

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 69/110 (63%), Gaps = 10/110 (9%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP--------SAPAQREIPVINMSNLLQ  223
            G+LG +L+VP VQEL K++   +P RY R DLD         +  +  +IPVI+M NL  
Sbjct  7    GSLGKSLKVPMVQELVKENLVGIPSRYIRRDLDHHHHHHHHHTLSSSLQIPVIDMHNLFH  66

Query  224  GDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             +S   EL KL  ACK+WGFFQLI+H V S+++E  K + K F ++ +EE
Sbjct  67   QESVDSELDKLHNACKQWGFFQLINHRVESAVVENMKAEVKGFFDMAIEE  116



>gb|KJB51669.1| hypothetical protein B456_008G228300 [Gossypium raimondii]
Length=350

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/110 (47%), Positives = 71/110 (65%), Gaps = 5/110 (5%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD---PSAPAQREIPVINMSNL  217
            ME  + S  +  +L V  VQ LA ++   +P RY R +++    S    ++IPVI+MS L
Sbjct  1    METKVQSTDMLYSLPVENVQALASKNLNRIPSRYIRPEVEFDVVSIDESQQIPVIDMSKL  60

Query  218  LQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               D  E KKL  ACK+WGFFQLI+HGV+  +IEK KTDT++F NLP+EE
Sbjct  61   DHHD--EQKKLHQACKDWGFFQLINHGVADEVIEKMKTDTQEFFNLPLEE  108



>gb|KCW54631.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=295

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFR--DDLDP-SAPAQREIPVINMSNLLQGDSEEL  241
              G ++ VP VQELA++    +PPRY R  DD DP S  A   +PV+++  L +GD  EL
Sbjct  16   NFGRSIIVPSVQELARKPIVNLPPRYVRCSDDEDPVSGDASESVPVVDVQRLARGDPVEL  75

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  ACK+WGFFQ+++HGVS  L+E+ K + K F +L  EE
Sbjct  76   EKLHFACKDWGFFQVVNHGVSVLLLEEFKQEIKSFFDLSYEE  117



>ref|XP_004294174.1| PREDICTED: protein SRG1-like [Fragaria vesca subsp. vesca]
Length=375

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 53/114 (46%), Positives = 68/114 (60%), Gaps = 22/114 (19%)
 Frame = +2

Query  92   VPCVQELAKQSPEIVPPRYFRDDL---------------DPSAPAQREIPVINMSNLLQG  226
            VP VQELAK+    +PPRY + DL               + S+  Q EIP IN   LL  
Sbjct  19   VPSVQELAKKPITTLPPRYIQQDLHDGDARDQVNKIGSNEASSSIQPEIPTINFKKLLSR  78

Query  227  -------DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                   DS+EL +L +A KEWGFFQL++HGVSSSL+EK KT+ +DF NL ++E
Sbjct  79   KESNSFQDSDELARLHLASKEWGFFQLVNHGVSSSLLEKIKTEIQDFFNLSIDE  132



>gb|AFK43235.1| unknown [Lotus japonicus]
Length=356

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 65/102 (64%), Gaps = 5/102 (5%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLLQGDSEEL  241
            G +L VP VQELAKQ    VP +Y   +     + PS     ++P+I+++ LL  D+ EL
Sbjct  5    GTSLLVPSVQELAKQHMIKVPEQYLHPNQEPINVAPSTTTSLQVPIIDLNKLLSEDAIEL  64

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             KL+ ACKEWGFFQLI+HGV  SL+E  K   ++F  LPME+
Sbjct  65   DKLNSACKEWGFFQLINHGVKPSLVENVKIGVQEFFGLPMEQ  106



>emb|CDX86869.1| BnaA09g22590D [Brassica napus]
Length=238

 Score = 93.2 bits (230),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 9/106 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNL--LQGD  229
            T   +L VP V E+AK++   VPPRY R D D +     +    ++PVI+M  L  +   
Sbjct  7    TQWSSLLVPSVLEIAKEN--TVPPRYLRSDQDKTDTLDDSCLSSKLPVIDMQRLCSVSAM  64

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL+KLD+AC++WGFFQL++HG+ SS +EK +T+ KD  NLPMEE
Sbjct  65   DTELEKLDLACQDWGFFQLVNHGIDSSFLEKLETEAKDLFNLPMEE  110



>ref|XP_010057205.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW74248.1| hypothetical protein EUGRSUZ_E02888 [Eucalyptus grandis]
Length=370

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 71/108 (66%), Gaps = 10/108 (9%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-PSAPAQR-----EIPVINMSNLLQGDSE  235
            LG +L VP VQE+AK+    VPPRY R + D P   A+      + PVI++S L   + +
Sbjct  8    LGSSLPVPSVQEMAKEPITEVPPRYVRANQDHPFMHAELGTSLLQAPVIDLSKLSSSNDD  67

Query  236  ----ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                EL+KL +AC++WGFFQLI+HGVS SL+E+ K   ++F NLPMEE
Sbjct  68   FMESELEKLHVACRDWGFFQLINHGVSCSLVEEVKLGIQEFFNLPMEE  115



>ref|XP_006452690.1| hypothetical protein CICLE_v100105992mg, partial [Citrus clementina]
 gb|ESR65930.1| hypothetical protein CICLE_v100105992mg, partial [Citrus clementina]
Length=144

 Score = 91.3 bits (225),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 47/92 (51%), Positives = 62/92 (67%), Gaps = 6/92 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEI-VPPRYFRDDLDP-----SAPAQREIPVINMSNLLQGDS  232
             +G +L  P + ELA   P I VPPRY R ++D         + R++PVI+M  LL GD 
Sbjct  7    VIGSSLVEPSILELANNQPLITVPPRYVRAEIDHPLIRNDDSSTRQLPVIDMHRLLSGDD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXK  328
             EL+KL+ ACK+WGFFQL++HGVSSSL+EK K
Sbjct  67   SELEKLEHACKDWGFFQLMNHGVSSSLVEKKK  98



>gb|KDP22220.1| hypothetical protein JCGZ_26051 [Jatropha curcas]
Length=363

 Score = 94.0 bits (232),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 67/105 (64%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR-----EIPVINMSNLL--QGDS  232
            LG T+ VP V+E+AK     +PPRY R D  P +         +IPVI+M+ L   Q   
Sbjct  7    LGSTVLVPSVKEIAKDQLISIPPRYVRLDHQPPSTVTNSTSLPQIPVIDMAKLFPQQFLD  66

