BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001C01

Length=524
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009610057.1|  PREDICTED: protein PAM68, chloroplastic            133   2e-35   Nicotiana tomentosiformis
ref|XP_009764577.1|  PREDICTED: protein PAM68, chloroplastic            133   3e-35   Nicotiana sylvestris
emb|CDP14931.1|  unnamed protein product                                131   2e-34   Coffea canephora [robusta coffee]
ref|XP_011092614.1|  PREDICTED: protein PAM68, chloroplastic            131   4e-34   Sesamum indicum [beniseed]
gb|KCW78446.1|  hypothetical protein EUGRSUZ_D02600                     128   1e-33   Eucalyptus grandis [rose gum]
ref|XP_002519872.1|  conserved hypothetical protein                     129   1e-33   Ricinus communis
gb|KHG16592.1|  Protein PAM68, chloroplastic -like protein              128   2e-33   Gossypium arboreum [tree cotton]
ref|XP_008238103.1|  PREDICTED: protein PAM68, chloroplastic            129   2e-33   Prunus mume [ume]
ref|XP_010693416.1|  PREDICTED: protein PAM68, chloroplastic            128   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010054064.1|  PREDICTED: protein PAM68, chloroplastic            129   2e-33   Eucalyptus grandis [rose gum]
ref|XP_006342491.1|  PREDICTED: protein PAM68, chloroplastic-like       128   3e-33   Solanum tuberosum [potatoes]
gb|KDP35418.1|  hypothetical protein JCGZ_10801                         128   4e-33   Jatropha curcas
gb|EYU37511.1|  hypothetical protein MIMGU_mgv1a014159mg                127   5e-33   Erythranthe guttata [common monkey flower]
ref|XP_004300149.1|  PREDICTED: protein PAM68, chloroplastic            127   7e-33   Fragaria vesca subsp. vesca
ref|XP_004253084.1|  PREDICTED: protein PAM68, chloroplastic            126   9e-33   Solanum lycopersicum
ref|XP_008373447.1|  PREDICTED: protein PAM68, chloroplastic            127   1e-32   
ref|XP_009365732.1|  PREDICTED: protein PAM68, chloroplastic            127   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_010434463.1|  PREDICTED: protein PAM68, chloroplastic            126   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010439767.1|  PREDICTED: protein PAM68, chloroplastic-like       126   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010449401.1|  PREDICTED: protein PAM68, chloroplastic-like       126   2e-32   Camelina sativa [gold-of-pleasure]
gb|KFK28579.1|  hypothetical protein AALP_AA7G015400                    126   2e-32   Arabis alpina [alpine rockcress]
gb|KJB25156.1|  hypothetical protein B456_004G178900                    125   3e-32   Gossypium raimondii
ref|XP_007040805.1|  PAM68, chloroplastic, putative isoform 1           127   3e-32   
ref|XP_007040807.1|  PAM68, chloroplastic, putative isoform 3           126   3e-32   
gb|KJB25157.1|  hypothetical protein B456_004G178900                    125   3e-32   Gossypium raimondii
ref|NP_974571.1|  uncharacterized protein                               125   3e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011018420.1|  PREDICTED: protein PAM68, chloroplastic isof...    125   5e-32   Populus euphratica
ref|XP_009108407.1|  PREDICTED: protein PAM68, chloroplastic isof...    124   5e-32   Brassica rapa
emb|CDX76498.1|  BnaA08g09020D                                          125   5e-32   
ref|XP_009108406.1|  PREDICTED: protein PAM68, chloroplastic isof...    124   5e-32   Brassica rapa
emb|CDY09271.1|  BnaC03g63010D                                          124   6e-32   Brassica napus [oilseed rape]
ref|XP_008448605.1|  PREDICTED: protein PAM68, chloroplastic isof...    125   6e-32   Cucumis melo [Oriental melon]
ref|XP_008448604.1|  PREDICTED: protein PAM68, chloroplastic isof...    125   6e-32   Cucumis melo [Oriental melon]
ref|XP_011018419.1|  PREDICTED: protein PAM68, chloroplastic isof...    125   8e-32   Populus euphratica
emb|CBI24589.3|  unnamed protein product                                122   8e-32   Vitis vinifera
ref|XP_010278829.1|  PREDICTED: protein PAM68, chloroplastic            124   9e-32   Nelumbo nucifera [Indian lotus]
ref|XP_006285425.1|  hypothetical protein CARUB_v10006842mg             124   9e-32   Capsella rubella
ref|XP_010535844.1|  PREDICTED: protein PAM68, chloroplastic            124   1e-31   Tarenaya hassleriana [spider flower]
ref|XP_002870000.1|  hypothetical protein ARALYDRAFT_492947             124   1e-31   
ref|XP_004146119.1|  PREDICTED: protein PAM68, chloroplastic-like       124   1e-31   Cucumis sativus [cucumbers]
ref|XP_006368302.1|  hypothetical protein POPTR_0001s01420g             127   1e-31   
ref|XP_002266174.1|  PREDICTED: protein PAM68, chloroplastic            122   3e-31   Vitis vinifera
ref|XP_006414010.1|  hypothetical protein EUTSA_v10026226mg             121   1e-30   Eutrema salsugineum [saltwater cress]
ref|XP_003517076.1|  PREDICTED: protein PAM68, chloroplastic            121   2e-30   Glycine max [soybeans]
gb|AFK40696.1|  unknown                                                 120   3e-30   Lotus japonicus
ref|XP_004512411.1|  PREDICTED: protein PAM68, chloroplastic-like       120   3e-30   Cicer arietinum [garbanzo]
ref|XP_003612620.1|  hypothetical protein MTR_5g027010                  120   3e-30   
ref|XP_003534311.1|  PREDICTED: protein PAM68, chloroplastic-like       120   4e-30   Glycine max [soybeans]
ref|XP_008802491.1|  PREDICTED: protein PAM68, chloroplastic isof...    119   7e-30   Phoenix dactylifera
ref|XP_010906237.1|  PREDICTED: protein PAM68, chloroplastic            118   2e-29   Elaeis guineensis
ref|XP_010097737.1|  Ribose-phosphate pyrophosphokinase 1               123   3e-29   
gb|KDO50363.1|  hypothetical protein CISIN_1g028026mg                   117   3e-29   Citrus sinensis [apfelsine]
ref|XP_007158189.1|  hypothetical protein PHAVU_002G131600g             117   4e-29   Phaseolus vulgaris [French bean]
ref|XP_006432569.1|  hypothetical protein CICLE_v10002455mg             117   7e-29   Citrus clementina [clementine]
ref|XP_006854204.1|  hypothetical protein AMTR_s00048p00210800          115   2e-28   
ref|XP_007211025.1|  hypothetical protein PRUPE_ppa019898mg             115   3e-28   
gb|EAZ36811.1|  hypothetical protein OsJ_21150                          113   2e-27   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001174756.1|  Os06g0319800                                       113   3e-27   
ref|XP_004985587.1|  PREDICTED: protein PAM68, chloroplastic-like       111   1e-26   Setaria italica
gb|EPS59352.1|  hypothetical protein M569_15458                         108   2e-26   Genlisea aurea
ref|XP_006656932.1|  PREDICTED: protein PAM68, chloroplastic-like       108   7e-26   Oryza brachyantha
ref|XP_008660538.1|  PREDICTED: protein PAM68, chloroplastic-like       108   1e-25   Zea mays [maize]
ref|XP_002465806.1|  hypothetical protein SORBIDRAFT_01g046150          108   1e-25   Sorghum bicolor [broomcorn]
ref|NP_001150699.1|  ABC-type Co2+ transport system, permease com...    108   1e-25   
ref|XP_009397800.1|  PREDICTED: protein PAM68, chloroplastic            107   2e-25   
gb|ACU20343.1|  unknown                                                 101   4e-24   Glycine max [soybeans]
gb|EMS52637.1|  hypothetical protein TRIUR3_12218                       101   5e-23   Triticum urartu
dbj|BAJ86947.1|  predicted protein                                      101   6e-23   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMT12087.1|  hypothetical protein F775_13697                         101   1e-22   
ref|XP_003558741.1|  PREDICTED: protein PAM68, chloroplastic-like     98.2    8e-22   Brachypodium distachyon [annual false brome]
ref|XP_001782833.1|  predicted protein                                89.0    2e-19   
ref|XP_005849087.1|  hypothetical protein CHLNCDRAFT_57385            79.7    6e-15   Chlorella variabilis
ref|XP_005849088.1|  hypothetical protein CHLNCDRAFT_143598           78.6    1e-14   Chlorella variabilis
ref|XP_006844462.1|  hypothetical protein AMTR_s00016p00088520        72.4    1e-12   Amborella trichopoda
ref|XP_003574246.1|  PREDICTED: uncharacterized protein PAM68-like    71.6    3e-12   Brachypodium distachyon [annual false brome]
ref|XP_004983833.1|  PREDICTED: protein PAM68, chloroplastic-like     71.2    5e-12   Setaria italica
ref|XP_010261351.1|  PREDICTED: uncharacterized protein PAM68-like    70.9    5e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010671611.1|  PREDICTED: uncharacterized protein PAM68-like    70.5    6e-12   
ref|XP_004308047.2|  PREDICTED: uncharacterized protein PAM68-like    70.1    7e-12   Fragaria vesca subsp. vesca
ref|XP_007038832.1|  Sterol regulatory element-binding protein cl...  69.7    1e-11   
ref|XP_009382268.1|  PREDICTED: uncharacterized protein PAM68-like    69.3    2e-11   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB63794.1|  hypothetical protein B456_010G016400                  68.9    2e-11   Gossypium raimondii
ref|XP_010060378.1|  PREDICTED: uncharacterized protein PAM68-like    68.2    3e-11   
gb|KJB68664.1|  hypothetical protein B456_010G016500                  67.8    3e-11   Gossypium raimondii
gb|KDP22218.1|  hypothetical protein JCGZ_26049                       68.2    3e-11   Jatropha curcas
ref|NP_001151720.1|  ABC-type Co2+ transport system, permease com...  68.6    3e-11   Zea mays [maize]
ref|XP_002465027.1|  hypothetical protein SORBIDRAFT_01g030700        71.2    4e-11   
ref|XP_001416259.1|  predicted protein                                66.6    5e-11   Ostreococcus lucimarinus CCE9901
emb|CDP05137.1|  unnamed protein product                              67.8    5e-11   Coffea canephora [robusta coffee]
ref|XP_002953299.1|  hypothetical protein VOLCADRAFT_105894           67.0    1e-10   Volvox carteri f. nagariensis
ref|XP_010060371.1|  PREDICTED: uncharacterized protein PAM68-like    67.0    1e-10   Eucalyptus grandis [rose gum]
ref|XP_003075338.1|  unnamed protein product                          67.0    1e-10   Ostreococcus tauri
ref|XP_010919136.1|  PREDICTED: uncharacterized protein PAM68-like    66.2    2e-10   
ref|XP_009368728.1|  PREDICTED: uncharacterized protein PAM68-like    65.5    3e-10   Pyrus x bretschneideri [bai li]
dbj|BAJ90050.1|  predicted protein                                    65.1    5e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008805570.1|  PREDICTED: uncharacterized protein PAM68-like    64.7    5e-10   Phoenix dactylifera
ref|XP_001690643.1|  predicted membrane protein                       63.9    7e-10   Chlamydomonas reinhardtii
ref|XP_004150568.1|  PREDICTED: uncharacterized protein PAM68-like    64.3    8e-10   Cucumis sativus [cucumbers]
ref|XP_007219815.1|  hypothetical protein PRUPE_ppa026735mg           63.9    9e-10   Prunus persica
gb|KIZ07329.1|  hypothetical protein MNEG_0616                        62.0    1e-09   Monoraphidium neglectum
ref|XP_002274943.1|  PREDICTED: uncharacterized protein PAM68-like    63.9    1e-09   Vitis vinifera
ref|XP_008439311.1|  PREDICTED: uncharacterized protein PAM68-like    63.5    2e-09   Cucumis melo [Oriental melon]
ref|XP_006422044.1|  hypothetical protein CICLE_v10006017mg           63.2    2e-09   Citrus clementina [clementine]
ref|XP_010537142.1|  PREDICTED: uncharacterized protein PAM68-like    62.8    2e-09   Tarenaya hassleriana [spider flower]
ref|XP_009377566.1|  PREDICTED: uncharacterized protein PAM68-like    62.8    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_009375538.1|  PREDICTED: uncharacterized protein PAM68-like    62.8    2e-09   Pyrus x bretschneideri [bai li]
ref|XP_008354247.1|  PREDICTED: uncharacterized protein PAM68-like    62.8    3e-09   
ref|XP_009770565.1|  PREDICTED: uncharacterized protein PAM68-like    62.4    4e-09   Nicotiana sylvestris
ref|XP_008234831.1|  PREDICTED: uncharacterized protein PAM68-like    62.0    4e-09   Prunus mume [ume]
ref|NP_001065153.1|  Os10g0533100                                     62.0    7e-09   
ref|XP_009621677.1|  PREDICTED: uncharacterized protein PAM68-like    61.6    8e-09   Nicotiana tomentosiformis
ref|WP_015195444.1|  hypothetical protein                             60.8    8e-09   Stanieria cyanosphaera
ref|XP_006362662.1|  PREDICTED: uncharacterized protein PAM68-like    61.2    8e-09   Solanum tuberosum [potatoes]
ref|XP_004234285.1|  PREDICTED: uncharacterized protein PAM68-like    61.2    9e-09   Solanum lycopersicum
ref|XP_011076476.1|  PREDICTED: uncharacterized protein PAM68-like    59.7    3e-08   Sesamum indicum [beniseed]
ref|XP_002513644.1|  conserved hypothetical protein                   59.7    3e-08   Ricinus communis
ref|XP_010105738.1|  hypothetical protein L484_014227                 58.9    6e-08   Morus notabilis
gb|EYU25152.1|  hypothetical protein MIMGU_mgv1a014448mg              58.9    7e-08   Erythranthe guttata [common monkey flower]
ref|XP_003062717.1|  predicted protein                                57.8    7e-08   Micromonas pusilla CCMP1545
ref|WP_016859898.1|  hypothetical protein                             57.8    1e-07   Fischerella muscicola
ref|WP_006103587.1|  hypothetical protein                             57.4    1e-07   Coleofasciculus chthonoplastes
ref|WP_017309569.1|  MULTISPECIES: hypothetical protein               57.4    1e-07   Hapalosiphonaceae
gb|KEH26295.1|  transmembrane protein, putative                       57.8    1e-07   Medicago truncatula
ref|XP_004515985.1|  PREDICTED: uncharacterized protein PAM68-like    57.4    2e-07   Cicer arietinum [garbanzo]
gb|AFK33720.1|  unknown                                               57.4    2e-07   Medicago truncatula
emb|CDY49826.1|  BnaCnng18230D                                        57.0    2e-07   Brassica napus [oilseed rape]
ref|WP_026731449.1|  hypothetical protein                             56.6    2e-07   Fischerella sp. PCC 9605
ref|XP_006661996.1|  PREDICTED: protein PAM68, chloroplastic-like     57.8    2e-07   Oryza brachyantha
ref|WP_026723123.1|  hypothetical protein                             56.6    2e-07   Hapalosiphonaceae
ref|WP_015135349.1|  hypothetical protein                             56.6    3e-07   Leptolyngbya sp. PCC 7376
ref|WP_011610060.1|  hypothetical protein                             56.2    4e-07   Trichodesmium erythraeum
ref|WP_009460041.1|  MULTISPECIES: hypothetical protein               55.8    5e-07   Fischerella thermalis
ref|XP_010482653.1|  PREDICTED: uncharacterized protein PAM68-like    55.8    6e-07   Camelina sativa [gold-of-pleasure]
gb|AFK39959.1|  unknown                                               56.2    6e-07   Lotus japonicus
ref|XP_010445240.1|  PREDICTED: uncharacterized protein PAM68-like    55.8    6e-07   Camelina sativa [gold-of-pleasure]
ref|XP_010442822.1|  PREDICTED: uncharacterized protein PAM68-like    55.8    6e-07   Camelina sativa [gold-of-pleasure]
ref|WP_041781285.1|  hypothetical protein                             55.1    7e-07   
ref|WP_015205051.1|  hypothetical protein                             55.5    8e-07   Crinalium epipsammum
gb|AFZ21030.1|  Protein of unknown function (DUF3464)                 55.1    1e-06   Microcoleus sp. PCC 7113
ref|WP_016865287.1|  hypothetical protein                             54.7    1e-06   Fischerella muscicola
gb|AFG45582.1|  hypothetical protein 0_18478_02                       52.8    1e-06   Pinus taeda
emb|CAN77998.1|  hypothetical protein VITISV_002983                   57.0    2e-06   Vitis vinifera
ref|WP_024546344.1|  hypothetical protein                             54.3    2e-06   Synechococcus
ref|WP_027840435.1|  hypothetical protein                             54.3    2e-06   Mastigocoleus testarum
ref|WP_015151669.1|  hypothetical protein                             53.9    3e-06   Oscillatoria acuminata
ref|WP_002763019.1|  hypothetical protein                             53.5    3e-06   Microcystis
ref|WP_009786687.1|  hypothetical protein                             53.9    3e-06   Lyngbya sp. PCC 8106
ref|WP_023064930.1|  hypothetical protein                             53.9    3e-06   Lyngbya aestuarii
ref|WP_026101482.1|  hypothetical protein                             53.5    3e-06   cyanobacterium PCC 7702
ref|WP_002804136.1|  hypothetical protein                             53.5    3e-06   Microcystis aeruginosa
ref|WP_002785112.1|  hypothetical protein                             53.5    3e-06   Microcystis aeruginosa
ref|WP_017744403.1|  hypothetical protein                             53.5    4e-06   Scytonema hofmannii
ref|WP_041032249.1|  hypothetical protein                             53.1    5e-06   Tolypothrix campylonemoides
ref|XP_002865928.1|  hypothetical protein ARALYDRAFT_495341           53.1    5e-06   
ref|WP_002788032.1|  hypothetical protein                             53.1    5e-06   Microcystis aeruginosa
ref|WP_012307435.1|  hypothetical protein                             53.1    5e-06   Synechococcus
ref|XP_007513904.1|  predicted protein                                54.7    5e-06   Bathycoccus prasinos
gb|AFG45583.1|  hypothetical protein 0_18478_02                       50.8    6e-06   Pinus taeda
ref|WP_015127369.1|  hypothetical protein                             52.8    6e-06   Calothrix sp. PCC 7507
ref|WP_022607303.1|  protein of unknown function (DUF3464)            53.1    7e-06   Rubidibacter lacunae
ref|WP_015124492.1|  hypothetical protein                             52.8    7e-06   Synechococcus sp. PCC 6312
ref|WP_015171680.1|  hypothetical protein                             52.8    8e-06   Geitlerinema sp. PCC 7407
ref|XP_009127218.1|  PREDICTED: uncharacterized protein PAM68-like    52.4    1e-05   Brassica rapa
emb|CDY27049.1|  BnaA02g10690D                                        52.4    1e-05   Brassica napus [oilseed rape]
ref|WP_030006377.1|  hypothetical protein                             52.0    1e-05   Synechococcus sp. NKBG042902
ref|WP_036009074.1|  hypothetical protein                             52.0    1e-05   
ref|WP_036616883.1|  hypothetical protein                             52.0    1e-05   
ref|WP_002791710.1|  hypothetical protein                             51.6    1e-05   Microcystis aeruginosa
ref|WP_017318522.1|  hypothetical protein                             51.6    1e-05   Mastigocladopsis repens
ref|WP_002738795.1|  hypothetical protein                             51.6    1e-05   Microcystis aeruginosa
ref|WP_008201436.1|  hypothetical protein                             51.6    1e-05   Microcystis
ref|NP_200090.1|  uncharacterized protein                             52.0    1e-05   Arabidopsis thaliana [mouse-ear cress]
ref|WP_002741884.1|  hypothetical protein                             51.6    2e-05   Microcystis aeruginosa
ref|WP_016875149.1|  hypothetical protein                             51.6    2e-05   Chlorogloeopsis fritschii
ref|XP_006281501.1|  hypothetical protein CARUB_v10027596mg           51.6    2e-05   Capsella rubella
ref|WP_012627065.1|  hypothetical protein                             51.6    2e-05   Cyanothece sp. PCC 7425
ref|WP_038027051.1|  hypothetical protein                             50.8    2e-05   
ref|WP_006633862.1|  hypothetical protein                             51.2    2e-05   Microcoleus vaginatus
ref|XP_005536916.1|  hypothetical protein, conserved                  52.8    2e-05   Cyanidioschyzon merolae strain 10D
ref|WP_015174481.1|  hypothetical protein                             51.2    3e-05   Oscillatoria nigro-viridis
gb|EKQ68405.1|  UDP-N-acetylmuramyl pentapeptide phosphotransfera...  51.2    3e-05   Oscillatoriales cyanobacterium JSC-12
ref|NP_001239781.1|  uncharacterized protein LOC100782877             51.2    3e-05   Glycine max [soybeans]
ref|XP_006401783.1|  hypothetical protein EUTSA_v10014707mg           51.6    4e-05   
ref|XP_002505889.1|  predicted protein                                52.0    5e-05   Micromonas commoda
ref|WP_007357191.1|  MULTISPECIES: hypothetical protein               50.1    6e-05   Kamptonema
ref|WP_015216757.1|  hypothetical protein                             50.1    6e-05   Anabaena cylindrica
gb|KIJ81069.1|  hypothetical protein SD80_25805                       50.1    7e-05   Scytonema tolypothrichoides VB-61278
ref|WP_015118841.1|  hypothetical protein                             49.7    8e-05   Rivularia sp. PCC 7116
ref|WP_015198544.1|  hypothetical protein                             49.7    9e-05   Calothrix parietina
ref|WP_028947886.1|  hypothetical protein                             49.7    1e-04   Synechocystis sp. PCC 6714
ref|WP_031291683.1|  hypothetical protein                             49.7    1e-04   Leptolyngbya sp. Heron Island J
ref|WP_006517795.1|  Protein of unknown function (DUF3464)            49.7    1e-04   Leptolyngbya sp. PCC 7375
gb|EKD05861.1|  hypothetical protein SPLC1_S580100                    48.5    1e-04   Arthrospira platensis C1
emb|CBN78153.1|  all0748                                              50.8    1e-04   Ectocarpus siliculosus
ref|WP_008188495.1|  hypothetical protein                             49.3    2e-04   Moorea producens
gb|KIE12240.1|  hypothetical protein DA73_0211775                     48.9    2e-04   Tolypothrix bouteillei VB521301
ref|WP_018397062.1|  hypothetical protein                             48.9    2e-04   filamentous cyanobacterium ESFC-1
ref|WP_011244110.1|  MULTISPECIES: hypothetical protein               48.5    2e-04   Synechococcus
ref|WP_010994922.1|  hypothetical protein                             48.5    3e-04   Nostocaceae
ref|WP_012165617.1|  hypothetical protein                             49.3    3e-04   Acaryochloris marina
ref|WP_011321313.1|  hypothetical protein                             48.1    3e-04   Trichormus variabilis
ref|WP_006195035.1|  hypothetical protein                             48.1    3e-04   Nodularia spumigena
ref|WP_010478694.1|  hypothetical protein                             48.9    3e-04   Acaryochloris sp. CCMEE 5410
ref|WP_015138656.1|  hypothetical protein                             48.1    3e-04   Nostoc sp. PCC 7524
ref|WP_015167908.1|  hypothetical protein                             47.8    4e-04   Synechococcus sp. PCC 7502
ref|WP_016952466.1|  hypothetical protein                             48.1    4e-04   Anabaena sp. PCC 7108
gb|EMT23713.1|  hypothetical protein F775_07395                       46.6    4e-04   
ref|WP_036485392.1|  hypothetical protein                             47.8    4e-04   Myxosarcina sp. GI1
ref|WP_036843652.1|  MULTISPECIES: hypothetical protein               47.4    4e-04   
ref|WP_010871511.1|  hypothetical protein                             47.8    5e-04   Synechocystis
ref|WP_017712570.1|  hypothetical protein                             48.1    5e-04   Prochlorothrix hollandica
ref|WP_019500551.1|  hypothetical protein                             47.4    5e-04   Pseudanabaena sp. PCC 6802
ref|XP_005780389.1|  hypothetical protein EMIHUDRAFT_443108           48.5    6e-04   Emiliania huxleyi CCMP1516
ref|WP_006669266.1|  MULTISPECIES: hypothetical protein               47.8    7e-04   Arthrospira
ref|WP_015187896.1|  hypothetical protein                             47.4    7e-04   Gloeocapsa sp. PCC 7428
ref|WP_017720086.1|  hypothetical protein                             47.0    8e-04   Oscillatoria sp. PCC 10802
ref|WP_029633172.1|  hypothetical protein [                           47.0    8e-04   [Scytonema hofmanni] UTEX B 1581
ref|WP_006617942.1|  hypothetical protein                             47.4    0.001   Arthrospira platensis