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL+K  +ACK+WGFFQL++HGV++ L+EK K +T  F NLP+E+
Sbjct  67   SELQKFHLACKDWGFFQLVNHGVTTELLEKMKIETAAFFNLPIEK  111



>ref|XP_010027975.1| PREDICTED: protein SRG1-like [Eucalyptus grandis]
 gb|KCW54630.1| hypothetical protein EUGRSUZ_I00575 [Eucalyptus grandis]
Length=364

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 48/102 (47%), Positives = 67/102 (66%), Gaps = 3/102 (3%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFR--DDLDP-SAPAQREIPVINMSNLLQGDSEEL  241
              G ++ VP VQELA++    +PPRY R  DD DP S  A   +PV+++  L +GD  EL
Sbjct  16   NFGRSIIVPSVQELARKPIVNLPPRYVRCSDDEDPVSGDASESVPVVDVQRLARGDPVEL  75

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            +KL  ACK+WGFFQ+++HGVS  L+E+ K + K F +L  EE
Sbjct  76   EKLHFACKDWGFFQVVNHGVSVLLLEEFKQEIKSFFDLSYEE  117



>ref|XP_004488689.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=352

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 67/103 (65%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQ----REIPVINMSNLL--QGDSEE  238
            G +L VP VQELAK++   VPPRY +   +     +     EIP+I+M  LL  +  S E
Sbjct  9    GTSLLVPSVQELAKENISEVPPRYIQSQHEGLVLTKIDNILEIPIIDMHRLLSLEFGSSE  68

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L KL +ACK+WGFFQL++HG+SS L+EK K + ++F  LPM E
Sbjct  69   LTKLHLACKDWGFFQLVNHGISSCLVEKVKLEIQEFFKLPMSE  111



>ref|XP_003524845.1| PREDICTED: protein SRG1-like [Glycine max]
Length=359

 Score = 94.0 bits (232),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQSPEIVPPRYFRDD------LDPSAPAQREIPVINMSNLLQGDSEE--  238
            +L VP VQE+AK +   VP RY R        L  +     ++PVI++S LL  D +E  
Sbjct  5    SLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEPE  64

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KL  ACKEWGFFQLI+HGVS+SL+EK K   +DF NLP+EE
Sbjct  65   LEKLHYACKEWGFFQLINHGVSTSLVEKVKRGAQDFFNLPIEE  107



>ref|XP_004233001.1| PREDICTED: protein SRG1-like [Solanum lycopersicum]
Length=354

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 68/110 (62%), Gaps = 3/110 (3%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSA-PAQREIPVINMSNLLQ  223
            ME +      G +L VP VQEL+KQ    +P RY R + +P    A   +PVI++  L+ 
Sbjct  1    MESTPVKMNFGKSLLVPSVQELSKQRLTNIPARYVRSEQEPPVINAGEAVPVIDLQKLIS  60

Query  224  GDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            GDS   EL+KL  AC++WGF Q+I+HGV+ SL+E  K +  +F  LPMEE
Sbjct  61   GDSMDSELQKLHFACQQWGFLQVINHGVTPSLLEDFKREVIEFFGLPMEE  110



>ref|XP_006449603.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
 gb|ESR62843.1| hypothetical protein CICLE_v10015853mg [Citrus clementina]
Length=337

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/112 (44%), Positives = 72/112 (64%), Gaps = 5/112 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-SAPAQR---EIPVINMSN  214
             E   ++   G ++ VP VQEL  ++   VPPRY R D DP S  A      +P+I++  
Sbjct  3    FEAEATTVNFGRSIIVPSVQELTNETIINVPPRYVRTDQDPPSVTADTWLPSVPLIDLQK  62

Query  215  LLQG-DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+ G  ++EL++L  AC+EWGFFQ+I+HGVSSSL+EK K + ++F  +P EE
Sbjct  63   LVDGVHADELERLHSACREWGFFQVINHGVSSSLLEKLKFEIENFFKIPYEE  114



>ref|XP_008463796.1| PREDICTED: probable 2-oxoglutarate/Fe(II)-dependent dioxygenase 
[Cucumis melo]
Length=361

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 49/102 (48%), Positives = 63/102 (62%), Gaps = 5/102 (5%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDL---DPSAPAQREIPVINMSNLLQGDS--EEL  241
            G ++ VP VQELAK     +P RY   DL    P +    +IPVI+MSNL   D+   EL
Sbjct  12   GSSILVPSVQELAKHPITEIPHRYIHPDLLHHSPISSDASQIPVIDMSNLRSHDTMDSEL  71

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             +L  ACK WGFFQL+ HGVS SL+E+ K +T+    LP+EE
Sbjct  72   SRLHSACKNWGFFQLVKHGVSDSLVERMKMETQKLFELPIEE  113



>gb|KEH27900.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=280

 Score = 93.2 bits (230),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELK  244
            G +L VP VQEL KQ    +P RY   + DP A +      ++PVI++  LL  D+ EL+
Sbjct  5    GTSLLVPSVQELVKQPITNIPERYLHPNQDPIAVSNTSSLPQVPVIDLHKLLSDDATELQ  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D AC+ WGFFQLI+HGV++ ++E  K   + FL LPMEE
Sbjct  65   NFDHACRGWGFFQLINHGVNTPIVENMKIGVEQFLKLPMEE  105



>ref|XP_009376707.1| PREDICTED: protein SRG1-like [Pyrus x bretschneideri]
Length=372

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 55/123 (45%), Positives = 71/123 (58%), Gaps = 16/123 (13%)
 Frame = +2

Query  47   MERSISSG--TLGGTLQVPCVQELAKQSPEIVPPRYFR----------DDLDPSAPAQRE  190
            ME   S+G    GG+L VP VQEL K+    +PPRY +          + +  S     +
Sbjct  1    MEEKASAGKSMYGGSLLVPSVQELVKKPITTIPPRYIQPHHQDGNQEHEMIINSDHHAHQ  60

Query  191  IPVINMSNLLQGDSEE----LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLP  358
            IP I+M  LL  +S      L +L  ACKEWGFFQL++HGVSSSL+ K KT+ +DF NLP
Sbjct  61   IPSIDMQKLLSQESTSSESELARLHFACKEWGFFQLVNHGVSSSLVGKIKTEIQDFFNLP  120