>ref|XP_009610057.1| PREDICTED: protein PAM68, chloroplastic [Nicotiana tomentosiformis]
Length=194

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 112/164 (68%), Positives = 126/164 (77%), Gaps = 16/164 (10%)
 Frame = +2

Query  50   KHFLPFSLPKSKP-HQSSTS-LSHFT-LSAT---PRGFGYGTSQkkpkrskkkprkGSFe  211
            KHFL F LPKSK  H+S+ S LS+FT L AT   P+GFG   ++K  K  K+   +    
Sbjct  24   KHFLQFPLPKSKQLHKSTPSHLSNFTPLFATLNSPKGFGPKKTKKSKKPKKEYEEEEE--  81

Query  212  dddedkeeeveedeeeGVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDV  391
                    + +E +E GVIPEIVTNRM+SR+GLSVGIPLFIGLLFFPFFYYLKVGLKIDV
Sbjct  82   --------DDDEQQEGGVIPEIVTNRMISRIGLSVGIPLFIGLLFFPFFYYLKVGLKIDV  133

Query  392  PTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            PTWIPFIVSFIFFGTALLGVSYGIVSSSWDP REGS LGWNEA+
Sbjct  134  PTWIPFIVSFIFFGTALLGVSYGIVSSSWDPYREGSFLGWNEAK  177



>ref|XP_009764577.1| PREDICTED: protein PAM68, chloroplastic [Nicotiana sylvestris]
Length=193

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 108/160 (68%), Positives = 124/160 (78%), Gaps = 9/160 (6%)
 Frame = +2

Query  50   KHFLPFSLPKSKP-HQSSTSLSH-FTLSATPRGFGYGTSQkkpkrskkkprkGSFeddde  223
            KHFL F L KSK  HQ+ + LS  F    +P+GFG   ++K  K  K+   +        
Sbjct  24   KHFLQFPLSKSKQLHQTPSHLSPLFATLNSPKGFGPKKTKKIKKPKKEYEDEEE------  77

Query  224  dkeeeveedeeeGVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWI  403
             +EE+ +E ++ GVIPEIVTNRM+SR+GLSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWI
Sbjct  78   -EEEDDDEQQQGGVIPEIVTNRMISRIGLSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWI  136

Query  404  PFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            PFIVSFIFFGTALLGVSYGIVSSSWDP REGSLLGWNEA+
Sbjct  137  PFIVSFIFFGTALLGVSYGIVSSSWDPYREGSLLGWNEAK  176



>emb|CDP14931.1| unnamed protein product [Coffea canephora]
Length=199

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPEIVTNRMMSRMG SVG+PLFIGLLFFPFFYYLKVGLKIDVPTWIPFIVSFIFFGTA
Sbjct  93   GIIPEIVTNRMMSRMGFSVGVPLFIGLLFFPFFYYLKVGLKIDVPTWIPFIVSFIFFGTA  152

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS LGWNEAQ
Sbjct  153  LLGVSYGIVSSSWDPLREGSFLGWNEAQ  180



>ref|XP_011092614.1| PREDICTED: protein PAM68, chloroplastic [Sesamum indicum]
Length=220

 Score =   131 bits (329),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 83/88 (94%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRM+SRMG SVGIPLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSFIFFGTA
Sbjct  96   GVIPEVVTNRMISRMGFSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFIFFGTA  155

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDPMREGSLLGWNEAQ
Sbjct  156  LLGVSYGIVSASWDPMREGSLLGWNEAQ  183



>gb|KCW78446.1| hypothetical protein EUGRSUZ_D02600 [Eucalyptus grandis]
Length=182

 Score =   128 bits (322),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMM+RMG SVG+PLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  75   GVIPEVVTNRMMNRMGFSVGVPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  134

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  135  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  162



>ref|XP_002519872.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF42476.1| conserved hypothetical protein [Ricinus communis]
Length=220

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPE+VTNRM+SRMG SVG+PLFIGLLFFPFFYYLKVGLKIDVPTW+P+IVSF FFGTA
Sbjct  116  GIIPEVVTNRMISRMGFSVGVPLFIGLLFFPFFYYLKVGLKIDVPTWVPYIVSFFFFGTA  175

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMREGSLLGWNEAQ
Sbjct  176  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  203



>gb|KHG16592.1| Protein PAM68, chloroplastic -like protein [Gossypium arboreum]
Length=204

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRM+SRMG +VGIPL +GLLFFPFFYYLKVGLKIDVPTW+PFIVSFIFFGTA
Sbjct  99   GVIPEVVTNRMISRMGFTVGIPLLVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFIFFGTA  158

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS+LGWNEAQ
Sbjct  159  LLGVSYGIVSSSWDPLREGSVLGWNEAQ  186



>ref|XP_008238103.1| PREDICTED: protein PAM68, chloroplastic [Prunus mume]
Length=220

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+ RMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  116  GVIPEIVTNRMIGRMGFTVGVPLFLGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTA  175

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS+LGWNEAQ
Sbjct  176  LLGVSYGIVSSSWDPLREGSILGWNEAQ  203



>ref|XP_010693416.1| PREDICTED: protein PAM68, chloroplastic [Beta vulgaris subsp. 
vulgaris]
Length=202

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 103/158 (65%), Positives = 118/158 (75%), Gaps = 11/158 (7%)
 Frame = +2

Query  65   FSLPKSKPHQSSTSLSH--FTLSAT---PRGFGYGTSQkkpkrskkkprkGSFedddedk  229
            FS P SK HQ+  SLS     L+AT   P+GFG    + K  ++ K            + 
Sbjct  28   FSFPTSKIHQNLFSLSSKPTQLNATLRNPKGFGTPKKKNKKIKTPKNFNNED------ED  81

Query  230  eeeveedeeeGVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPF  409
            E++ ++DEEEG+IPEIVTNRM+ RMG SVGIPLFIGL FFP FYYLKVGLKIDVPTW+PF
Sbjct  82   EDDDDDDEEEGIIPEIVTNRMIKRMGFSVGIPLFIGLAFFPLFYYLKVGLKIDVPTWVPF  141

Query  410  IVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            IVSFIFFGTALLGVSYGIVSSSWDP+REGSLLGW EAQ
Sbjct  142  IVSFIFFGTALLGVSYGIVSSSWDPLREGSLLGWQEAQ  179



>ref|XP_010054064.1| PREDICTED: protein PAM68, chloroplastic [Eucalyptus grandis]
 gb|KCW78445.1| hypothetical protein EUGRSUZ_D02600 [Eucalyptus grandis]
Length=221

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMM+RMG SVG+PLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  114  GVIPEVVTNRMMNRMGFSVGVPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  173

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  174  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  201



>ref|XP_006342491.1| PREDICTED: protein PAM68, chloroplastic-like [Solanum tuberosum]
Length=197

 Score =   128 bits (321),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 82/88 (93%), Positives = 87/88 (99%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMGLSVGIPLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFG+A
Sbjct  91   GVIPEIVTNRMISRMGLSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGSA  150

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMREGS LGWNEA+
Sbjct  151  LLGVSYGIVSSSWDPMREGSTLGWNEAK  178



>gb|KDP35418.1| hypothetical protein JCGZ_10801 [Jatropha curcas]
Length=214

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPE+VTNRM+SRMG SVGIPLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  110  GIIPEVVTNRMISRMGFSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  169

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  170  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  197



>gb|EYU37511.1| hypothetical protein MIMGU_mgv1a014159mg [Erythranthe guttata]
Length=199

 Score =   127 bits (319),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 79/87 (91%), Positives = 87/87 (100%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRMMSR+GLSVGIPLF+GLLFFPFFYYLKVGLKID+PTW+PFIVSF+FFGTAL
Sbjct  95   VIPEIVTNRMMSRIGLSVGIPLFVGLLFFPFFYYLKVGLKIDIPTWVPFIVSFVFFGTAL  154