Query  359  MEE  367
             EE
Sbjct  121  TEE  123



>ref|XP_007025217.1| Senescence-related gene 1 [Theobroma cacao]
 gb|EOY27839.1| Senescence-related gene 1 [Theobroma cacao]
Length=368

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 68/108 (63%), Gaps = 11/108 (10%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAP-------AQREIPVINMSNLLQG--  226
            LG +L VPCVQELAK+    VP RY R   +  AP       +  ++PVI+M  L     
Sbjct  8    LGASLLVPCVQELAKEHLIEVPSRYLRSTDEDPAPFLSNANSSLLQVPVIDMQKLSSKHL  67

Query  227  -DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             DSE  +KL  ACKEWGFFQLI+HGVS++L+E  K   ++F NLPMEE
Sbjct  68   KDSES-EKLHHACKEWGFFQLINHGVSAALVENVKLGIQEFFNLPMEE  114



>ref|XP_006378697.1| hypothetical protein POPTR_0010s20850g [Populus trichocarpa]
 gb|ERP56494.1| hypothetical protein POPTR_0010s20850g [Populus trichocarpa]
Length=370

 Score = 93.6 bits (231),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 64/104 (62%), Gaps = 5/104 (5%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDSE  235
            T G +L VP VQE+ ++  + +  RY ++  D +     +P   EIP+IN S L+ GD +
Sbjct  17   TWGKSLPVPSVQEMVRKDHQFLSERYIQEHKDRAVATNLSPTTSEIPIINFSLLINGDED  76

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            E +KLD ACKEWGFFQ+ +HGV   +++K K     F  LP+EE
Sbjct  77   ERRKLDTACKEWGFFQITNHGVPEKVLKKMKAAVAAFYELPLEE  120



>gb|KEH27901.1| flavonol synthase/flavanone 3-hydroxylase [Medicago truncatula]
Length=354

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/101 (46%), Positives = 63/101 (62%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELK  244
            G +L VP VQEL KQ    +P RY   + DP A +      ++PVI++  LL  D+ EL+
Sbjct  5    GTSLLVPSVQELVKQPITNIPERYLHPNQDPIAVSNTSSLPQVPVIDLHKLLSDDATELQ  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D AC+ WGFFQLI+HGV++ ++E  K   + FL LPMEE
Sbjct  65   NFDHACRGWGFFQLINHGVNTPIVENMKIGVEQFLKLPMEE  105



>ref|XP_004301702.1| PREDICTED: S-norcoclaurine synthase 1-like [Fragaria vesca subsp. 
vesca]
Length=360

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/108 (46%), Positives = 68/108 (63%), Gaps = 6/108 (6%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD---PSAPAQREIPVINMSNLLQGD  229
            I    LGG+L V  VQ LA  + + +P RY R + +    S     +IPV++M  L++  
Sbjct  7    IRKDQLGGSLPVENVQALASNNLKDIPSRYLRPEAEFEQVSIEESLQIPVVDMRKLIENS  66

Query  230  S---EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPME  364
            S   +EL KL +ACKEWGFFQLI+HGVS  +IEK KTDT++F   P+E
Sbjct  67   SFRDDELAKLHLACKEWGFFQLINHGVSDEVIEKMKTDTEEFFRQPLE  114



>gb|AGL52586.1| 2-oxoglutarate/Fe2+-dependent dioxygenase [Papaver somniferum]
Length=373

 Score = 93.2 bits (230),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 50/109 (46%), Positives = 69/109 (63%), Gaps = 11/109 (10%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-------SAPAQREIPVINMSNLLQGD-  229
            LGG+L VP VQELAKQS   VP RY R D D        ++   + +PVI++  +L  + 
Sbjct  9    LGGSLLVPSVQELAKQSLAEVPARYIRTDQDTLGDNVTVTSMIDQSVPVIDLQKVLSPEP  68

Query  230  ---SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
                 EL++L  ACKEWGFFQ+++HGV + L+EK K+D + F  LPM+E
Sbjct  69   IIGELELERLHSACKEWGFFQVVNHGVDNLLVEKVKSDIEGFFKLPMDE  117



>gb|KDP20395.1| hypothetical protein JCGZ_05278 [Jatropha curcas]
Length=345

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 9/111 (8%)
 Frame = +2

Query  59   ISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDL------DPSAPAQREIPVINMSNLL  220
            +++  L  +L VP VQEL  Q  + VPPRY RDDL      D  +P  R +P+I+M+ L+
Sbjct  1    MAAENLQWSLPVPSVQELVLQQIQTVPPRYIRDDLFIYPSDDHHSPRPR-VPLIDMTKLV  59

Query  221  QGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              DS+  EL+KL  ACK+WG FQLI+HGVS   +   K  T++F  LP+EE
Sbjct  60   NPDSQSSELQKLHSACKDWGLFQLINHGVSDVSLRNMKEQTQEFFQLPLEE  110



>ref|XP_006355571.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=357

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 48/108 (44%), Positives = 67/108 (62%), Gaps = 2/108 (2%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-PSAPAQREIPVINMSNLLQ  223
            ME +      G +L VP VQELAKQ    +P RY R + + P   A   +P+I++  L+ 
Sbjct  1    MESTPEKMNFGKSLLVPSVQELAKQHLTNIPSRYVRSEQESPVISAAASVPIIDLQKLIS  60

Query  224  GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            GDSE L+KL  AC++WGF Q+I+HGV+ SL+E  K +  +   LPMEE
Sbjct  61   GDSE-LQKLHFACQQWGFLQVINHGVTPSLLEDFKREVIELFKLPMEE  107



>ref|XP_002519769.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
 gb|EEF42742.1| Flavonol synthase/flavanone 3-hydroxylase, putative [Ricinus 
communis]
Length=363

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/114 (44%), Positives = 72/114 (63%), Gaps = 7/114 (6%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMS  211
            ME S+ +   G ++ VP VQELAK S   +P RY R + D         +   +PVI++ 
Sbjct  1    METSLEADNFGKSIIVPSVQELAKASLIEIPTRYARLNQDSPIISGDGLSHLCVPVIDLD  60

Query  212  NLLQGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             L  GDS   EL++L +AC+EWGFFQL++HGVS++L+E  K +T++F  LP EE
Sbjct  61   RLNAGDSVDLELERLHLACREWGFFQLVNHGVSTTLLEVFKLETENFFKLPYEE  114



>ref|XP_006413319.1| hypothetical protein EUTSA_v10025577mg [Eutrema salsugineum]
 gb|ESQ54772.1| hypothetical protein EUTSA_v10025577mg [Eutrema salsugineum]
Length=353

 Score = 93.2 bits (230),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/101 (47%), Positives = 66/101 (65%), Gaps = 6/101 (6%)
 Frame = +2

Query  83   TLQVPCVQELAKQSP-EIVPPRYFRDDLDPS---APAQREIPVINMSNLLQGDS--EELK  244
            ++ VP VQE+ K+   + VPPRY R DLD +        +IPVI+M+ L    +   E+ 
Sbjct  11   SIIVPSVQEMVKEKMIKTVPPRYVRSDLDKAEIDVDLNTKIPVIDMNRLCSSTTMDSEID  70

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGFFQL++HG+ S  ++K K++ +D  NLPMEE
Sbjct  71   KLDFACKEWGFFQLVNHGMDSGFLDKIKSEIQDLFNLPMEE  111



>ref|XP_004513256.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=298

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 50/106 (47%), Positives = 69/106 (65%), Gaps = 8/106 (8%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEI--VPPRYFRDDLDP----SAPAQREIPVINMSNLLQGD--  229
            LG  L  PCV+EL  ++ E+  VP RY   ++DP    +  + + +PVI++S LL  +  
Sbjct  9    LGSCLVFPCVKELVAKNGELNSVPERYVSRNIDPFVLSNIDSLQHLPVIDLSKLLYEEVK  68

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL+KLDIACKEWGFFQLI+HGVS +L+E  K   ++  NL MEE
Sbjct  69   GSELEKLDIACKEWGFFQLINHGVSMTLVEDMKKGAEELFNLSMEE  114



>emb|CDY52434.1| BnaA07g39110D [Brassica napus]
Length=358

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/106 (46%), Positives = 69/106 (65%), Gaps = 9/106 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNL--LQGD  229
            T   +L VP V E+AK++   VPPRY R D D +     +    ++PVI+M  L  +   
Sbjct  7    TQWSSLLVPSVLEIAKEN--TVPPRYLRSDQDKTDTLDDSCLSSKLPVIDMQRLCSVSAM  64

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL+KLD+AC++WGFFQL++HG+ SS +EK +T+ KD  NLPMEE
Sbjct  65   DTELEKLDLACQDWGFFQLVNHGIDSSFLEKLETEAKDLFNLPMEE  110



>ref|XP_010654354.1| PREDICTED: protein SRG1-like [Vitis vinifera]
Length=347

 Score = 92.8 bits (229),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/104 (44%), Positives = 68/104 (65%), Gaps = 5/104 (5%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRD--DLDPSAPAQR---EIPVINMSNLLQGDSE  235
            T  G+L VP VQE+ + +P  VP RY R+  D+  +  A     EIPVI++S L  G  E
Sbjct  16   TYAGSLPVPNVQEMERSNPMQVPERYIRNQEDMPKTTDAIHLSCEIPVIDLSLLSNGHKE  75

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ELKKL++AC+EWGFFQ+++HGV+  +++  K    +F  LP++E
Sbjct  76   ELKKLELACEEWGFFQVVNHGVAEEVLQGMKYSASEFFELPLQE  119



>ref|XP_011085299.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=352

 Score = 92.8 bits (229),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 51/105 (49%), Positives = 66/105 (63%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLLQGDS--  232
            LGG+L VP VQEL K+    VPPRY R D     +  S  +   IPVI+M  L    S  
Sbjct  5    LGGSLPVPIVQELGKEKLATVPPRYVRPDQHQQMILSSLSSLPPIPVIDMQKLSDKYSLD  64

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL+ L  AC+EWGFFQLI+HGV ++++EK K   ++F NLP+EE
Sbjct  65   SELQALHNACQEWGFFQLINHGVDAAVVEKMKLQVQEFFNLPIEE  109



>ref|XP_007207795.1| hypothetical protein PRUPE_ppa025000mg, partial [Prunus persica]
 gb|EMJ08994.1| hypothetical protein PRUPE_ppa025000mg, partial [Prunus persica]
Length=354

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/106 (44%), Positives = 62/106 (58%), Gaps = 7/106 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRD-------DLDPSAPAQREIPVINMSNLLQGD  229
            T G +L VP VQE+ K  P  VP RY          D D +     EIP I+ S L +G 
Sbjct  3    TFGSSLPVPNVQEIVKSDPLHVPERYLIKNQEDMPKDADHTCNLSSEIPTIDFSLLSRGH  62

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EEL KLD+ACKEWGFFQ+++HGV++ +++  K     F  LP+EE
Sbjct  63   KEELTKLDLACKEWGFFQMVNHGVATEVLQGMKDAAAKFFELPVEE  108



>gb|KHN25971.1| Protein SRG1 [Glycine soja]
Length=483

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQSPEIVPPRYFRDD------LDPSAPAQREIPVINMSNLLQGDSEE--  238
            +L VP VQE+AK +   VP RY R        L  +     ++PVI++S LL  D +E  
Sbjct  129  SLTVPFVQEIAKDALTRVPERYVRPLHERPILLSATTTPLPQVPVIDLSKLLSQDLKEPE  188

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KL  ACKEWGFFQLI+HGVS+SL+EK K   +DF NLP+EE
Sbjct  189  LEKLHYACKEWGFFQLINHGVSTSLVEKVKRGAQDFFNLPIEE  231



>emb|CDX88453.1| BnaC06g38970D [Brassica napus]
Length=363

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/108 (45%), Positives = 70/108 (65%), Gaps = 9/108 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSP-EIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQ---  223
            T   +L VP V E+AK++    VPPRY R + D +     +    ++PVI+M  L     
Sbjct  7    TQWSSLLVPSVLEIAKENNFTTVPPRYLRSEQDKTETLDDSCLSSKLPVIDMQRLCSVSA  66

Query  224  GDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             D+ ELKKLD+AC++WGFFQL++HG+ SS +EK +T+ +D  NLPMEE
Sbjct  67   MDTTELKKLDLACQDWGFFQLVNHGIDSSFLEKLETEAQDLFNLPMEE  114



>gb|KHG08200.1| S-norcoclaurine synthase 1 [Gossypium arboreum]
Length=349

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD--PSAPAQREIPVINMSNLL  220
            M+  + S    G+L V  VQ LA ++ + +P RY R +++   S    ++IPVI+MS L 
Sbjct  1    MDTKVVSRGFAGSLPVDSVQALASKNLKNIPSRYIRPEVEFVVSIGESQQIPVIDMSKLD  60