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVS+SWDP+REGSLLGWNEA+
Sbjct  155  LGVSYGIVSASWDPLREGSLLGWNEAK  181



>ref|XP_004300149.1| PREDICTED: protein PAM68, chloroplastic [Fragaria vesca subsp. 
vesca]
Length=212

 Score =   127 bits (319),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPEIVTNRM+SRMG +VG+PLF GLLFFPFFYYLKVGLK+DVPTW+PFIVSF+FFGTA
Sbjct  108  GIIPEIVTNRMISRMGFTVGLPLFTGLLFFPFFYYLKVGLKLDVPTWVPFIVSFVFFGTA  167

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDPMREGSLLGWNEAQ
Sbjct  168  LAGVSYGIVSSSWDPMREGSLLGWNEAQ  195



>ref|XP_004253084.1| PREDICTED: protein PAM68, chloroplastic [Solanum lycopersicum]
Length=193

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG SVGIPLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFG+A
Sbjct  87   GVIPEIVTNRMISRMGFSVGIPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGSA  146

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMREGS LGWNEA+
Sbjct  147  LLGVSYGIVSSSWDPMREGSTLGWNEAK  174



>ref|XP_008373447.1| PREDICTED: protein PAM68, chloroplastic [Malus domestica]
Length=227

 Score =   127 bits (319),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 84/87 (97%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+ RMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTAL
Sbjct  123  VIPEIVTNRMIGRMGFTVGLPLFLGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTAL  182

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDPMREGSLLGW EAQ
Sbjct  183  LGVSYGIVSSSWDPMREGSLLGWTEAQ  209



>ref|XP_009365732.1| PREDICTED: protein PAM68, chloroplastic [Pyrus x bretschneideri]
Length=226

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+ RMG +VG+PLF+GLLFF FFYYLKVGLKIDVPTW+PFIVSF+FFGTAL
Sbjct  122  VIPEIVTNRMIGRMGFTVGLPLFLGLLFFSFFYYLKVGLKIDVPTWVPFIVSFVFFGTAL  181

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDPMREGSLLGW EAQ
Sbjct  182  LGVSYGIVSSSWDPMREGSLLGWTEAQ  208



>ref|XP_010434463.1| PREDICTED: protein PAM68, chloroplastic [Camelina sativa]
Length=215

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  111  GVIPEIVTNRMISRMGFTVGLPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTA  170

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  171  LAGVSYGIVSSSWDPLREGSLLGWNEAK  198



>ref|XP_010439767.1| PREDICTED: protein PAM68, chloroplastic-like [Camelina sativa]
Length=214

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  110  GVIPEIVTNRMISRMGFTVGLPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTA  169

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  170  LAGVSYGIVSSSWDPLREGSLLGWNEAK  197



>ref|XP_010449401.1| PREDICTED: protein PAM68, chloroplastic-like [Camelina sativa]
Length=218

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  114  GVIPEIVTNRMISRMGFTVGLPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTA  173

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  174  LAGVSYGIVSSSWDPLREGSLLGWNEAK  201



>gb|KFK28579.1| hypothetical protein AALP_AA7G015400 [Arabis alpina]
Length=212

 Score =   126 bits (316),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 98/155 (63%), Positives = 122/155 (79%), Gaps = 4/155 (3%)
 Frame = +2

Query  71   LPKSKPHQSSTSLSHFT-LSAT---PRGFGYGTSQkkpkrskkkprkGSFedddedkeee  238
            +P+S  + +   +S F  L AT   PRGFG    + K    K KP   S E+D+E+++++
Sbjct  41   VPQSLTYINQLEISRFAPLQATMNSPRGFGRPPKKTKKSTKKLKPGNQSDEEDEEEEDDD  100

Query  239  veedeeeGVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVS  418
             E++ E GVIPEIVTNRM+SRMG +VG+PLF+GLLFFP FYYLKVGLK+DVPTW+PFIVS
Sbjct  101  YEDERERGVIPEIVTNRMISRMGFTVGLPLFVGLLFFPLFYYLKVGLKVDVPTWVPFIVS  160

Query  419  FIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            F+FFGTAL GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  161  FVFFGTALAGVSYGIVSSSWDPLREGSLLGWNEAK  195



>gb|KJB25156.1| hypothetical protein B456_004G178900 [Gossypium raimondii]
Length=208

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRM+SRMG +VGIPL +GLLFFPFFYYLKV LKIDVPTW+PFIVSFIFFGTA
Sbjct  103  GVIPEVVTNRMISRMGFTVGIPLLVGLLFFPFFYYLKVELKIDVPTWVPFIVSFIFFGTA  162

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS+LGWNEAQ
Sbjct  163  LLGVSYGIVSSSWDPLREGSVLGWNEAQ  190



>ref|XP_007040805.1| PAM68, chloroplastic, putative isoform 1 [Theobroma cacao]
 ref|XP_007040806.1| PAM68, chloroplastic, putative isoform 1 [Theobroma cacao]
 gb|EOY25306.1| PAM68, chloroplastic, putative isoform 1 [Theobroma cacao]
 gb|EOY25307.1| PAM68, chloroplastic, putative isoform 1 [Theobroma cacao]
Length=245

 Score =   127 bits (318),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG SVG+PLFIGLLFFPFFYYLKV LKIDVPTW+PFIVSF FFGTA
Sbjct  135  GVIPEIVTNRMISRMGFSVGVPLFIGLLFFPFFYYLKVVLKIDVPTWVPFIVSFFFFGTA  194

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  195  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  222



>ref|XP_007040807.1| PAM68, chloroplastic, putative isoform 3 [Theobroma cacao]
 ref|XP_007040808.1| PAM68, chloroplastic, putative isoform 3 [Theobroma cacao]
 gb|EOY25308.1| PAM68, chloroplastic, putative isoform 3 [Theobroma cacao]
 gb|EOY25309.1| PAM68, chloroplastic, putative isoform 3 [Theobroma cacao]
Length=239

 Score =   126 bits (317),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 81/88 (92%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG SVG+PLFIGLLFFPFFYYLKV LKIDVPTW+PFIVSF FFGTA
Sbjct  135  GVIPEIVTNRMISRMGFSVGVPLFIGLLFFPFFYYLKVVLKIDVPTWVPFIVSFFFFGTA  194

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  195  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  222



>gb|KJB25157.1| hypothetical protein B456_004G178900 [Gossypium raimondii]
Length=187

 Score =   125 bits (313),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRM+SRMG +VGIPL +GLLFFPFFYYLKV LKIDVPTW+PFIVSFIFFGTA
Sbjct  82   GVIPEVVTNRMISRMGFTVGIPLLVGLLFFPFFYYLKVELKIDVPTWVPFIVSFIFFGTA  141

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS+LGWNEAQ
Sbjct  142  LLGVSYGIVSSSWDPLREGSVLGWNEAQ  169



>ref|NP_974571.1| uncharacterized protein [Arabidopsis thaliana]
 sp|O49668.1|PAM68_ARATH RecName: Full=Protein PAM68, chloroplastic; AltName: Full=PHOTOSYNTHESIS 
AFFECTED MUTANT 68; Flags: Precursor [Arabidopsis 
thaliana]
 emb|CAA16699.1| putative protein [Arabidopsis thaliana]
 emb|CAB78912.1| putative protein [Arabidopsis thaliana]
 gb|ABL66777.1| At4g19100 [Arabidopsis thaliana]
 gb|AEE84140.1| uncharacterized protein AT4G19100 [Arabidopsis thaliana]
Length=214

 Score =   125 bits (315),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLFIGLLFFPFFYYLKVGLK+DVPTW+PFIVSF+FFGTA
Sbjct  110  GVIPEIVTNRMISRMGFTVGLPLFIGLLFFPFFYYLKVGLKVDVPTWVPFIVSFVFFGTA  169

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  170  LAGVSYGIVSSSWDPLREGSLLGWNEAK  197



>ref|XP_011018420.1| PREDICTED: protein PAM68, chloroplastic isoform X2 [Populus euphratica]
Length=212

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRMG+SVG PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  108  GVIPEVVTNRMMSRMGISVGAPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  167

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP REGS  GWNEAQ
Sbjct  168  LLGVSYGIVSSSWDPNREGSFWGWNEAQ  195



>ref|XP_009108407.1| PREDICTED: protein PAM68, chloroplastic isoform X2 [Brassica 
rapa]
Length=200

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GL FFP FYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  100  GVIPEIVTNRMISRMGFTVGLPLFVGLCFFPLFYYLKVGLKIDVPTWVPFIVSFVFFGTA  159

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP REGSLLGWNEA+
Sbjct  160  LAGVSYGIVSSSWDPSREGSLLGWNEAK  187



>emb|CDX76498.1| BnaA08g09020D [Brassica napus]
Length=204

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GL FFP FYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  100  GVIPEIVTNRMISRMGFTVGLPLFVGLCFFPLFYYLKVGLKIDVPTWVPFIVSFVFFGTA  159

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP REGSLLGWNEA+
Sbjct  160  LAGVSYGIVSSSWDPSREGSLLGWNEAK  187



>ref|XP_009108406.1| PREDICTED: protein PAM68, chloroplastic isoform X1 [Brassica 
rapa]
Length=201

 Score =   124 bits (312),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GL FFP FYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  101  GVIPEIVTNRMISRMGFTVGLPLFVGLCFFPLFYYLKVGLKIDVPTWVPFIVSFVFFGTA  160

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP REGSLLGWNEA+
Sbjct  161  LAGVSYGIVSSSWDPSREGSLLGWNEAK  188



>emb|CDY09271.1| BnaC03g63010D [Brassica napus]
Length=204

 Score =   124 bits (312),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLF+GL FFP FYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  100  GVIPEIVTNRMISRMGFTVGLPLFVGLCFFPLFYYLKVGLKIDVPTWVPFIVSFVFFGTA  159

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP REGSLLGWNEA+
Sbjct  160  LAGVSYGIVSSSWDPSREGSLLGWNEAR  187



>ref|XP_008448605.1| PREDICTED: protein PAM68, chloroplastic isoform X2 [Cucumis melo]
Length=216

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRMG +VGIPLFIGLLFFPFFYYLKVGLKIDVP+W+P IVSF FFG+A
Sbjct  112  GVIPEVVTNRMMSRMGFTVGIPLFIGLLFFPFFYYLKVGLKIDVPSWVPVIVSFFFFGSA  171

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMREGSLLGWNEAQ
Sbjct  172  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  199



>ref|XP_008448604.1| PREDICTED: protein PAM68, chloroplastic isoform X1 [Cucumis melo]
Length=217

 Score =   125 bits (313),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRMG +VGIPLFIGLLFFPFFYYLKVGLKIDVP+W+P IVSF FFG+A
Sbjct  113  GVIPEVVTNRMMSRMGFTVGIPLFIGLLFFPFFYYLKVGLKIDVPSWVPVIVSFFFFGSA  172

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMREGSLLGWNEAQ
Sbjct  173  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  200



>ref|XP_011018419.1| PREDICTED: protein PAM68, chloroplastic isoform X1 [Populus euphratica]
Length=226

 Score =   125 bits (313),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/88 (89%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRMG+SVG PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  122  GVIPEVVTNRMMSRMGISVGAPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  181

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP REGS  GWNEAQ
Sbjct  182  LLGVSYGIVSSSWDPNREGSFWGWNEAQ  209



>emb|CBI24589.3| unnamed protein product [Vitis vinifera]
Length=136

 Score =   122 bits (306),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SRMG SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+AL
Sbjct  33   VIPEIVTNRMISRMGFSVGIPLMIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSAL  92

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDP+REGS LGW EAQ
Sbjct  93   LGVSYGIVSSSWDPLREGSFLGWTEAQ  119



>ref|XP_010278829.1| PREDICTED: protein PAM68, chloroplastic [Nelumbo nucifera]
 ref|XP_010278830.1| PREDICTED: protein PAM68, chloroplastic [Nelumbo nucifera]
 ref|XP_010278832.1| PREDICTED: protein PAM68, chloroplastic [Nelumbo nucifera]
 ref|XP_010278833.1| PREDICTED: protein PAM68, chloroplastic [Nelumbo nucifera]
Length=192

 Score =   124 bits (310),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPE+VTNRMMSRM  SVGIPLFIGLLFFPFFYYLKV LKIDVPTW+PFIVSF FFG+A
Sbjct  88   GIIPEVVTNRMMSRMAFSVGIPLFIGLLFFPFFYYLKVVLKIDVPTWVPFIVSFFFFGSA  147

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  148  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  175



>ref|XP_006285425.1| hypothetical protein CARUB_v10006842mg [Capsella rubella]
 gb|EOA18323.1| hypothetical protein CARUB_v10006842mg [Capsella rubella]
Length=212

 Score =   124 bits (312),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SRMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTAL
Sbjct  109  VIPEIVTNRMISRMGFTVGLPLFVGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTAL  168

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             GVSYGIVSSSWDP+REGSLLGWNEA+
Sbjct  169  AGVSYGIVSSSWDPLREGSLLGWNEAK  195



>ref|XP_010535844.1| PREDICTED: protein PAM68, chloroplastic [Tarenaya hassleriana]
Length=222

 Score =   124 bits (312),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 80/88 (91%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VGIPLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSFIFFG A
Sbjct  113  GVIPEIVTNRMISRMGFTVGIPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFIFFGAA  172

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS LGW EAQ
Sbjct  173  LLGVSYGIVSSSWDPLREGSFLGWKEAQ  200



>ref|XP_002870000.1| hypothetical protein ARALYDRAFT_492947 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46259.1| hypothetical protein ARALYDRAFT_492947 [Arabidopsis lyrata subsp. 
lyrata]
Length=214

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 86/88 (98%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLFIGLLFFPFFYYLKVGLK+DVPTW+PFIVSF+FFGTA
Sbjct  110  GVIPEIVTNRMISRMGFTVGLPLFIGLLFFPFFYYLKVGLKVDVPTWVPFIVSFVFFGTA  169

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVSSSWDP+R+GSLLGWNEA+
Sbjct  170  LAGVSYGIVSSSWDPLRKGSLLGWNEAK  197



>ref|XP_004146119.1| PREDICTED: protein PAM68, chloroplastic-like [Cucumis sativus]
 ref|XP_004163614.1| PREDICTED: protein PAM68, chloroplastic-like [Cucumis sativus]
 gb|KGN55697.1| hypothetical protein Csa_3G006590 [Cucumis sativus]
Length=213

 Score =   124 bits (311),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 85/88 (97%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRMG +VGIPLFIGLLFFPFFYYLKVGLKIDVP+W+P IVSF FFG+A
Sbjct  109  GVIPEVVTNRMMSRMGFTVGIPLFIGLLFFPFFYYLKVGLKIDVPSWVPVIVSFFFFGSA  168

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  169  LLGVSYGIVSSSWDPLREGSLLGWNEAQ  196



>ref|XP_006368302.1| hypothetical protein POPTR_0001s01420g [Populus trichocarpa]
 gb|ERP64871.1| hypothetical protein POPTR_0001s01420g [Populus trichocarpa]
Length=347

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 84/88 (95%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMM+RMG+SVG PLF+G+LFFPFFYYLKVGLKIDVPTW+PFIVSFIFFG+A
Sbjct  122  GVIPEVVTNRMMTRMGISVGAPLFVGVLFFPFFYYLKVGLKIDVPTWVPFIVSFIFFGSA  181

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP REGS  GWNEAQ
Sbjct  182  LLGVSYGIVSSSWDPKREGSFWGWNEAQ  209



>ref|XP_002266174.1| PREDICTED: protein PAM68, chloroplastic [Vitis vinifera]
 emb|CAN79943.1| hypothetical protein VITISV_021078 [Vitis vinifera]
Length=196

 Score =   122 bits (307),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 78/87 (90%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SRMG SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+AL
Sbjct  93   VIPEIVTNRMISRMGFSVGIPLMIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSAL  152

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDP+REGS LGW EAQ
Sbjct  153  LGVSYGIVSSSWDPLREGSFLGWTEAQ  179



>ref|XP_006414010.1| hypothetical protein EUTSA_v10026226mg [Eutrema salsugineum]
 gb|ESQ55463.1| hypothetical protein EUTSA_v10026226mg [Eutrema salsugineum]
Length=213

 Score =   121 bits (304),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 83/87 (95%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SRMG +VG+PLFIGLLFFP FYYLKVGLKIDVP+W+PFIVSF+FFGTAL
Sbjct  110  VIPEIVTNRMISRMGFTVGLPLFIGLLFFPIFYYLKVGLKIDVPSWVPFIVSFVFFGTAL  169