Query  221  QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            + D  E KKL  ACK+WGFFQLI+HG++  +IEK K DT++F  LP+EE
Sbjct  61   RDD--EQKKLHQACKDWGFFQLINHGIADEVIEKMKIDTQEFFKLPLEE  107



>ref|XP_002890198.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66457.1| hypothetical protein ARALYDRAFT_889094 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 92.4 bits (228),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 67/103 (65%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQ-SPEIVPPRYFRDDLDPSA-----PAQREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+ +   VPPRY R D D +        + EIP+I++  L    +   E
Sbjct  11   SILVPSVQEMVKEKTITTVPPRYVRSDQDKTKVDDDFDVKTEIPIIDLKRLCSSTTMDSE  70

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            ++KLD ACKEWGFFQL++HG+  S ++K K++ +DF NLPMEE
Sbjct  71   VEKLDFACKEWGFFQLVNHGIEPSFLDKVKSEIQDFFNLPMEE  113



>gb|ACU21203.1| unknown [Glycine max]
Length=255

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELK  244
            G +  VP V ELAKQ    VP RY   + DP   +      ++P+I++  LL  D  EL+
Sbjct  5    GTSCLVPSVLELAKQPIIEVPERYVHANQDPHILSNTISLPQVPIIDLHQLLSEDPSELE  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGFFQLI+HGV   ++E  K   ++F NLPMEE
Sbjct  65   KLDHACKEWGFFQLINHGVDPPVVENMKIGVQEFFNLPMEE  105



>ref|XP_006416751.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
 gb|ESQ35104.1| hypothetical protein EUTSA_v10008010mg [Eutrema salsugineum]
Length=360

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/105 (46%), Positives = 63/105 (60%), Gaps = 10/105 (10%)
 Frame = +2

Query  83   TLQVPCVQELAKQSP-EIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDS----  232
            ++ VP VQE+ K+     VPPRY R DLD +     +    EIP+I+M  L    +    
Sbjct  11   SIIVPSVQEMVKEKMITTVPPRYVRSDLDKTEITDGSGLNTEIPIIDMKRLCSSTAIAMD  70

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             E++KLD ACKEWGFFQL++HG+  S +EK K     F NLPMEE
Sbjct  71   SEVEKLDFACKEWGFFQLVNHGIDPSFLEKTKAGIHGFFNLPMEE  115



>ref|XP_010107326.1| Protein SRG1 [Morus notabilis]
 gb|EXC14806.1| Protein SRG1 [Morus notabilis]
Length=360

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/104 (43%), Positives = 66/104 (63%), Gaps = 5/104 (5%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPA-----QREIPVINMSNLLQGDSE  235
            T   +LQVP VQE+  + P  VP RY R++ +            ++P+I++S L +GD E
Sbjct  13   TYAPSLQVPSVQEMVMKDPLQVPERYIRNEEEMQKKLDMFHLSSQVPIIDLSLLSKGDEE  72

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KLD+ACKEWGFF++++HGV S +++  K  T  F  LP+EE
Sbjct  73   ELVKLDLACKEWGFFKVVNHGVESEVLKAMKDATVQFFELPLEE  116



>ref|XP_006429134.1| hypothetical protein CICLE_v10011334mg [Citrus clementina]
 gb|ESR42374.1| hypothetical protein CICLE_v10011334mg [Citrus clementina]
Length=598

 Score = 94.4 bits (233),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 68/109 (62%), Gaps = 5/109 (5%)
 Frame = +2

Query  56   SISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLL  220
            ++ + T   +L VP VQE+ K  P  VP RY R+      ++  +    EIPVI+++ L 
Sbjct  245  NVDAPTYAPSLPVPNVQEMVKNDPLHVPERYVRNQEDGPLMNDMSHLSSEIPVIDLALLS  304

Query  221  QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             GD EELKKLD+ACKEWGFFQ+++HGV+  + +  K    +F  LP++E
Sbjct  305  AGDIEELKKLDLACKEWGFFQVVNHGVAKEVFQNMKNAASEFFELPLQE  353



>gb|KHG12687.1| S-norcoclaurine synthase 1 [Gossypium arboreum]
Length=342

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/111 (46%), Positives = 70/111 (63%), Gaps = 7/111 (6%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD----PSAPAQREIPVINMSN  214
            M   + S    G+L V  VQ LA ++ + +P RY R +++    P   +Q +IPVI+MS 
Sbjct  1    MGTKVVSRAFAGSLPVDSVQALASKNLKNIPSRYIRPEIEFEVVPIDESQ-QIPVIDMSK  59

Query  215  LLQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L  GD  E KKL  ACK+WGFFQLI+HG++  LI K K DT++F  LP+EE
Sbjct  60   LDHGD--EQKKLHQACKDWGFFQLINHGIADELIAKMKIDTQEFFKLPLEE  108



>gb|KJB51686.1| hypothetical protein B456_008G228400 [Gossypium raimondii]
Length=349

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD--PSAPAQREIPVINMSNLL  220
            M+  + S    G+L V  VQ LA ++ + +P RY R +++   S    ++ PVI+MS L 
Sbjct  1    MDTKVVSRGFAGSLPVDSVQALASKNLKNIPSRYIRPEVEFIVSIDESQQFPVIDMSKLD  60

Query  221  QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D  E KKL  ACK+WGFFQLI+HG++  LIEK K DT++F  LP+EE
Sbjct  61   HDD--EQKKLHQACKDWGFFQLINHGIADELIEKMKIDTQEFFKLPLEE  107



>gb|KHG18773.1| S-norcoclaurine synthase 1 [Gossypium arboreum]
Length=341

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/109 (45%), Positives = 71/109 (65%), Gaps = 4/109 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD--PSAPAQREIPVINMSNLL  220
            M+  + S    G+L V  VQ LA ++ + +P RY R +++   S    ++IPVI+MS L 
Sbjct  1    MDTKVVSRGFAGSLPVDSVQALASKNLKNIPSRYIRPEVEFVVSIGESQQIPVIDMSKLD  60

Query  221  QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            + D  E KKL  ACK+WGFFQLI+HG++  +IEK K DT++F  LP+EE
Sbjct  61   RDD--EQKKLHQACKDWGFFQLINHGIADEVIEKMKIDTQEFFKLPLEE  107



>gb|KHN29183.1| Protein SRG1 [Glycine soja]
Length=356

 Score = 92.0 bits (227),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/110 (46%), Positives = 69/110 (63%), Gaps = 11/110 (10%)
 Frame = +2

Query  68   GTLGGTLQVPCVQELAKQSPEIVPPRYFRD-DLD------PSAPAQREIPVINMSNLLQG  226
              L  +L VP VQELA Q PE VP RY RD D D      PS P+ R +P I+M+ L+  
Sbjct  6    ANLESSLSVPSVQELAFQRPEKVPARYIRDQDGDGIIATYPSHPSLR-VPFIDMAKLVNA  64

Query  227  DS---EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            D+   EEL+KL +ACK+WG FQL++HG+S+S ++      K F  LP++E
Sbjct  65   DTQQKEELRKLHLACKDWGVFQLVNHGLSNSSLKNMGNQVKRFFELPLQE  114



>ref|XP_003614581.1| Protein SRG1 [Medicago truncatula]
 gb|AES97539.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=350

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 50/105 (48%), Positives = 69/105 (66%), Gaps = 7/105 (7%)
 Frame = +2

Query  74   LGGTLQV---PCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDS  232
            + GT  V   P VQ+L K+  E VP +Y + + DP    +  +  ++PVI++S LL  DS
Sbjct  1    MAGTSSVVLAPSVQQLEKEGIEKVPEQYLQPNQDPIFVSNTTSLPKLPVIDLSKLLCEDS  60

Query  233  EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL+KLD ACKEWGFFQLI+HGV+ SL+E  K   + F N+P+EE
Sbjct  61   VELEKLDHACKEWGFFQLINHGVNPSLVENVKIGIQQFFNIPIEE  105



>ref|XP_003531421.1| PREDICTED: protein SRG1-like [Glycine max]
Length=356

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 51/112 (46%), Positives = 70/112 (63%), Gaps = 11/112 (10%)
 Frame = +2

Query  62   SSGTLGGTLQVPCVQELAKQSPEIVPPRYFRD-DLD------PSAPAQREIPVINMSNLL  220
            +   L  +L VP VQELA Q PE VP RY RD D D      PS P+ R +P I+M+ L+
Sbjct  4    TPANLESSLSVPSVQELAFQRPEKVPARYIRDQDGDGIIATYPSHPSLR-VPFIDMAKLV  62

Query  221  QGDS---EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D+   EEL+KL +ACK+WG FQL++HG+S+S ++      K F  LP++E
Sbjct  63   NADTHQKEELRKLHLACKDWGVFQLVNHGLSNSSLKNMGNQVKRFFELPLQE  114



>ref|XP_008242498.1| PREDICTED: protein SRG1-like [Prunus mume]
Length=339

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 47/115 (41%), Positives = 65/115 (57%), Gaps = 7/115 (6%)
 Frame = +2

Query  44   IMERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDD-------LDPSAPAQREIPVI  202
            I E    + T G +L VP VQE+ K  P  VP RY   +        D +     EIP I
Sbjct  10   IHEEVAVAPTFGSSLPVPNVQEIVKSDPLHVPERYLIKNQEDKPKGADHTCKLSSEIPTI  69

Query  203  NMSNLLQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            + S L +G  EEL +LD+ACKEWGFFQ+++HGV++ +++  K     F  LP+EE
Sbjct  70   DFSLLSRGHKEELTRLDLACKEWGFFQMVNHGVATEVLQGMKDAAAKFFELPVEE  124



>ref|XP_003518805.1| PREDICTED: protein SRG1 [Glycine max]
Length=354

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 62/101 (61%), Gaps = 4/101 (4%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQR----EIPVINMSNLLQGDSEELK  244
            G +  VP V ELAKQ    VP RY   + DP   +      ++P+I++  LL  D  EL+
Sbjct  5    GTSCLVPSVLELAKQPIIEVPERYVHANQDPHILSNTISLPQVPIIDLHQLLSEDPSELE  64

Query  245  KLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            KLD ACKEWGFFQLI+HGV   ++E  K   ++F NLPMEE
Sbjct  65   KLDHACKEWGFFQLINHGVDPPVVENMKIGVQEFFNLPMEE  105



>ref|XP_006435645.1| hypothetical protein CICLE_v10033449mg [Citrus clementina]
 gb|ESR48885.1| hypothetical protein CICLE_v10033449mg [Citrus clementina]
Length=365

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/103 (45%), Positives = 60/103 (58%), Gaps = 6/103 (6%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFR------DDLDPSAPAQREIPVINMSNLLQGDSEE  238
            G +L VP VQE+ +     VP RY +      D     + A  EIPVINMS L  GD +E
Sbjct  19   GKSLPVPSVQEIVRNDSLCVPERYIQERQNRPDYHSEVSYASSEIPVINMSLLANGDKDE  78

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+K DIACKEWGFFQ+ +HG++ ++I   K     F  LP +E
Sbjct  79   LRKFDIACKEWGFFQITNHGIAETVIHNMKDAIAAFFQLPFDE  121



>ref|XP_004490336.1| PREDICTED: protein SRG1-like [Cicer arietinum]
Length=352

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/103 (50%), Positives = 67/103 (65%), Gaps = 5/103 (5%)
 Frame = +2

Query  74   LGGT-LQVPCVQELAKQSPEIVPPRYFRDDLDP----SAPAQREIPVINMSNLLQGDSEE  238
            +GGT +  P VQELAKQ    VP +Y + + DP    +  +  ++P+I+   LL  D  E
Sbjct  1    MGGTPVLAPSVQELAKQGITEVPEQYLQPNQDPILVSNTTSLPQLPIIDFDKLLCEDVTE  60

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+KL  A KEWGFFQLI+HGV+SSLIE  K   ++F NLPMEE
Sbjct  61   LEKLHHASKEWGFFQLINHGVNSSLIENVKIGVEEFFNLPMEE  103



>ref|XP_006355573.1| PREDICTED: protein SRG1-like [Solanum tuberosum]
Length=360

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/110 (45%), Positives = 70/110 (64%), Gaps = 3/110 (3%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD-PSAPAQREIPVINMSNLLQ  223
            ME + +   LG +L VP VQELA+Q    +P RY R + + P   A  E+PVI++   + 
Sbjct  1    MESTPAKLNLGKSLLVPSVQELAEQHLTNIPDRYLRPEQETPVISAGAEVPVIHLQKFIS  60