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             GVSY IVSSSWDP+REGSLLGWNEA+
Sbjct  170  AGVSYAIVSSSWDPLREGSLLGWNEAK  196



>ref|XP_003517076.1| PREDICTED: protein PAM68, chloroplastic [Glycine max]
 gb|KHN41732.1| Protein PAM68, chloroplastic [Glycine soja]
Length=208

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 77/88 (88%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMSRM +SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  103  GVIPEVVTNRMMSRMAVSVGIPLGIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  162

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS  GW EAQ
Sbjct  163  LLGVSYGIVSSSWDPLREGSFWGWTEAQ  190



>gb|AFK40696.1| unknown [Lotus japonicus]
Length=201

 Score =   120 bits (301),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 76/88 (86%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMMS M  SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSFIF+G+A
Sbjct  99   GVIPEVVTNRMMSGMAFSVGIPLGIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFIFYGSA  158

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP+REGSLLGWNE +
Sbjct  159  LLGVSYGIVSTSWDPLREGSLLGWNEPR  186



>ref|XP_004512411.1| PREDICTED: protein PAM68, chloroplastic-like [Cicer arietinum]
Length=199

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPE+VTNRM+ RM LSVG+PL IGLLFFPFFYYLKVGLKIDVP W+PFIVSF FFG+A
Sbjct  95   GIIPEVVTNRMIGRMALSVGVPLGIGLLFFPFFYYLKVGLKIDVPNWVPFIVSFFFFGSA  154

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP+REGSLLGW EAQ
Sbjct  155  LLGVSYGIVSASWDPLREGSLLGWTEAQ  182



>ref|XP_003612620.1| hypothetical protein MTR_5g027010 [Medicago truncatula]
 gb|AES95578.1| transmembrane protein, putative [Medicago truncatula]
Length=202

 Score =   120 bits (300),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 73/88 (83%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G+IPE+VTNRM+ RM LSVGIPL +GLLFFPFFYYLKVGLKIDVP W+PF+VSF FFG+A
Sbjct  98   GIIPEVVTNRMIGRMALSVGIPLSVGLLFFPFFYYLKVGLKIDVPNWVPFLVSFFFFGSA  157

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP+REGSLLGW EAQ
Sbjct  158  LLGVSYGIVSASWDPLREGSLLGWTEAQ  185



>ref|XP_003534311.1| PREDICTED: protein PAM68, chloroplastic-like [Glycine max]
 gb|KHN11840.1| Protein PAM68, chloroplastic [Glycine soja]
Length=211

 Score =   120 bits (300),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 81/88 (92%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMM+RM +SVGIPL +GLLFFP FYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  105  GVIPEVVTNRMMNRMAVSVGIPLGVGLLFFPLFYYLKVGLKIDVPTWVPFIVSFFFFGSA  164

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+REGS  GW EAQ
Sbjct  165  LLGVSYGIVSSSWDPLREGSFWGWTEAQ  192



>ref|XP_008802491.1| PREDICTED: protein PAM68, chloroplastic isoform X1 [Phoenix dactylifera]
Length=192

 Score =   119 bits (297),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G IPE+VTNRMM RMG SVGIPL  GLLFFPFFYYLKV  KIDVPTWIPFIVSF FFG+A
Sbjct  89   GTIPEVVTNRMMRRMGFSVGIPLAFGLLFFPFFYYLKVVSKIDVPTWIPFIVSFFFFGSA  148

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP+REGSLLGWNEA+
Sbjct  149  LLGVSYGIVSASWDPLREGSLLGWNEAR  176



>ref|XP_010906237.1| PREDICTED: protein PAM68, chloroplastic [Elaeis guineensis]
Length=194

 Score =   118 bits (295),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 75/88 (85%), Positives = 80/88 (91%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G IPE+VTNRMM RMG SVGIPL  GLLFFPFFYYLKV  KIDVPTWIPFIVSF FFG+A
Sbjct  91   GTIPEVVTNRMMRRMGFSVGIPLAFGLLFFPFFYYLKVVSKIDVPTWIPFIVSFFFFGSA  150

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP+REGSLLGWNEA+
Sbjct  151  LLGVSYGIVSASWDPLREGSLLGWNEAR  178



>ref|XP_010097737.1| Ribose-phosphate pyrophosphokinase 1 [Morus notabilis]
 gb|EXB70692.1| Ribose-phosphate pyrophosphokinase 1 [Morus notabilis]
Length=658

 Score =   123 bits (309),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 79/88 (90%), Positives = 83/88 (94%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+SRMG +VG+PLFIGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFGTA
Sbjct  554  GVIPEIVTNRMISRMGFTVGVPLFIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGTA  613

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDPMR GS  GWNEAQ
Sbjct  614  LLGVSYGIVSSSWDPMRGGSFWGWNEAQ  641



>gb|KDO50363.1| hypothetical protein CISIN_1g028026mg [Citrus sinensis]
Length=215

 Score =   117 bits (294),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 75/87 (86%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SR+G +VGIPL +GLLFFPFFYYLKV LKIDVP+W+P IVSFIFFG AL
Sbjct  110  VIPEIVTNRMISRIGFTVGIPLLVGLLFFPFFYYLKVVLKIDVPSWLPVIVSFIFFGAAL  169

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDP+REGSLLGWNEAQ
Sbjct  170  LGVSYGIVSSSWDPLREGSLLGWNEAQ  196



>ref|XP_007158189.1| hypothetical protein PHAVU_002G131600g [Phaseolus vulgaris]
 gb|ESW30183.1| hypothetical protein PHAVU_002G131600g [Phaseolus vulgaris]
Length=210

 Score =   117 bits (294),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 74/88 (84%), Positives = 82/88 (93%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPE+VTNRMM+R+ +SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+A
Sbjct  106  GVIPEVVTNRMMNRVAVSVGIPLSIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSA  165

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVSSSWDP+R+GS  GW EAQ
Sbjct  166  LLGVSYGIVSSSWDPLRDGSFWGWTEAQ  193



>ref|XP_006432569.1| hypothetical protein CICLE_v10002455mg [Citrus clementina]
 ref|XP_006471335.1| PREDICTED: protein PAM68, chloroplastic-like [Citrus sinensis]
 gb|ESR45809.1| hypothetical protein CICLE_v10002455mg [Citrus clementina]
 gb|KDO50362.1| hypothetical protein CISIN_1g028112mg [Citrus sinensis]
Length=213

 Score =   117 bits (292),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 74/87 (85%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRM+SR+G +VGIPL +GLLFFPFFYYLKV LKIDVP+W+P IVSFIFFG AL
Sbjct  108  VIPEIVTNRMISRIGFTVGIPLLVGLLFFPFFYYLKVVLKIDVPSWLPVIVSFIFFGAAL  167

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGV+YGIVSSSWDP+REGSLLGWNEAQ
Sbjct  168  LGVNYGIVSSSWDPLREGSLLGWNEAQ  194



>ref|XP_006854204.1| hypothetical protein AMTR_s00048p00210800 [Amborella trichopoda]
 gb|ERN15671.1| hypothetical protein AMTR_s00048p00210800 [Amborella trichopoda]
Length=186

 Score =   115 bits (288),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 71/87 (82%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPEIVTNRMM RMG SVGIPLF GL FFP FYYLKV LK+D+P W+PFIVSF FFG+AL
Sbjct  83   TIPEIVTNRMMGRMGFSVGIPLFFGLFFFPVFYYLKVILKVDIPNWLPFIVSFFFFGSAL  142

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVSSSWDP+REGS LGW EAQ
Sbjct  143  LGVSYGIVSSSWDPLREGSFLGWKEAQ  169



>ref|XP_007211025.1| hypothetical protein PRUPE_ppa019898mg, partial [Prunus persica]
 gb|EMJ12224.1| hypothetical protein PRUPE_ppa019898mg, partial [Prunus persica]
Length=195

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 72/82 (88%), Positives = 79/82 (96%), Gaps = 0/82 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            GVIPEIVTNRM+ RMG +VG+PLF+GLLFFPFFYYLKVGLKIDVPTW+PFIVSF+FFGTA
Sbjct  114  GVIPEIVTNRMIGRMGFTVGVPLFLGLLFFPFFYYLKVGLKIDVPTWVPFIVSFVFFGTA  173

Query  440  LLGVSYGIVSSSWDPMREGSLL  505
            L GVSYGIVSSSWDP+REGSLL
Sbjct  174  LFGVSYGIVSSSWDPLREGSLL  195



>gb|EAZ36811.1| hypothetical protein OsJ_21150 [Oryza sativa Japonica Group]
Length=215

 Score =   113 bits (282),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G+SVG PL +G+ F P FYYLK   K+DVPTWIPF VSF+FFG AL
Sbjct  103  AIPEVVTNRMMRRVGVSVGAPLAVGVAFLPAFYYLKKAAKVDVPTWIPFGVSFLFFGAAL  162

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  163  LGVSYGIVSASWDPAREGSLLGWNEAR  189



>ref|NP_001174756.1| Os06g0319800 [Oryza sativa Japonica Group]
 dbj|BAD61615.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|EAZ00723.1| hypothetical protein OsI_22748 [Oryza sativa Indica Group]
 dbj|BAH93484.1| Os06g0319800 [Oryza sativa Japonica Group]
Length=215

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G+SVG PL +G+ F P FYYLK   K+DVPTWIPF VSF+FFG AL
Sbjct  103  AIPEVVTNRMMRRVGVSVGAPLAVGVAFLPAFYYLKKAAKVDVPTWIPFGVSFLFFGAAL  162

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  163  LGVSYGIVSASWDPAREGSLLGWNEAR  189



>ref|XP_004985587.1| PREDICTED: protein PAM68, chloroplastic-like [Setaria italica]
Length=208

 Score =   111 bits (277),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G+SVG PL +G+ FFP FYYLK   K+DVPTWIPF VSF+FFG AL
Sbjct  106  AIPEVVTNRMMRRVGVSVGAPLALGVGFFPLFYYLKAVRKVDVPTWIPFGVSFVFFGAAL  165

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  166  LGVSYGIVSASWDPAREGSLLGWNEAR  192



>gb|EPS59352.1| hypothetical protein M569_15458, partial [Genlisea aurea]
Length=149

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 70/87 (80%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIPEIVTNRMM R+  SVGIPLF GL FFPFFYYLK   K+DVP+WIP IVSF FFGTAL
Sbjct  50   VIPEIVTNRMMGRIAASVGIPLFTGLAFFPFFYYLKAVAKLDVPSWIPLIVSFFFFGTAL  109

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LGVSYGIVS+SWDP+REGS LGWNEA+
Sbjct  110  LGVSYGIVSASWDPLREGSTLGWNEAK  136



>ref|XP_006656932.1| PREDICTED: protein PAM68, chloroplastic-like [Oryza brachyantha]
Length=208

 Score =   108 bits (271),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
              IPE+VTNRMM R+G+SVG PL +G+ FFP FYYLK   K+DVPTWIPF VSF+FFG A
Sbjct  100  AAIPEVVTNRMMRRVGVSVGAPLAVGVGFFPAFYYLKTVAKVDVPTWIPFGVSFVFFGAA  159

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LLGVSYGIVS+SWDP REGSLLGW+EA+
Sbjct  160  LLGVSYGIVSASWDPSREGSLLGWSEAR  187



>ref|XP_008660538.1| PREDICTED: protein PAM68, chloroplastic-like [Zea mays]
 gb|AFW89588.1| hypothetical protein ZEAMMB73_349086 [Zea mays]
 gb|AFW89720.1| ABC-type Co2+ transport system, permease component [Zea mays]
Length=215

 Score =   108 bits (270),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
              IPE+VTNRMM R+G SVG+PL +G+  FP FYYLK   K+DVPTWIPF VSF+FFG A
Sbjct  107  ATIPEVVTNRMMRRVGASVGLPLALGVGLFPVFYYLKAVAKVDVPTWIPFGVSFVFFGAA  166

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  167  LAGVSYGIVSASWDPAREGSLLGWNEAR  194



>ref|XP_002465806.1| hypothetical protein SORBIDRAFT_01g046150 [Sorghum bicolor]
 gb|EER92804.1| hypothetical protein SORBIDRAFT_01g046150 [Sorghum bicolor]
Length=206

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
              IPE+VTNRMM R+G SVG+PL +G+ FFP FYYLK   K+DVPTWIPF VSF+FFG A
Sbjct  98   ATIPEVVTNRMMRRVGASVGLPLALGVGFFPVFYYLKAVAKVDVPTWIPFGVSFVFFGAA  157

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  158  LAGVSYGIVSASWDPAREGSLLGWNEAR  185



>ref|NP_001150699.1| ABC-type Co2+ transport system, permease component [Zea mays]
 gb|ACG40047.1| ABC-type Co2+ transport system, permease component [Zea mays]
Length=212

 Score =   108 bits (269),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
              IPE+VTNRMM R+G SVG+PL +G+ FFP FYYLK   K+DVPTWIPF VSF+FFG A
Sbjct  106  ATIPEVVTNRMMRRVGASVGLPLALGVGFFPVFYYLKAVAKVDVPTWIPFGVSFVFFGAA  165

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            L GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  166  LAGVSYGIVSASWDPAREGSLLGWNEAR  193



>ref|XP_009397800.1| PREDICTED: protein PAM68, chloroplastic [Musa acuminata subsp. 
malaccensis]
Length=198

 Score =   107 bits (267),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 65/86 (76%), Positives = 77/86 (90%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+VTNRMM RMG+S+GIPL +GLLFFP FYYLKV  K+DVP+W+P +VSF FFG +LL
Sbjct  92   IPEVVTNRMMRRMGVSIGIPLSLGLLFFPLFYYLKVVAKVDVPSWVPVLVSFFFFGASLL  151

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            GVSYGIVS+SWDP+REGS LGWNEA+
Sbjct  152  GVSYGIVSASWDPLREGSFLGWNEAR  177



>gb|ACU20343.1| unknown [Glycine max]
Length=96

 Score =   101 bits (251),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 68/78 (87%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +2

Query  290  MMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSYGIVS  469
            MMSRM +SVGIPL IGLLFFPFFYYLKVGLKIDVPTW+PFIVSF FFG+ALLGVSYGIVS
Sbjct  1    MMSRMAVSVGIPLGIGLLFFPFFYYLKVGLKIDVPTWVPFIVSFFFFGSALLGVSYGIVS  60

Query  470  SSWDPMREGSLLGWNEAQ  523
            SSWDP+REGS  GW EAQ
Sbjct  61   SSWDPLREGSFWGWTEAQ  78



>gb|EMS52637.1| hypothetical protein TRIUR3_12218 [Triticum urartu]
Length=211

 Score =   101 bits (252),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G SVGIPL +GL FFP FYYLK   K+DVP++IP+ +SF+FFG AL
Sbjct  102  AIPEVVTNRMMRRVGASVGIPLALGLAFFPAFYYLKKVAKVDVPSFIPYGLSFVFFGAAL  161

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  162  AGVSYGIVSASWDPAREGSLLGWNEAR  188



>dbj|BAJ86947.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=212

 Score =   101 bits (251),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G SVG+PL +GL FFP FYYLK   K+DVP++IP+ +SF+FFG AL
Sbjct  102  AIPEVVTNRMMRRVGASVGLPLALGLAFFPAFYYLKKVAKVDVPSFIPYGLSFVFFGAAL  161

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  162  AGVSYGIVSASWDPAREGSLLGWNEAR  188



>gb|EMT12087.1| hypothetical protein F775_13697 [Aegilops tauschii]
Length=241

 Score =   101 bits (251),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G SVG+PL +GL FFP FYYLK   K+DVP++IP+ +SF+FFG AL
Sbjct  131  AIPEVVTNRMMRRVGASVGLPLALGLAFFPAFYYLKKVAKVDVPSFIPYGLSFVFFGAAL  190

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             GVSYGIVS+SWDP REGSLLGWNEA+
Sbjct  191  AGVSYGIVSASWDPAREGSLLGWNEAR  217



>ref|XP_003558741.1| PREDICTED: protein PAM68, chloroplastic-like [Brachypodium distachyon]
Length=213

 Score = 98.2 bits (243),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+VTNRMM R+G SVG+PL +GL FFP FYYLK   K+DVPT+IP+ +SF+FFG AL
Sbjct  107  AIPEVVTNRMMRRVGASVGLPLALGLGFFPAFYYLKKVAKVDVPTFIPYGLSFVFFGAAL  166

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             G+SYGIVS+SWDP REGS LGWNEA+
Sbjct  167  AGISYGIVSASWDPNREGSWLGWNEAR  193



>ref|XP_001782833.1| predicted protein [Physcomitrella patens]
 gb|EDQ52347.1| predicted protein, partial [Physcomitrella patens]
Length=99

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            V+PE+VTNRM+ R+  +VGIP  IG+ FF  +YYLK   K+D+P W+P   SF+ FG+A 
Sbjct  6    VVPEVVTNRMLKRIAFTVGIPFAIGVAFFVLYYYLKAVKKVDIPEWLPLFTSFLTFGSAG  65

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
             G++YG++S+SWDP REGSLLGW EAQ
Sbjct  66   AGITYGVLSASWDPKREGSLLGWKEAQ  92



>ref|XP_005849087.1| hypothetical protein CHLNCDRAFT_57385 [Chlorella variabilis]
 gb|EFN56985.1| hypothetical protein CHLNCDRAFT_57385 [Chlorella variabilis]
Length=234

 Score = 79.7 bits (195),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 50/87 (57%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            V+PE+VTNRM+ R+ L +G P+F G+L FPFFY+LK+   +D+P W+ ++ S + FG  L
Sbjct  133  VVPEVVTNRMLRRVILFMGTPVFGGILLFPFFYWLKIKQGVDLPNWVAYLSSSLTFGGGL  192

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYGI+S+SWDP REGSLLGW E Q
Sbjct  193  LGISYGIMSASWDPRREGSLLGWTEFQ  219



>ref|XP_005849088.1| hypothetical protein CHLNCDRAFT_143598 [Chlorella variabilis]
 gb|EFN56986.1| hypothetical protein CHLNCDRAFT_143598 [Chlorella variabilis]
Length=196

 Score = 78.6 bits (192),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 49/87 (56%), Positives = 67/87 (77%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             +PE+VTNRM+ R+ L +G P+F G+L FPFFY+LK+   +D+P W+ ++ S + FG  L
Sbjct  95   AVPEVVTNRMLRRVILFMGTPVFGGILLFPFFYWLKIKQGVDLPNWVAYLSSSLTFGGGL  154

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYGI+S+SWDP REGSLLGW E Q
Sbjct  155  LGISYGIMSASWDPRREGSLLGWTEFQ  181



>ref|XP_006844462.1| hypothetical protein AMTR_s00016p00088520 [Amborella trichopoda]
 gb|ERN06137.1| hypothetical protein AMTR_s00016p00088520 [Amborella trichopoda]
Length=173

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V +RM+ R+   VG P+ +GL     F  LK G   D P W+P +   + FGT+ L
Sbjct  76   IPQVVLDRMLRRIVFYVGAPMGLGLGLLWAFDTLKNGGVWDAPMWLPLLTVLLGFGTSAL  135

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            GV+YG +S+SWDP  EGSLLGW EAQ
Sbjct  136  GVAYGTLSASWDPSEEGSLLGWKEAQ  161



>ref|XP_003574246.1| PREDICTED: uncharacterized protein PAM68-like [Brachypodium distachyon]
Length=220

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V +R++ R+  +VG+P+  G+     +  LK G  ++VP W+P + + + FGT+ L
Sbjct  118  LPQAVFDRILRRILFTVGVPMATGVALLSVYDALKRGRGVEVPQWVPLLTTLVAFGTSAL  177

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP +EGSLLG +EA+
Sbjct  178  GIAYGTLSASWDPDKEGSLLGIDEAR  203



>ref|XP_004983833.1| PREDICTED: protein PAM68, chloroplastic-like [Setaria italica]
Length=230

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V +R++ R+  +VG+P+  G+     +  LK G  ++VPTW+P +   + FGT+ L
Sbjct  122  LPQPVFDRILRRIMFAVGVPMASGVALLNAYDALKRGQGVEVPTWVPLLTILVAFGTSAL  181

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP +EGSLLG +EA+
Sbjct  182  GIAYGTLSASWDPDKEGSLLGIDEAR  207



>ref|XP_010261351.1| PREDICTED: uncharacterized protein PAM68-like [Nelumbo nucifera]
Length=185

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP +V  RM+ R+   VG P+ IG+   P F  LK     DVP W+PF+ + + FGT+ L
Sbjct  89   IPSVVFERMIVRILFYVGTPMAIGVALLPVFETLKDRHIWDVPLWLPFLTTLVAFGTSAL  148

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP ++GSLLGW EAQ
Sbjct  149  GIAYGTLSTSWDPDKKGSLLGWEEAQ  174



>ref|XP_010671611.1| PREDICTED: uncharacterized protein PAM68-like [Beta vulgaris 
subsp. vulgaris]
Length=181

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPEIV +RM+ R+  SVGIP+ +G +    F  LK     DVP W+ FI +F+FFG+++L
Sbjct  81   IPEIVFDRMIKRILASVGIPMAMGAVLLKTFDILKEKQMWDVPLWVTFITTFVFFGSSVL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            GV+YG +S+SW+   +GSLLG+ EA+
Sbjct  141  GVAYGSLSTSWNSENKGSLLGFEEAK  166



>ref|XP_004308047.2| PREDICTED: uncharacterized protein PAM68-like [Fragaria vesca 
subsp. vesca]
Length=184

 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 61/86 (71%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++VT RM+ R+  +VG+PL  G+ F   F Y+K     DVP W+PF+ + + FGT+ L
Sbjct  83   IPQVVTERMLVRIVAAVGLPLATGIAFLNVFEYIKENHLWDVPVWLPFLTTLLTFGTSAL  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG+ EAQ
Sbjct  143  GIAYGALSTSWDAEKKGSILGFEEAQ  168



>ref|XP_007038832.1| Sterol regulatory element-binding protein cleavage-activating 
protein, putative [Theobroma cacao]
 gb|EOY23333.1| Sterol regulatory element-binding protein cleavage-activating 
protein, putative [Theobroma cacao]
Length=181

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V +R+++R+ +SVG+PL  GL     F   K     DVP W+PF+ +FI FG + L
Sbjct  81   VPQVVFDRIIARILVSVGVPLATGLALLHLFGVAKEQNLWDVPLWLPFLTTFITFGASTL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP R GS++G  EAQ
Sbjct  141  GIAYGTLSASWDPERRGSIMGLEEAQ  166



>ref|XP_009382268.1| PREDICTED: uncharacterized protein PAM68-like [Musa acuminata 
subsp. malaccensis]
Length=183

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V +RM+ R+  SVG P+  G+       +LK     +VP W+P +   + FGT+ L
Sbjct  83   IPQVVFDRMIRRIVFSVGAPMASGIGVLYLESFLKKSQLWEVPGWLPLLTILLSFGTSAL  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP +EGSLLGW +A+
Sbjct  143  GIAYGTLSTSWDPNKEGSLLGWEQAR  168



>gb|KJB63794.1| hypothetical protein B456_010G016400 [Gossypium raimondii]
Length=182

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V  RM++R+ +SVG+P+  GL     F   K     D P W+PF+ + I FG + L
Sbjct  82   IPQVVFERMIARILVSVGVPMATGLALLHLFGVAKEQNLWDAPLWLPFLTTLITFGASTL  141

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP ++GSLLG  EAQ
Sbjct  142  GIAYGTLSASWDPKKKGSLLGLEEAQ  167



>ref|XP_010060378.1| PREDICTED: uncharacterized protein PAM68-like [Eucalyptus grandis]
 gb|KCW90620.1| hypothetical protein EUGRSUZ_A02725 [Eucalyptus grandis]
Length=146

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V  RM+ R+ + VG+P+  G+        +K    +DVP W+PF+ + + FG + +
Sbjct  48   IPQVVFERMIGRILVFVGVPMAAGIALLYVMGAIKERELLDVPRWLPFLTTLVCFGASAV  107

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +SSSWDP + GS+LG +EAQ
Sbjct  108  GIAYGTLSSSWDPDKSGSVLGLDEAQ  133



>gb|KJB68664.1| hypothetical protein B456_010G016500, partial [Gossypium raimondii]
Length=129

 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 39/85 (46%), Positives = 57/85 (67%), Gaps = 0/85 (0%)
 Frame = +2

Query  269  PEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLG  448
            P++V  RM++R+  SVG+P+  GL     F   K     DVP W+PF+ +FI FG ++L 
Sbjct  34   PQLVFERMIARILASVGVPMATGLALLHLFGLAKERNLWDVPLWLPFLTTFITFGESMLR  93

Query  449  VSYGIVSSSWDPMREGSLLGWNEAQ  523
            ++YG +S+SWDP ++GSLLG  EAQ
Sbjct  94   ITYGTLSASWDPKKKGSLLGLEEAQ  118



>gb|KDP22218.1| hypothetical protein JCGZ_26049 [Jatropha curcas]
Length=176

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 62/86 (72%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V+NR++ R+ +SVG+P+ +GL F  FF  +K     DVP WIPF+ +F+ FG + L
Sbjct  77   IPKEVSNRIIIRILVSVGLPMAVGLAFLNFFEVVKEQGLFDVPVWIPFLTTFVTFGASAL  136

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GSLLG  EAQ
Sbjct  137  GIAYGALSTSWDANKKGSLLGLEEAQ  162



>ref|NP_001151720.1| ABC-type Co2+ transport system, permease component [Zea mays]
 ref|XP_008657881.1| PREDICTED: uncharacterized protein PAM68-like [Zea mays]
 gb|ACG44117.1| ABC-type Co2+ transport system, permease component [Zea mays]
 tpg|DAA46047.1| TPA: ABC-type Co2+ transport system, permease component [Zea 
mays]
Length=214

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V +R++ R+  +VG+P+  G+     +  LK G  + VP+W+P +   + FGT+ L
Sbjct  108  LPQPVFDRILRRIAFTVGLPMASGVALLNVYDALKRGQGVVVPSWVPLLTILVAFGTSAL  167

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP +EGSLLG +EA+
Sbjct  168  GIAYGTLSASWDPDKEGSLLGIDEAR  193



>ref|XP_002465027.1| hypothetical protein SORBIDRAFT_01g030700 [Sorghum bicolor]
 gb|EER92025.1| hypothetical protein SORBIDRAFT_01g030700 [Sorghum bicolor]
Length=832

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 36/86 (42%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V +R++ R+  +VG+P+  G+     +  LK G  + VP+W+P +   + FGT+ L
Sbjct  723  LPQPVFDRILRRIAFTVGLPMATGVALLNVYDALKRGQGVVVPSWVPLLTILVAFGTSAL  782

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP REGSLLG +EA+
Sbjct  783  GIAYGTLSASWDPDREGSLLGIDEAR  808



>ref|XP_001416259.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO94552.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=98

 Score = 66.6 bits (161),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/84 (48%), Positives = 61/84 (73%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++VT+RM+ R+G+  G PL +G +  P FYY KV  K++VP+W+ F+ S   FG A++
Sbjct  1    LPQVVTDRMLKRVGIFCGTPLVLGFMTGPAFYYAKVIAKLEVPSWVFFVSSTATFGAAVV  60

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWDP  EGS  G +E
Sbjct  61   GISYGVLSASWDPRMEGSFWGGSE  84



>emb|CDP05137.1| unnamed protein product [Coffea canephora]
Length=188

 Score = 67.8 bits (164),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE V  R+M R+   VG+PL  G+     F  +K     DVP W+PF+ +F+ FG + L
Sbjct  89   IPEAVWERIMFRILFYVGVPLVTGVALLQVFSIMKEQNLWDVPIWLPFLTTFLTFGASAL  148

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  REGS LG+ EAQ
Sbjct  149  GIAYGTLSTSWDAQREGSFLGFEEAQ  174



>ref|XP_002953299.1| hypothetical protein VOLCADRAFT_105894 [Volvox carteri f. nagariensis]
 gb|EFJ45609.1| hypothetical protein VOLCADRAFT_105894 [Volvox carteri f. nagariensis]
Length=189

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 42/85 (49%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +2

Query  269  PEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLG  448
            P++V +RM  R+ +  G+P+F G+  FP FY+L+V   ID P WI +I   + FG  LLG
Sbjct  93   PQVVVDRMFRRILVCTGVPVFTGMALFPLFYWLRVVQDIDYPLWIVYIAQVLTFGGGLLG  152

Query  449  VSYGIVSSSWDPMREGSLLGWNEAQ  523
            ++YG +S+SWDP REGS LGW E Q
Sbjct  153  ITYGALSASWDPSREGSALGWTELQ  177



>ref|XP_010060371.1| PREDICTED: uncharacterized protein PAM68-like [Eucalyptus grandis]
 gb|KCW90619.1| hypothetical protein EUGRSUZ_A02724 [Eucalyptus grandis]
Length=189

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V  RM  R+   VG+P+  G+        +K    +DVP W+PF+ + + FG + L
Sbjct  91   IPQVVFERMTGRILAFVGVPMAAGIALLYVMGAIKERELLDVPRWLPFLTTLLCFGASAL  150

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +SSSWDP + GS LG +EAQ
Sbjct  151  GIAYGTLSSSWDPDKSGSALGLDEAQ  176



>ref|XP_003075338.1| unnamed protein product [Ostreococcus tauri]
 emb|CAL52610.1| Protein of unknown function DUF3464 [Ostreococcus tauri]
Length=226

 Score = 67.0 bits (162),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 41/84 (49%), Positives = 56/84 (67%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+IVT+RM+ R+G+  G PL +G    P FYY K    +DVP W+ F  S   FG A +
Sbjct  111  IPQIVTDRMLKRVGIFCGTPLMLGFTTGPLFYYFKAVRHVDVPPWVFFTASTATFGAAFI  170

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWDP REG+  G +E
Sbjct  171  GISYGVLSASWDPRREGTFWGGSE  194



>ref|XP_010919136.1| PREDICTED: uncharacterized protein PAM68-like [Elaeis guineensis]
Length=182

 Score = 66.2 bits (160),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V NR++ RM  SVGIP+ +G+        LK G   +VP W+PF+   + FGT+ +
Sbjct  83   IPPDVFNRLIRRMLFSVGIPMGLGIGLLYVLSLLKKGNIWEVPGWLPFLTILLSFGTSAM  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++Y  +++SWD  +EGSLLGW EAQ
Sbjct  143  GIAYATLTTSWDQNKEGSLLGWEEAQ  168



>ref|XP_009368728.1| PREDICTED: uncharacterized protein PAM68-like [Pyrus x bretschneideri]
Length=184

 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V  RM+ R+  +VG+PL  G  F   F  +K     DVP W+PF+ + + FGT+ L
Sbjct  81   VPQVVIERMLVRIIAAVGLPLATGFAFLKVFDAVKENHLWDVPLWLPFLTTLLTFGTSAL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG  EAQ
Sbjct  141  GIAYGALSTSWDAEKKGSVLGLEEAQ  166



>dbj|BAJ90050.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=223

 Score = 65.1 bits (157),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V +R++ R+  +VG+P+  G+     +  LK G   +VP+W+  +   + FGT+ L
Sbjct  122  LPQVVFDRILRRILFTVGVPMASGVALLNVYDALKRGGGAEVPSWVQLLTILLSFGTSAL  181

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWDP +EGSLLG +EA+
Sbjct  182  GIAYGTLSASWDPEKEGSLLGVDEAR  207



>ref|XP_008805570.1| PREDICTED: uncharacterized protein PAM68-like [Phoenix dactylifera]
Length=182

 Score = 64.7 bits (156),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V +RM+ RM  SVG P+ +G+        LK G   +VP W+PF+   + FGT+ +
Sbjct  83   IPPDVFDRMIRRMLFSVGTPMALGIGLLYVLSLLKKGNLWEVPGWLPFLTILLSFGTSAM  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++Y  +++SWD  +EGSLLGW EA+
Sbjct  143  GIAYATLTTSWDHNKEGSLLGWEEAK  168



>ref|XP_001690643.1| predicted membrane protein [Chlamydomonas reinhardtii]
 gb|EDP05902.1| predicted membrane protein [Chlamydomonas reinhardtii]
Length=147

 Score = 63.9 bits (154),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 59/85 (69%), Gaps = 0/85 (0%)
 Frame = +2

Query  269  PEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLG  448
            P+IV +RM  R+ +  G+P+F G+  FP FYYL+V + I+ P WI ++   + FG  L G
Sbjct  51   PQIVVDRMFRRILVFTGVPVFTGMALFPLFYYLRVVMDIEYPLWIVYVSQVLTFGGGLFG  110