Query  224  GDS--EELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            GDS   EL+KL  AC++WGF Q+I+HGV+ SL+E  K +  +  +LPMEE
Sbjct  61   GDSMDSELQKLHSACQQWGFLQVINHGVTPSLLEDFKREVIELFSLPMEE  110



>gb|KEH22932.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=363

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 45/100 (45%), Positives = 65/100 (65%), Gaps = 5/100 (5%)
 Frame = +2

Query  83   TLQVPCVQELAKQSPEIVPPRYFRDD-----LDPSAPAQREIPVINMSNLLQGDSEELKK  247
            +L VP VQE+ K +P  VP +Y R++     ++       EIPVI+ + L  G+ EEL K
Sbjct  14   SLPVPNVQEMVKVNPLQVPTKYVRNEEEMEKVNYMPQLSSEIPVIDFTQLSNGNMEELLK  73

Query  248  LDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            L+IACKEWGFFQ+++HGV   LI++ +  + +F  LPMEE
Sbjct  74   LEIACKEWGFFQMVNHGVEKDLIQRMRDASNEFFELPMEE  113



>ref|XP_003638391.1| Protein SRG1, partial [Medicago truncatula]
Length=121

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 51/104 (49%), Positives = 64/104 (62%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSP-EIVPPRYFR----DDLDPSAPAQREIPVINMSNLLQGD--SE  235
            G +L VP VQELAK      VPPRY +    D +        +IPVI+M  L   +  S 
Sbjct  9    GTSLLVPSVQELAKDGKISTVPPRYIQPNHQDLILSEVDTNLQIPVIDMYKLHSEEFGSS  68

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL K  +ACK+WGFFQLI+H +S SL+EK K +T+DF NLPM E
Sbjct  69   ELLKFHLACKDWGFFQLINHPISLSLLEKVKLETQDFFNLPMSE  112



>ref|XP_010665638.1| PREDICTED: protein SRG1-like [Beta vulgaris subsp. vulgaris]
Length=367

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/114 (43%), Positives = 69/114 (61%), Gaps = 7/114 (6%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDP-----SAPAQREIPVINMS  211
            M+++      G +  VP VQELAK+S   +P RY RD+ D      S  +   +PVI++ 
Sbjct  1    MDKAPEMINFGSSFIVPSVQELAKESIVSIPSRYVRDNGDQLEYPNSQSSSFSVPVIDLQ  60

Query  212  NLLQGD--SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             LL  +    EL KL  ACKEWGFFQ+I+HGVS+SL+E  + +  +F  LP+EE
Sbjct  61   RLLHAEYIDSELHKLHSACKEWGFFQVINHGVSTSLLETFEGEVINFFQLPLEE  114



>gb|KEH38517.1| 2OG-Fe(II) oxygenase family oxidoreductase [Medicago truncatula]
Length=359

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/104 (50%), Positives = 67/104 (64%), Gaps = 7/104 (7%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQ-SPEIVPPRYFR----DDLDPSAPAQREIPVINMSNLLQGD--SE  235
            G +L VP VQEL+K  +   VPPRY +    D +        +IPVI+M  L   +  S 
Sbjct  9    GTSLLVPSVQELSKDGNISTVPPRYIQPNHQDLILSEVDTNLQIPVIDMYKLHSEELGSS  68

Query  236  ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            EL KL +ACK+WGFFQL++HGVSS+LIEK K + +DF NLPM E
Sbjct  69   ELVKLHLACKDWGFFQLVNHGVSSNLIEKIKLEIQDFFNLPMSE  112



>ref|XP_009137512.1| PREDICTED: protein SRG1-like [Brassica rapa]
Length=359

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/103 (46%), Positives = 68/103 (66%), Gaps = 8/103 (8%)
 Frame = +2

Query  83   TLQVPCVQELAKQSP-EIVPPRYFRDDLDPS-----APAQREIPVINMSNLLQGDS--EE  238
            ++ VP VQE+ K+   + VP RY R DLD +     +  + EIP+I+++ L    S   E
Sbjct  12   SIIVPSVQEMVKEKMIKTVPQRYIRSDLDKAEITDDSGPRTEIPIIDLNLLCSSTSMTSE  71

Query  239  LKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            + KLD+ACKEWGFFQL++HG+ S  ++K K+D +D  NLPMEE
Sbjct  72   IDKLDLACKEWGFFQLVNHGIDSKFLDKVKSDIQDHFNLPMEE  114



>gb|KHG05552.1| S-norcoclaurine synthase 1 [Gossypium arboreum]
Length=341

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/109 (44%), Positives = 69/109 (63%), Gaps = 4/109 (4%)
 Frame = +2

Query  47   MERSISSGTLGGTLQVPCVQELAKQSPEIVPPRYFRDDLD--PSAPAQREIPVINMSNLL  220
            M+  + S    G+L V  VQ LA ++ + +P RY R +++   S    ++IPVI+MS L 
Sbjct  1    MDTKVVSRGFAGSLPVDSVQALASKNLKNIPSRYIRPEVEFVVSIDESQQIPVIDMSKLD  60

Query  221  QGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              D +  KKL   CK+WGFFQLI+HG++  LIEK K DT++F  LP+EE
Sbjct  61   HDDGQ--KKLHQVCKDWGFFQLINHGIADELIEKMKIDTQEFFKLPLEE  107



>ref|XP_006305827.1| hypothetical protein CARUB_v10010858mg [Capsella rubella]
 gb|EOA38725.1| hypothetical protein CARUB_v10010858mg [Capsella rubella]
Length=357

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 68/107 (64%), Gaps = 8/107 (7%)
 Frame = +2

Query  71   TLGGTLQVPCVQELA-KQSPEIVPPRYFRDDLDPSAPA-----QREIPVINMSNL--LQG  226
            T   ++ VP VQE+  +++   VPPRY R D D +          +IP+I+M  L  L  
Sbjct  7    TSWSSIIVPSVQEMVDEKTITTVPPRYVRYDEDKTEAVDDSGLSNKIPIIDMERLCSLTA  66

Query  227  DSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
               E++KLD ACKEWGFFQL++HG+ SS ++K K++ +DF NLP+EE
Sbjct  67   VDSEVEKLDFACKEWGFFQLVNHGIDSSFLDKIKSEIQDFFNLPLEE  113