Query  449  VSYGIVSSSWDPMREGSLLGWNEAQ  523
            ++YG +S+SWDP REGS +GW+E Q
Sbjct  111  ITYGALSASWDPTREGSAMGWSEMQ  135



>ref|XP_004150568.1| PREDICTED: uncharacterized protein PAM68-like [Cucumis sativus]
 ref|XP_004169837.1| PREDICTED: uncharacterized protein PAM68-like [Cucumis sativus]
 gb|KGN61652.1| hypothetical protein Csa_2G213970 [Cucumis sativus]
Length=180

 Score = 64.3 bits (155),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE V +R+++R+   VGIP+  G+     F  +K     DVP W+PF  +F+ FG + +
Sbjct  80   IPEAVYSRIITRILAFVGIPMAFGVTLLKIFQAIKEQNLWDVPIWVPFFTTFLTFGASTM  139

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S DP ++GS+LGW EAQ
Sbjct  140  GIAYGTLSTSLDPEKKGSVLGWEEAQ  165



>ref|XP_007219815.1| hypothetical protein PRUPE_ppa026735mg [Prunus persica]
 gb|EMJ21014.1| hypothetical protein PRUPE_ppa026735mg [Prunus persica]
Length=184

 Score = 63.9 bits (154),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 58/86 (67%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RM+ R+  SVG+P+ +G  F   F  +K     DVP W+PF+ + + FG++ L
Sbjct  79   IPQAVFERMLVRIVASVGLPMAMGFAFLNVFEVIKEKHLWDVPLWLPFLTTLLTFGSSTL  138

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG+ EAQ
Sbjct  139  GIAYGALSTSWDAEKKGSILGFEEAQ  164



>gb|KIZ07329.1| hypothetical protein MNEG_0616, partial [Monoraphidium neglectum]
Length=76

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 37/50 (74%), Gaps = 0/50 (0%)
 Frame = +2

Query  368  KVGLKIDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNE  517
            KV  K++ P W+ ++ S + FG  LLG++YGI+S+SWDP REG+ LGW E
Sbjct  27   KVVAKVEYPLWLAYLGSTLMFGGGLLGITYGILSTSWDPRREGTALGWTE  76



>ref|XP_002274943.1| PREDICTED: uncharacterized protein PAM68-like [Vitis vinifera]
 emb|CBI22642.3| unnamed protein product [Vitis vinifera]
Length=178

 Score = 63.9 bits (154),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V +RM+ R+   VG P+ IG+     F  +K     DVP W+PF+ + I FG + L
Sbjct  83   IPQVVFDRMIVRILFFVGAPMGIGVALLNLFGAVKDQHLWDVPVWLPFLTTLIAFGASAL  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GSLLG  EAQ
Sbjct  143  GIAYGTLSTSWDAEKKGSLLGLEEAQ  168



>ref|XP_008439311.1| PREDICTED: uncharacterized protein PAM68-like [Cucumis melo]
Length=184

 Score = 63.5 bits (153),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE V +R+++R+   VGIP+  G+     F  +K     DVP W+PF  +F+ FG + +
Sbjct  84   IPEAVYSRIITRILAFVGIPMAFGVTLLKIFQAIKEQNLWDVPIWVPFFTTFLTFGASTM  143

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S DP ++GS++GW EAQ
Sbjct  144  GIAYGTLSTSLDPEKKGSVMGWEEAQ  169



>ref|XP_006422044.1| hypothetical protein CICLE_v10006017mg [Citrus clementina]
 ref|XP_006490625.1| PREDICTED: uncharacterized protein PAM68-like [Citrus sinensis]
 gb|ESR35284.1| hypothetical protein CICLE_v10006017mg [Citrus clementina]
 gb|KDO56809.1| hypothetical protein CISIN_1g030244mg [Citrus sinensis]
Length=180

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 59/86 (69%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V  R++ R+ +SVG+PL  G+    FF  +K     D+P WIP + +F+ FG + +
Sbjct  83   LPQVVLERIIVRILVSVGVPLATGIASLHFFGVVKEKQLFDLPLWIPLVTTFLTFGLSAV  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +SSSWD  ++GSLLG+ EA+
Sbjct  143  GIAYGSLSSSWDAEKQGSLLGFEEAK  168



>ref|XP_010537142.1| PREDICTED: uncharacterized protein PAM68-like [Tarenaya hassleriana]
Length=172

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE V ++MM R+ +SVG PL +G+        +K     DVP W+PF  + + FG + L
Sbjct  77   IPEEVFHKMMVRIVVSVGTPLAVGVAILKILGAMKDRNVWDVPMWVPFSTTLVTFGASAL  136

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S DP R+GSLLG +EA+
Sbjct  137  GIAYGSLSTSLDPNRKGSLLGLDEAK  162



>ref|XP_009377566.1| PREDICTED: uncharacterized protein PAM68-like [Pyrus x bretschneideri]
Length=184

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V  RM+ R+  +VG+PL  G  F   F  +K     DVP W+PF+ + + FG + L
Sbjct  81   VPQVVFERMLVRIIAAVGLPLATGFAFLKVFDAVKEKHLWDVPLWLPFLTTLLTFGASAL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG  EAQ
Sbjct  141  GIAYGALSTSWDAEKKGSVLGLEEAQ  166



>ref|XP_009375538.1| PREDICTED: uncharacterized protein PAM68-like [Pyrus x bretschneideri]
Length=184

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V  RM+ R+  +VG+PL  G  F   F  +K     DVP W+PF+ + + FG + L
Sbjct  81   VPQVVFERMLVRIIAAVGLPLAAGFAFLKVFDAVKEKHLWDVPLWLPFLTTLLTFGASAL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG  EAQ
Sbjct  141  GIAYGALSTSWDAEKKGSVLGLEEAQ  166



>ref|XP_008354247.1| PREDICTED: uncharacterized protein PAM68-like [Malus domestica]
 ref|XP_008362785.1| PREDICTED: uncharacterized protein PAM68-like [Malus domestica]
Length=184

 Score = 62.8 bits (151),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V  RM+ R+  +VG+PL  G  F   F  +K     DVP W+PF+ + + FG + L
Sbjct  81   VPQVVFERMLVRIIAAVGLPLATGFAFLKVFDAVKEKHLWDVPLWLPFLTTLLTFGASAL  140

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG  EAQ
Sbjct  141  GIAYGALSTSWDAEKKGSVLGLEEAQ  166



>ref|XP_009770565.1| PREDICTED: uncharacterized protein PAM68-like [Nicotiana sylvestris]
Length=191

 Score = 62.4 bits (150),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V  R++ RM   VG P+  G+        +K     DVP W+PF+ +FI FG + L
Sbjct  88   IPSAVWERIIGRMLFYVGAPMVGGVALLQVLDIVKQQQLWDVPVWLPFLTTFITFGASTL  147

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  +EG+ LG  +AQ
Sbjct  148  GIAYGTLSASWDSEKEGTFLGLEQAQ  173



>ref|XP_008234831.1| PREDICTED: uncharacterized protein PAM68-like [Prunus mume]
Length=184

 Score = 62.0 bits (149),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RM+ R+  SVG+P+ +G  F   F  +K     DVP W+PF+ + + FG++ L
Sbjct  79   IPQAVFERMLVRIVASVGLPMAMGFAFLNVFEVIKEKHLWDVPLWLPFLTTLLTFGSSTL  138

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  ++GS+LG+ E Q
Sbjct  139  GIAYGALSTSWDAEKKGSILGFEEVQ  164



>ref|NP_001065153.1| Os10g0533100 [Oryza sativa Japonica Group]
 gb|AAM88633.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP54787.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF27067.1| Os10g0533100 [Oryza sativa Japonica Group]
 gb|EEC67355.1| hypothetical protein OsI_34450 [Oryza sativa Indica Group]
 gb|EEE51306.1| hypothetical protein OsJ_32262 [Oryza sativa Japonica Group]
Length=221

 Score = 62.0 bits (149),  Expect = 7e-09, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V +R++ R+   VG+P+  G+     +  L+ G  + VP+W+P +   + FGT+ L
Sbjct  118  LPQPVFDRILRRIMFMVGVPMASGVGLLNLYGALERGRGVAVPSWLPLLTILVAFGTSAL  177

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G+++G +S+SWDP +EGSLLG  EA+
Sbjct  178  GIAFGTLSASWDPEKEGSLLGLEEAR  203



>ref|XP_009621677.1| PREDICTED: uncharacterized protein PAM68-like [Nicotiana tomentosiformis]
Length=194

 Score = 61.6 bits (148),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 50/86 (58%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V  R++ RM   VG P+  G+        +K     DVP W+PF+ + I FG + L
Sbjct  88   IPSTVWERIIGRMLFYVGAPMVGGVALLQVLDIVKQQQLWDVPVWLPFLTTLITFGASTL  147

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SWD  +EGS LG  +AQ
Sbjct  148  GIAYGTLSASWDAEKEGSFLGLEQAQ  173



>ref|WP_015195444.1| hypothetical protein [Stanieria cyanosphaera]
 gb|AFZ37790.1| hypothetical protein Sta7437_4321 [Stanieria cyanosphaera PCC 
7437]
Length=155

 Score = 60.8 bits (146),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G IP  V+ RM  RM +   +P  +G+L F  FY +K    +++P+++P IVS  FFG  
Sbjct  48   GAIPNAVSKRMARRMAMFCTVPTGLGMLSFVLFYVVKTNDLLELPSFVPLIVSISFFGIG  107

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNE  517
            ++G+SYGI+S+SWD  R G+ LG  E
Sbjct  108  MIGLSYGILSASWDEKRTGTWLGIEE  133



>ref|XP_006362662.1| PREDICTED: uncharacterized protein PAM68-like [Solanum tuberosum]
Length=182

 Score = 61.2 bits (147),  Expect = 8e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  383  IDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +D+P W+PF+ +FI FG + LG +YG +S+SWDP ++GS +G  EAQ
Sbjct  114  LDLPIWLPFLTTFITFGASALGAAYGTLSASWDPEKQGSFIGLEEAQ  160



>ref|XP_004234285.1| PREDICTED: uncharacterized protein PAM68-like [Solanum lycopersicum]
Length=185

 Score = 61.2 bits (147),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +2

Query  383  IDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +D+P W+PF+ +FI FG + LG +YG +S+SWDP ++GS +G  EAQ
Sbjct  117  LDLPIWLPFLTTFITFGASALGAAYGTLSASWDPEKQGSFIGLEEAQ  163



>ref|XP_011076476.1| PREDICTED: uncharacterized protein PAM68-like [Sesamum indicum]
Length=173

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 41/81 (51%), Positives = 54/81 (67%), Gaps = 0/81 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V  RM+SR+  SVG+PL IG  F   F  LK     DVP W+PF+ +FI FG++ L
Sbjct  73   IPEVVWERMISRILFSVGVPLGIGFAFLQAFGVLKEQELWDVPKWLPFLTTFITFGSSAL  132

Query  446  GVSYGIVSSSWDPMREGSLLG  508
            G++YG +S+S D   EGS LG
Sbjct  133  GIAYGSLSTSLDAEEEGSFLG  153



>ref|XP_002513644.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF49047.1| conserved hypothetical protein [Ricinus communis]
Length=183

 Score = 59.7 bits (143),  Expect = 3e-08, Method: Compositional matrix adjust.
 Identities = 39/86 (45%), Positives = 60/86 (70%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V NR++ R+ +SVG+P+ +GL F  FF  ++     DVP WI F  +F+ FGT+ L
Sbjct  84   LPKEVVNRVIKRILVSVGVPMALGLAFLKFFGSVREQGIWDVPVWIVFATTFLTFGTSAL  143

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S DP ++GSLLG+ E Q
Sbjct  144  GIAYGALSASLDPNKKGSLLGFEEVQ  169



>ref|XP_010105738.1| hypothetical protein L484_014227 [Morus notabilis]
 gb|EXC05958.1| hypothetical protein L484_014227 [Morus notabilis]
Length=185

 Score = 58.9 bits (141),  Expect = 6e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V  RMM R+ +SVG+PL  GL    FF  +K     D+P W+P + +F  F  + L
Sbjct  84   IPQVVFERMMVRIAVSVGVPLAGGLAALKFFDVVKERHLWDIPMWLPLLTAFFMFSVSAL  143

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++Y  +S+SWD  + GS LG  E Q
Sbjct  144  GLAYAALSTSWDAEKRGSFLGLEEVQ  169



>gb|EYU25152.1| hypothetical protein MIMGU_mgv1a014448mg [Erythranthe guttata]
Length=189

 Score = 58.9 bits (141),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V +RM+SR+ + VG+PL  G      F  LK    ++VP W+PF+ +F+ FG + L
Sbjct  89   IPDVVWDRMISRILVYVGVPLAAGFFMLQVFSVLKEQGSVNVPKWVPFVTTFVTFGASAL  148

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            GV+YG +S+S     EGSLLG+ + +
Sbjct  149  GVAYGSLSTSLSADEEGSLLGFEQVE  174



>ref|XP_003062717.1| predicted protein, partial [Micromonas pusilla CCMP1545]
 gb|EEH53536.1| predicted protein, partial [Micromonas pusilla CCMP1545]
Length=122

 Score = 57.8 bits (138),  Expect = 7e-08, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++VT+RM+ R+ +  G+PL +G    P FY  KV   +DV  W  F+ S + FG AL+
Sbjct  21   IPQVVTDRMLKRISIFSGVPLLLGFSTGPIFYGAKVFAHLDVAPWQFFLASTLTFGGALV  80

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG++S+SW+P REG+  G  E +
Sbjct  81   GITYGVLSASWEPGREGTFWGGAEIK  106



>ref|WP_016859898.1| hypothetical protein [Fischerella muscicola]
Length=154

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RMM R+    GIP  +G++     Y+L     I +P     +V+  FFG  +L
Sbjct  50   IPQVVSQRMMRRVAGFAGIPTSLGIMTLVVSYFLVTNTNIKLPPVAVLLVNMGFFGLGVL  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD  R GSLLGWN+
Sbjct  110  GISYGVLSASWDEDRTGSLLGWND  133



>ref|WP_006103587.1| hypothetical protein [Coleofasciculus chthonoplastes]
 gb|EDX73138.1| hypothetical protein MC7420_4385 [Coleofasciculus chthonoplastes 
PCC 7420]
Length=158

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V+ RM+ RM L  GIP  +G+L F   Y   V L+I++P     +VS  FFG  +L
Sbjct  54   IPDQVSKRMVRRMALLCGIPTALGMLSFVVSYLAVVNLEIELPNVAVVLVSMGFFGLGVL  113

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SW+    G+LLGW E
Sbjct  114  GLTYGVLSASWEEDSPGTLLGWQE  137



>ref|WP_017309569.1| MULTISPECIES: hypothetical protein [Stigonematales]
 gb|KIY15135.1| hypothetical protein SP67_00745 [Mastigocladus laminosus UU774]
Length=154

 Score = 57.4 bits (137),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RMM R+    G+P  +G++     Y+L     I +P     +V+  FFG  +L
Sbjct  50   IPQVVSQRMMRRVAGFAGVPTSLGIMTLVVSYFLLTNTDIKLPPVAVLLVNMGFFGLGVL  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD  R GSLLGWN+
Sbjct  110  GISYGVLSASWDEDRTGSLLGWND  133



>gb|KEH26295.1| transmembrane protein, putative [Medicago truncatula]
Length=183

 Score = 57.8 bits (138),  Expect = 1e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  386  DVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            + P W+PF+ + +FFG + LG++YG++S+S D  REGSLLG+ E +
Sbjct  123  NAPLWMPFVTTLVFFGASGLGIAYGVLSTSLDAEREGSLLGFEEVE  168



>ref|XP_004515985.1| PREDICTED: uncharacterized protein PAM68-like [Cicer arietinum]
Length=176

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V  R++ R+  SV +P+ +GL     +  LK     + P WIPF+ + I FG + L
Sbjct  78   IPKVVMYRIIGRILFSVIVPMALGLSILHLYGELKDRQIWNAPLWIPFLTTLITFGASAL  137

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG++S+S D  REGSL G  E +
Sbjct  138  GIAYGVLSTSLDAEREGSLFGLQEVE  163



>gb|AFK33720.1| unknown [Medicago truncatula]
Length=183

 Score = 57.4 bits (137),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 22/46 (48%), Positives = 35/46 (76%), Gaps = 0/46 (0%)
 Frame = +2