>ref|XP_011085296.1| PREDICTED: protein SRG1-like [Sesamum indicum]
Length=356

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 53/108 (49%), Positives = 70/108 (65%), Gaps = 16/108 (15%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDD---------LDPSAPAQREIPVINM---SNL  217
            LG +L VP VQELAK+    VPPRY R D         L+ S P   +IPVI+M   S++
Sbjct  8    LGSSLPVPIVQELAKEKLATVPPRYVRPDQHQHTILSALNSSFP---QIPVIDMQKFSDI  64

Query  218  LQGDSEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPM  361
               DSE L+ L  AC+EWGFFQLI+HGV S+++EK K + ++F NLP+
Sbjct  65   YTMDSE-LQALHNACQEWGFFQLINHGVGSAVMEKMKIEIQEFFNLPI  111



>ref|XP_009106564.1| PREDICTED: protein SRG1 [Brassica rapa]
Length=358

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/106 (45%), Positives = 69/106 (65%), Gaps = 9/106 (8%)
 Frame = +2

Query  71   TLGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPS-----APAQREIPVINMSNL--LQGD  229
            T   +L VP V E+AK++   VPPRY R + D +     +    ++PVI+M  L  +   
Sbjct  7    TQWSSLLVPSVLEIAKEN--TVPPRYLRSEQDKTETLADSCLSSKLPVIDMQRLCSVSAM  64

Query  230  SEELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
              EL+KLD+AC++WGFFQL++HG+ SS +EK +T+ KD  NLPMEE
Sbjct  65   DTELEKLDLACQDWGFFQLVNHGIDSSFLEKLETEAKDLFNLPMEE  110



>gb|KHN36942.1| Protein SRG1 [Glycine soja]
Length=360

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 52/108 (48%), Positives = 68/108 (63%), Gaps = 11/108 (10%)
 Frame = +2

Query  77   GGTLQVPCVQELAKQSPEIVPPRYFRDD------LDPSAPAQREIPVINMSNLL--QGDS  232
            G +L VP V ELAK++   VP RY +        +     +  EIPVI+M  LL  +  S
Sbjct  10   GTSLLVPSVLELAKENLTTVPQRYIQPQHQDMVLISEEDHSTLEIPVIDMHRLLSVESGS  69

Query  233  EELKKLDIACKEWGFFQ---LISHGVSSSLIEKXKTDTKDFLNLPMEE  367
             EL KL +ACKEWGFFQ   L++HGV+SSL+EK + +T+DF NLPM E
Sbjct  70   SELDKLHLACKEWGFFQTLELVNHGVNSSLVEKVRLETQDFFNLPMSE  117



>ref|XP_006439037.1| hypothetical protein CICLE_v10031934mg [Citrus clementina]
 gb|ESR52277.1| hypothetical protein CICLE_v10031934mg [Citrus clementina]
Length=358

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  47   MERSISSGTLG--GTLQVPCVQELAKQSPEIVPPRYFRDDLDPSA-----PAQREIPVIN  205
            ME   ++ TL     L VP VQELA Q PE VPPRY RD +         P+   +P+I+
Sbjct  1    MEAEAAAATLNLECCLPVPSVQELAIQQPEAVPPRYIRDHVVGDHVITVNPSSNRVPLID  60

Query  206  MSNLLQGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            M+ L+  DS+  EL++L  ACK WG FQLI+HG +   +   K   ++F +LP+EE
Sbjct  61   MNKLVDPDSQDAELRRLHSACKHWGLFQLINHGAADESLRNMKKQAQEFFDLPLEE  116



>ref|XP_008373604.1| PREDICTED: S-norcoclaurine synthase 1-like [Malus domestica]
Length=357

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/101 (48%), Positives = 66/101 (65%), Gaps = 5/101 (5%)
 Frame = +2

Query  74   LGGTLQVPCVQELAKQSPEIVPPRYFRDDLDPSAPAQRE----IPVINMSNLLQGDSEEL  241
            LGG+L V  VQ LA  + + +PPRY R ++    PA  E    IPV++ + L   D +EL
Sbjct  13   LGGSLPVENVQALASSTLKEIPPRYIRPEIQ-HEPASVEDSLQIPVVDTNKLNDDDDDEL  71

Query  242  KKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPME  364
             KL +ACKEWGFFQLI+H V   +I+K K+DT++F  LP+E
Sbjct  72   AKLHLACKEWGFFQLINHDVPEEVIKKMKSDTEEFFQLPLE  112



>ref|XP_006452694.1| hypothetical protein CICLE_v10010627mg [Citrus clementina]
 gb|ESR65934.1| hypothetical protein CICLE_v10010627mg [Citrus clementina]
Length=320

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 58/83 (70%), Gaps = 5/83 (6%)
 Frame = +2

Query  134  VPPRYFRDDLDP-----SAPAQREIPVINMSNLLQGDSEELKKLDIACKEWGFFQLISHG  298
            VPPRY R ++D         +  ++PVI+M  L+ GD  EL+KLD ACK+WGFFQLI+HG
Sbjct  17   VPPRYVRPEIDHPLIRNDESSAEQLPVIDMHKLVSGDDSELEKLDRACKDWGFFQLINHG  76

Query  299  VSSSLIEKXKTDTKDFLNLPMEE  367
            V  SL+EK K +T DF +LP++E
Sbjct  77   VRCSLVEKVKAETLDFFDLPIDE  99



>ref|XP_006482819.1| PREDICTED: protein SRG1-like [Citrus sinensis]
Length=358

 Score = 91.3 bits (225),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/116 (42%), Positives = 68/116 (59%), Gaps = 9/116 (8%)
 Frame = +2

Query  47   MERSISSGTLG--GTLQVPCVQELAKQSPEIVPPRYFR-----DDLDPSAPAQREIPVIN  205
            ME   ++ TL     L VP VQELA Q PE VPPRY R     D +    P+   +P+I+
Sbjct  1    MEAEAAAATLNLECCLPVPSVQELAIQQPEAVPPRYIRYHVVGDHVITVNPSSNRVPLID  60

Query  206  MSNLLQGDSE--ELKKLDIACKEWGFFQLISHGVSSSLIEKXKTDTKDFLNLPMEE  367
            M+ L+  DS+  EL++L  ACK WG FQLI+HG +   +   K   ++F +LP+EE
Sbjct  61   MNKLVDPDSQDAELRRLHSACKHWGLFQLINHGAADESLRNMKKQAQEFFDLPLEE  116



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 559392177135