Query  386  DVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            + P W+PF+ + +FFG + LG++YG++S+S D  REGSLLG+ E +
Sbjct  123  NAPLWMPFVTTLVFFGASGLGIAYGVLSTSLDAEREGSLLGFEEVE  168



>emb|CDY49826.1| BnaCnng18230D [Brassica napus]
Length=158

 Score = 57.0 bits (136),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RMM R+ +SVG PL +G+        LK     DVP W+PF+ + + FG + L
Sbjct  62   IPQEVFERMMGRIVVSVGTPLGLGVAVLKLLDILKDKNVWDVPLWVPFLTTLVTFGASAL  121

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S++ DP +  SL G  EA+
Sbjct  122  GIAYGSLSTNLDPTKTNSLFGLEEAK  147



>ref|WP_026731449.1| hypothetical protein [Fischerella sp. PCC 9605]
Length=154

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +2

Query  266  IPEIVTNRMMSRM-GLS-VgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            IP++V+ RMM R+ G S V   L I  L   +    + G+K+  P     +V+  FFG  
Sbjct  51   IPQVVSQRMMRRVAGFSGVPTSLGILTLIASYLLLTQAGIKL--PPVAVLLVNMGFFGLG  108

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNE  517
            +LG+SYG +S+SWD  R G+LLGWNE
Sbjct  109  VLGISYGALSASWDEERTGTLLGWNE  134



>ref|XP_006661996.1| PREDICTED: protein PAM68, chloroplastic-like [Oryza brachyantha]
Length=221

 Score = 57.8 bits (138),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 23/47 (49%), Positives = 34/47 (72%), Gaps = 0/47 (0%)
 Frame = +2

Query  383  IDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            + VP W+P +     FGT+ LG+++G +S+SWDP +EGSLLG  EA+
Sbjct  157  VAVPFWLPLLTILFAFGTSALGIAFGTLSASWDPEKEGSLLGLEEAR  203



>ref|WP_026723123.1| hypothetical protein [Fischerella sp. PCC 9431]
Length=154

 Score = 56.6 bits (135),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RMM R+    G+P  +G++     Y+L     I +P     +V+  FFG  +L
Sbjct  50   IPQVVSQRMMRRVAGFAGVPTSLGIMTLVVSYFLLTNTNIKLPPVAVLLVNMGFFGLGVL  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD  R G+LLGWN+
Sbjct  110  GISYGVLSASWDEDRTGTLLGWND  133



>ref|WP_015135349.1| hypothetical protein [Leptolyngbya sp. PCC 7376]
 gb|AFY39608.1| hypothetical protein Lepto7376_3401 [Leptolyngbya sp. PCC 7376]
Length=161

 Score = 56.6 bits (135),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 55/86 (64%), Gaps = 0/86 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
            G IPE V+ RM+ RM    GIP  +G+  F   YY+ +   I++P+    +VS  FFG  
Sbjct  53   GAIPEAVSKRMIRRMAFFSGIPTALGISSFVISYYIVINEIIELPSVAVLLVSLGFFGLG  112

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNE  517
            ++G+SYG++S+SWD  R GSLLG +E
Sbjct  113  VIGLSYGLLSTSWDEERTGSLLGSDE  138



>ref|WP_011610060.1| hypothetical protein [Trichodesmium erythraeum]
 gb|ABG49662.1| conserved hypothetical protein [Trichodesmium erythraeum IMS101]
Length=157

 Score = 56.2 bits (134),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 40/86 (47%), Positives = 57/86 (66%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPEIV+ RM+SRM L  G PL + LL F F Y++ +     +P  +  +VS  FFG +++
Sbjct  55   IPEIVSRRMISRMVLLSGTPLLLALLTFVFGYFIIINDLFTLPNQVILLVSISFFGLSVI  114

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G+SYGI S+SWD  ++GSLLG  E +
Sbjct  115  GLSYGIFSASWDEDKKGSLLGLQELK  140



>ref|WP_009460041.1| MULTISPECIES: hypothetical protein [Fischerella]
 gb|EHC08557.1| hypothetical protein FJSC11DRAFT_4424 [Fischerella sp. JSC-11]
Length=154

 Score = 55.8 bits (133),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RMM R+    G+P  +G++     Y+L V   I +P     +V+  FFG  +L
Sbjct  50   IPQVVSQRMMRRIAGFAGVPTSLGIMTLVVSYFLLVNTDIKLPPVAVLLVNMGFFGLGVL  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD  R G+LLGW++
Sbjct  110  GISYGVLSASWDEDRAGTLLGWSD  133



>ref|XP_010482653.1| PREDICTED: uncharacterized protein PAM68-like [Camelina sativa]
Length=168

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RMM R+ +SVG PL +G+        +K     DVP W+PF+ + + FG++ L
Sbjct  73   IPQEVFERMMGRIVVSVGTPLGLGVAILKILEVVKDRHVWDVPLWVPFLTTLVTFGSSAL  132

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S++ DP +  S+ G  EA+
Sbjct  133  GIAYGSLSTNLDPTKTNSVFGLKEAK  158



>gb|AFK39959.1| unknown [Lotus japonicus]
Length=187

 Score = 56.2 bits (134),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P +V  R++ R+  SVG+PL +GL     +  LK     D P WIPF  + + FG + L
Sbjct  83   LPRVVLYRIIGRILFSVGVPLVLGLALLDLYGELKDRGIWDAPLWIPFTTTLLTFGASTL  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S D  REG+ LG NE Q
Sbjct  143  GIAYGTLSASLDAEREGTFLGLNEVQ  168



>ref|XP_010445240.1| PREDICTED: uncharacterized protein PAM68-like [Camelina sativa]
Length=168

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RMM R+ +SVG PL +G+        +K     DVP W+PF+ + + FG++ L
Sbjct  73   IPQEVFERMMGRIVVSVGTPLGLGVAILKILEVVKDRHVWDVPLWVPFLTTLVTFGSSAL  132

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S++ DP +  S+ G  EA+
Sbjct  133  GIAYGSLSTNLDPTKTNSVFGLKEAK  158



>ref|XP_010442822.1| PREDICTED: uncharacterized protein PAM68-like [Camelina sativa]
Length=168

 Score = 55.8 bits (133),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP+ V  RMM R+ +SVG PL +G+        +K     DVP W+PF+ + + FG++ L
Sbjct  73   IPQEVFERMMGRIVVSVGTPLGLGVAILKILEVVKDRHVWDVPLWVPFLTTLVTFGSSAL  132

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S++ DP +  S+ G  EA+
Sbjct  133  GIAYGSLSTNLDPTKTNSVFGLKEAK  158



>ref|WP_041781285.1| hypothetical protein [Microcoleus sp. PCC 7113]
Length=143

 Score = 55.1 bits (131),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGL--SVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP++V+ RM  RM L   +   L I   F  +    +VGLK+  P  +  +VS  FFG 
Sbjct  40   AIPDVVSKRMARRMALLCGIPSVLGIVTFFASYVLVTQVGLKL--PNVVVVLVSMGFFGL  97

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             +LG+SYG++S+SWD    G+ LGW E
Sbjct  98   GVLGLSYGVLSASWDEDVPGTTLGWQE  124



>ref|WP_015205051.1| hypothetical protein [Crinalium epipsammum]
 gb|AFZ14955.1| hypothetical protein Cri9333_4161 [Crinalium epipsammum PCC 9333]
Length=160

 Score = 55.5 bits (132),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
              +P +V+NRM+ R+    G+P  +G+L F   Y +      ++P     I+S  FFG  
Sbjct  53   AAVPTVVSNRMIRRVAFFSGLPTAMGMLTFIISYLIVSKEWFNLPNVAVVIISISFFGLG  112

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNE  517
            +LG+SYG++S+SWD  R G+LLGWNE
Sbjct  113  VLGLSYGVLSASWDEERAGNLLGWNE  138



>gb|AFZ21030.1| Protein of unknown function (DUF3464) [Microcoleus sp. PCC 7113]
Length=169

 Score = 55.1 bits (131),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 50/87 (57%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGL--SVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP++V+ RM  RM L   +   L I   F  +    +VGLK+  P  +  +VS  FFG 
Sbjct  66   AIPDVVSKRMARRMALLCGIPSVLGIVTFFASYVLVTQVGLKL--PNVVVVLVSMGFFGL  123

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             +LG+SYG++S+SWD    G+ LGW E
Sbjct  124  GVLGLSYGVLSASWDEDVPGTTLGWQE  150



>ref|WP_016865287.1| hypothetical protein [Fischerella muscicola]
Length=154

 Score = 54.7 bits (130),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RMM R+    G+P  +G++     Y+L V   I +P     +V+  FFG  +L
Sbjct  50   IPQVVSQRMMRRVAGFAGVPTSLGIMTLVVSYFLLVNTGIKLPPVAVLLVNMGFFGLGVL  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD  R G+LLGW++
Sbjct  110  GISYGVLSASWDEDRTGTLLGWSD  133



>gb|AFG45582.1| hypothetical protein 0_18478_02, partial [Pinus taeda]
Length=45

 Score = 52.8 bits (125),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 23/27 (85%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +2

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYGIVSSSWDP+REGS LGW EAQ
Sbjct  2    LGISYGIVSSSWDPLREGSFLGWTEAQ  28



>emb|CAN77998.1| hypothetical protein VITISV_002983 [Vitis vinifera]
Length=591

 Score = 57.0 bits (136),  Expect = 2e-06, Method: Composition-based stats.
 Identities = 32/79 (41%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V +RM+ R+   VG P+ IG+     F  +K     DVP W+PF+ + I FG + L
Sbjct  84   IPQVVFDRMIVRILFFVGAPMGIGVALLNLFGAVKDQHLWDVPVWLPFLTTLIAFGASAL  143

Query  446  GVSYGIVSSSWDPMREGSL  502
            G++YG +S+SWD  ++G L
Sbjct  144  GIAYGTLSTSWDAEKKGVL  162



>ref|WP_024546344.1| hypothetical protein [Synechococcus sp. NKBG15041c]
Length=156

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIP+ V+ RM+ RM L  G+P  +G+  F   YY+     +++PT    +VS   FG  +
Sbjct  49   VIPDAVSKRMIRRMALFSGVPTALGISTFVVAYYVVSNQLLELPTVAVLLVSLGCFGIGV  108

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G+SYGI+S+SWD  R GS LGW E
Sbjct  109  VGLSYGILSTSWDENRVGSPLGWEE  133



>ref|WP_027840435.1| hypothetical protein [Mastigocoleus testarum]
Length=161

 Score = 54.3 bits (129),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ R+ +  G+P  +G+      Y L +   +++P     +V+  FFG  +L
Sbjct  58   IPKVVSQRMIRRVAVFCGVPTTLGISTLVASYLLLIYASVELPPLAVLLVNLGFFGLGVL  117

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R GSLLG++E
Sbjct  118  GITYGVLSASWDEHRAGSLLGFSE  141



>ref|WP_015151669.1| hypothetical protein [Oscillatoria acuminata]
 gb|AFY85060.1| Protein of unknown function (DUF3464) [Oscillatoria acuminata 
PCC 6304]
Length=155

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+SRM +  G+P  +G+  F   Y++  G    +P +   +VS   FG  +
Sbjct  51   AIPEVVSQRMVSRMAILCGVPTALGMFTFIASYFVITGDLFPLPNFAVVLVSMGCFGLGV  110

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G++YG++S+SWD    GSLLGW E
Sbjct  111  IGLTYGVLSASWDEEIPGSLLGWQE  135



>ref|WP_002763019.1| hypothetical protein [Microcystis aeruginosa]
 dbj|BAG00451.1| hypothetical protein MAE_06290 [Microcystis aeruginosa NIES-843]
 emb|CCH99593.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9717]
 emb|CCI21142.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9809]
Length=154

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM  RM +  G+P  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQVVSQRMAKRMAVFCGLPTALGIASFFGFYWIISHDLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_009786687.1| hypothetical protein [Lyngbya sp. PCC 8106]
 gb|EAW34812.1| hypothetical protein L8106_26357 [Lyngbya sp. PCC 8106]
Length=174

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+SRM L  G+PLF+ +  F   Y++ V     +P    F+ S   FG ++
Sbjct  65   TIPEVVSQRMLSRMALLSGVPLFMAISIFVGSYFIIVNEVFVLPNTAVFLASLGCFGLSV  124

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYGI S+SWD  + GS++GW E
Sbjct  125  LGLSYGIFSTSWDEDQTGSIVGWQE  149



>ref|WP_023064930.1| hypothetical protein [Lyngbya aestuarii]
 gb|ERT08837.1| hypothetical protein M595_1205 [Lyngbya aestuarii BL J]
Length=174

 Score = 53.9 bits (128),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+SRM +  G+PLF+ +  F   Y++ V     +P    F+ S   FG ++
Sbjct  65   AIPEVVSQRMLSRMAILSGVPLFMAISIFVGSYFIIVNEVFILPNTAVFLASLGCFGLSV  124

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYGI S+SWD  + GSL+GW E
Sbjct  125  LGLSYGIFSTSWDEDQTGSLVGWQE  149



>ref|WP_026101482.1| hypothetical protein [cyanobacterium PCC 7702]
Length=156

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGL--SVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP++V+ RM+ R+     V   L I  L   +      G+++  P     +V+  FFG 
Sbjct  52   AIPQVVSQRMIRRIAAFSGVPTALGISCLIVSYLLLKYTGIRL--PPVAVLLVNMAFFGM  109

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             +LG+SYG +S+ WD  R G+LLGWNE
Sbjct  110  GVLGISYGALSACWDEQRVGTLLGWNE  136



>ref|WP_002804136.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI38255.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9701]
Length=154

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 34/87 (39%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM  RM +  G+P  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQVVSQRMAKRMAVFCGLPTALGITSFFGFYWIISHDLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_002785112.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI14443.1| conserved hypothetical protein [Microcystis aeruginosa PCC 9806]
Length=154

 Score = 53.5 bits (127),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQVVSQRMAKRMAVFCGIPTALGITSFFGFYWIISHDLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_017744403.1| hypothetical protein [Scytonema hofmanni]
Length=160

 Score = 53.5 bits (127),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMG--LSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP+IV+ RM+ R+     V   L IG L   +      G+K+  P     +V   FFG 
Sbjct  51   AIPQIVSQRMIRRVASFCGVPTALGIGTLIASYLLLTYAGIKL--PPIAVLLVDMGFFGL  108

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             +LG++YG++S+SWD  R G LLGWNE
Sbjct  109  GVLGITYGVLSASWDEDRVGGLLGWNE  135



>ref|WP_041032249.1| hypothetical protein [Tolypothrix campylonemoides]
 gb|KIJ79578.1| hypothetical protein SD81_01240 [Tolypothrix campylonemoides 
VB511288]
Length=155

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 23/45 (51%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  383  IDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNE  517
            I +P     +V+  FFG  +LG++YG++S+SWD  R GSLLGWNE
Sbjct  91   IKLPPIAVLLVNMGFFGLGVLGITYGVLSASWDEDRVGSLLGWNE  135



>ref|XP_002865928.1| hypothetical protein ARALYDRAFT_495341 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH42187.1| hypothetical protein ARALYDRAFT_495341 [Arabidopsis lyrata subsp. 
lyrata]
Length=166

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  278  VTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSY  457
            V  RMM R+ +SVG PL +G+        LK     DVP W+PF+ + + FG++ LG++Y
Sbjct  76   VFERMMGRIVVSVGTPLGLGVAILKILEVLKDRKVWDVPLWVPFLTTLVTFGSSALGIAY  135

Query  458  GIVSSSWDPMREGSLLGWNEAQ  523
            G +S++ DP +  SL G  EA+
Sbjct  136  GSLSTNLDPTKTNSLFGLKEAK  157



>ref|WP_002788032.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI18099.1| Similar to tr|P72865|P72865 [Microcystis aeruginosa PCC 9807]
Length=154

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 53/87 (61%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQVVSQRMAKRMAVFCGIPTVLGITSFFGFYWIISHNLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_012307435.1| hypothetical protein [Synechococcus sp. PCC 7002]
 gb|ABV80283.1| hypothetical ABC-type Co2+ transport system permease component 
[Synechococcus sp. PCC 7002]
 gb|ACA99812.1| conserved hypothetical protein [Synechococcus sp. PCC 7002]
Length=159

 Score = 53.1 bits (126),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM+ RM L  GIP  +G+  F   YY+     +++PT    +VS   FG  +
Sbjct  52   AIPDAVSKRMIRRMALFSGIPTALGITSFVVSYYIVSRELLELPTIAVLLVSLGCFGLGV  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G+SYGI+S+SWD  R GSL GW E
Sbjct  112  VGLSYGILSTSWDENRPGSLFGWEE  136



>ref|XP_007513904.1| predicted protein [Bathycoccus prasinos]
 emb|CCO15341.1| predicted protein [Bathycoccus prasinos]
Length=267

 Score = 54.7 bits (130),  Expect = 5e-06, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +2

Query  263  VIPEIVTNRMMSRM-GLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTA  439
             +P+IVT+RM+SR+   S    +        ++Y+ K+  +  +  W+ F  S   FG A
Sbjct  148  AVPQIVTDRMLSRVVRFSGIPMVLGFTTGPTYYYFAKINTQEWLEPWMFFAASTATFGLA  207

Query  440  LLGVSYGIVSSSWDPMREGSLLGWNE  517
             +G++YG++S+SWDP REGS LG +E
Sbjct  208  FVGITYGVLSASWDPSREGSALGVDE  233



>gb|AFG45583.1| hypothetical protein 0_18478_02, partial [Pinus taeda]
Length=45

 Score = 50.8 bits (120),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 22/27 (81%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +2

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYGIVSSSWDP+REGS LGW E Q
Sbjct  2    LGISYGIVSSSWDPLREGSFLGWTETQ  28



>ref|WP_015127369.1| hypothetical protein [Calothrix sp. PCC 7507]
 gb|AFY31547.1| hypothetical protein Cal7507_1071 [Calothrix sp. PCC 7507]
Length=156

 Score = 52.8 bits (125),  Expect = 6e-06, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ R+    GIP  +G+      Y L V   I +P     +V+  FFG  +L
Sbjct  53   IPQVVSQRMVRRVAGFCGIPTALGITTLVTSYLLAVNTDIKLPPVAVLLVNMGFFGLGVL  112

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R GSLLG +E
Sbjct  113  GITYGVLSASWDEERAGSLLGLSE  136



>ref|WP_022607303.1| protein of unknown function (DUF3464) [Rubidibacter lacunae]
 gb|ERN41227.1| protein of unknown function (DUF3464) [Rubidibacter lacunae KORDI 
51-2]
Length=170

 Score = 53.1 bits (126),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/85 (42%), Positives = 54/85 (64%), Gaps = 1/85 (1%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE V+ RM+ RMGL  G+P  +G+  F   Y +      ++P++   +VS   FG  +
Sbjct  62   AIPEAVSQRMLRRMGLLSGLPTGLGIASFLVSYLIVSNHWFELPSYAVLLVSMGLFGIGV  121

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYGI+S+SW+  + GSL+GWNE
Sbjct  122  LGLSYGILSASWEE-QPGSLVGWNE  145



>ref|WP_015124492.1| hypothetical protein [Synechococcus sp. PCC 6312]
 gb|AFY60949.1| Protein of unknown function (DUF3464) [Synechococcus sp. PCC 
6312]
Length=161

 Score = 52.8 bits (125),  Expect = 7e-06, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 53/84 (63%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+NRM +RM +  G+P  +GLL FP  Y +      ++P     +VS   FG  +L
Sbjct  59   IPEVVSNRMATRMAVCCGVPSLLGLLTFPLCYVIVKQELFELPNVAVVLVSMGCFGLGVL  118

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SW+    GS LGW+E
Sbjct  119  GLSYGVISASWEEEVPGSFLGWSE  142



>ref|WP_015171680.1| hypothetical protein [Geitlerinema sp. PCC 7407]
 gb|AFY66113.1| hypothetical protein GEI7407_1622 [Geitlerinema sp. PCC 7407]
Length=163

 Score = 52.8 bits (125),  Expect = 8e-06, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 55/84 (65%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE V+ RM+ RMGL  G+PLF G+  F   Y++ +G    +PT    +VS  FFG ++L
Sbjct  58   IPEAVSKRMLQRMGLFSGVPLFFGIASFFVSYFIVIGDVFPMPTSAVVLVSMGFFGLSVL  117

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SW+    GS +GW E
Sbjct  118  GLSYGVLSASWEEEILGSKIGWEE  141



>ref|XP_009127218.1| PREDICTED: uncharacterized protein PAM68-like [Brassica rapa]
Length=169

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  278  VTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSY  457
            V  RMM R+ +SVG PL +G+        LK     DVP W+PF  + + FG + LG++Y
Sbjct  77   VFERMMGRIVVSVGTPLGLGVAVLKLLDILKDKNVWDVPLWVPFFTTLVTFGASALGIAY  136

Query  458  GIVSSSWDPMREGSLLGWNEAQ  523
            G +S++ DP +  SL G  EA+
Sbjct  137  GSLSTNLDPTKTNSLFGLEEAK  158



>emb|CDY27049.1| BnaA02g10690D [Brassica napus]
Length=169

 Score = 52.4 bits (124),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 48/82 (59%), Gaps = 0/82 (0%)
 Frame = +2

Query  278  VTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSY  457
            V  RMM R+ +SVG PL +G+        LK     DVP W+PF  + + FG + LG++Y
Sbjct  77   VFERMMGRIVVSVGTPLGLGVAVLKLLDILKDKNVWDVPLWVPFFTTLVTFGASALGIAY  136

Query  458  GIVSSSWDPMREGSLLGWNEAQ  523
            G +S++ DP +  SL G  EA+
Sbjct  137  GSLSTNLDPTKTNSLFGLEEAK  158



>ref|WP_030006377.1| hypothetical protein [Synechococcus sp. NKBG042902]
Length=159

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM+ RM L  GIP  +G+  F   YY+     +++PT    +VS   FG  +
Sbjct  52   AIPDAVSKRMIRRMALFSGIPTAMGITSFVVSYYIVSRELLELPTIAVLLVSLGCFGLGV  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G+SYGI+S+SWD  R GS LGW E
Sbjct  112  VGLSYGILSTSWDENRLGSRLGWEE  136



>ref|WP_036009074.1| hypothetical protein [Leptolyngbya sp. JSC-1]
Length=148

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 54/84 (64%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ R+ L  GIP  +G+  F   Y +     + +PT+   +VS ++FG  ++
Sbjct  46   IPEVVSRRMVKRVALFCGIPTALGMSTFIVSYLVVSNDWLQLPTYAVLLVSLLWFGLGVV  105

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            GVSYG++S+SWD    GS LG++E
Sbjct  106  GVSYGVLSASWDEDTAGSWLGFSE  129



>ref|WP_036616883.1| hypothetical protein, partial [Oscillatoriales cyanobacterium 
JSC-12]
Length=152

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +PEIV+ RM  RM    G+P  +G+L F   Y++       +PT +  + S  FFG  +L
Sbjct  49   VPEIVSKRMARRMAFFCGVPTGMGMLTFVVSYFIVSQHIYKLPTVVVLLTSLGFFGLGVL  108

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG +S+SWD  R GS  GW+E
Sbjct  109  GLSYGALSASWDEDRTGSWFGWSE  132



>ref|WP_002791710.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCI20793.1| Similar to tr|P72865|P72865 [Microcystis aeruginosa PCC 9808]
Length=154

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQAVSQRMAKRMAVFCGIPTVLGITSFFGFYWIISHNLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_017318522.1| hypothetical protein [Mastigocladopsis repens]
Length=155

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 31/87 (36%), Positives = 49/87 (56%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMG--LSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP++V+ RM+ R+     +   L I  L   +      G+K+  P     +++   FG 
Sbjct  50   AIPQVVSQRMIRRVAGFCGIPTALGISSLIVSYLLLTYTGIKL--PPIAVLLMNMGLFGL  107

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             +LG++YG++S+SWD  R GSLLGWNE
Sbjct  108  GVLGITYGVLSASWDEDRSGSLLGWNE  134



>ref|WP_002738795.1| hypothetical protein [Microcystis aeruginosa]
 emb|CCH94573.1| Similar to tr|P72865|P72865 [Microcystis aeruginosa PCC 9432]
 emb|CCI02883.1| Similar to tr|P72865|P72865 [Microcystis aeruginosa PCC 9443]
 emb|CCI07330.1| Similar to tr|P72865|P72865 [Microcystis aeruginosa PCC 7941]
 gb|ELP52799.1| hypothetical protein O53_4527 [Microcystis aeruginosa TAIHU98]
 gb|EPF21665.1| hypothetical protein MAESPC_02489 [Microcystis aeruginosa SPC777]
 gb|EPF24790.1| hypothetical protein MAESPC_00237 [Microcystis aeruginosa SPC777]
 dbj|GAL94359.1| hypothetical protein N44_02939 [Microcystis aeruginosa NIES-44]
Length=154

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQAVSQRMAKRMAVFCGIPTVLGITSFFGFYWIISHNLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_008201436.1| hypothetical protein [Microcystis sp. T1-4]
 emb|CCI32376.1| Similar to tr|P72865|P72865 [Microcystis sp. T1-4]
Length=154

 Score = 51.6 bits (122),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQAVSQRMAKRMAVFCGIPTVLGITSFFGFYWIISHNLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|NP_200090.1| uncharacterized protein [Arabidopsis thaliana]
 sp|Q9LTD9.1|Y5278_ARATH RecName: Full=Uncharacterized protein PAM68-like [Arabidopsis 
thaliana]
 dbj|BAA98096.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM63676.1| unknown [Arabidopsis thaliana]
 gb|ABF58938.1| At5g52780 [Arabidopsis thaliana]
 dbj|BAF00797.1| hypothetical protein [Arabidopsis thaliana]
 gb|AED96259.1| uncharacterized protein AT5G52780 [Arabidopsis thaliana]
Length=168

 Score = 52.0 bits (123),  Expect = 1e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  278  VTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSY  457
            V  RMM R+ +SVG PL +G+        LK     DVP W+P++ + + FG++ LG++Y
Sbjct  76   VFERMMGRIVVSVGTPLGLGVAILKVLEVLKDRNVWDVPLWVPYLTTLVTFGSSALGIAY  135

Query  458  GIVSSSWDPMREGSLLGWNEAQ  523
            G +S++ DP +  SL G  EA+
Sbjct  136  GSLSTNLDPAKTNSLFGLKEAK  157



>ref|WP_002741884.1| hypothetical protein [Microcystis aeruginosa]
 emb|CAO86280.1| unnamed protein product [Microcystis aeruginosa PCC 7806]
 gb|ELS49296.1| hypothetical protein C789_912 [Microcystis aeruginosa DIANCHI905]
Length=154

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/87 (40%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM  RM +  GIP  +G+  F  FY++     +++P+++  +VS   FG   
Sbjct  48   AIPQAVSQRMAKRMAVFCGIPTVLGITSFFGFYWIISHNLLEIPSYVAMLVSLSLFGLGF  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            +G+SYGI S+SWD  R G  LGW E Q
Sbjct  108  IGLSYGIFSASWDEDRVGDWLGWQEFQ  134



>ref|WP_016875149.1| hypothetical protein [Chlorogloeopsis fritschii]
Length=155

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 31/85 (36%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+    G+P  +G+      Y L +   + +P     +V+  FFG  +
Sbjct  51   AIPQVVSQRMIRRVAGFCGVPTALGIGSLVCSYLLLIYAGVKLPPVAVLLVNMGFFGLGV  110

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG++S+SWD  R G+LLGW+E
Sbjct  111  LGITYGVLSASWDEDRVGTLLGWSE  135



>ref|XP_006281501.1| hypothetical protein CARUB_v10027596mg [Capsella rubella]
 gb|EOA14399.1| hypothetical protein CARUB_v10027596mg [Capsella rubella]
Length=168

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 32/82 (39%), Positives = 50/82 (61%), Gaps = 0/82 (0%)
 Frame = +2

Query  278  VTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALLGVSY  457
            V  RMM R+ +SVG PL +G+        LK     DVP W+PF+ + + FG++ LG++Y
Sbjct  77   VFERMMGRIVVSVGTPLGLGVAILKILEVLKDRNVWDVPLWVPFLTTLVTFGSSALGIAY  136

Query  458  GIVSSSWDPMREGSLLGWNEAQ  523
            G +S++ DP +  S+ G  EA+
Sbjct  137  GSLSTNLDPTKTNSVFGLKEAK  158



>ref|WP_012627065.1| hypothetical protein [Cyanothece sp. PCC 7425]
 gb|ACL43975.1| conserved hypothetical protein [Cyanothece sp. PCC 7425]
Length=166

 Score = 51.6 bits (122),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 39/87 (45%), Positives = 52/87 (60%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+ RM    GIP  +GL+ FP  Y +      ++P     +VS  FFG   
Sbjct  62   AIPEVVSQRMLRRMAYFCGIPTLLGLITFPLCYVVVSQSWFELPNAAVVLVSLGFFGLGA  121

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYGI+SSSWD  + G+ LGW E Q
Sbjct  122  LGLSYGILSSSWDEGQGGTRLGWQEFQ  148



>ref|WP_038027051.1| hypothetical protein, partial [Synechococcus sp. PCC 7336]
Length=128

 Score = 50.8 bits (120),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V+ RM+ R+    G+P  +GL  F   YYL V   +++P+W  F+ +   FG   +
Sbjct  18   IPPEVSQRMVRRVAWMAGVPSALGLSAFFINYYLLVEHILELPSWFTFVETLSLFGIGFV  77

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SW+P R GS LG+ E
Sbjct  78   GITYGVLSASWEPERAGSWLGFEE  101



>ref|WP_006633862.1| hypothetical protein [Microcoleus vaginatus]
 gb|EGK86870.1| hypothetical protein MicvaDRAFT_3661 [Microcoleus vaginatus FGP-2]
Length=157

 Score = 51.2 bits (121),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+SR+ +  GIP  +G+  F   Y +      D+P     +VS   FG  +L
Sbjct  55   IPEVVSQRMISRIAVFCGIPTMLGICTFFVSYLVVSKGLFDLPNTAVLLVSMGCFGLGVL  114

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD    GS LGW E
Sbjct  115  GLSYGVLSASWDEEISGSTLGWEE  138



>ref|XP_005536916.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
 dbj|BAM80880.1| hypothetical protein, conserved [Cyanidioschyzon merolae strain 
10D]
Length=244

 Score = 52.8 bits (125),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/44 (55%), Positives = 32/44 (73%), Gaps = 3/44 (7%)
 Frame = +2

Query  401  IPFIVSFI---FFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            IP +V +     FG +L G++YGI+S+SWD  R GSLLGW+EAQ
Sbjct  163  IPPVVGYATLGLFGVSLFGLTYGIMSASWDAGRRGSLLGWDEAQ  206



>ref|WP_015174481.1| hypothetical protein [Oscillatoria nigro-viridis]
 gb|AFZ05149.1| hypothetical protein Osc7112_0554 [Oscillatoria nigro-viridis 
PCC 7112]
Length=157

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+SR+ +  GIP  +G+  F   Y +      D+P     +VS   FG  +L
Sbjct  55   IPEVVSQRMISRIAVFCGIPTILGISTFFVSYLIVSKGLFDLPNTAVLLVSMGCFGLGVL  114

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD    GS LGW E
Sbjct  115  GLSYGVLSASWDEEVSGSTLGWEE  138



>gb|EKQ68405.1| UDP-N-acetylmuramyl pentapeptide phosphotransferase/UDP-N-acetylglucosamine-1-phosphate 
transferase [Oscillatoriales cyanobacterium 
JSC-12]
Length=178

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +PEIV+ RM  RM    G+P  +G+L F   Y++       +PT +  + S  FFG  +L
Sbjct  75   VPEIVSKRMARRMAFFCGVPTGMGMLTFVVSYFIVSQHIYKLPTVVVLLTSLGFFGLGVL  134

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG +S+SWD  R GS  GW+E
Sbjct  135  GLSYGALSASWDEDRTGSWFGWSE  158



>ref|NP_001239781.1| uncharacterized protein LOC100782877 [Glycine max]
 gb|ACU19597.1| unknown [Glycine max]
 gb|KHN09288.1| Hypothetical protein glysoja_029059 [Glycine soja]
Length=183

 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 52/86 (60%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P+ V  R++ R+  SVG+P+ +GL     F  LK     D P W+PF+ + + FG + L
Sbjct  83   LPQEVMYRLIGRILFSVGVPMGLGLALLGLFGELKEKHVWDAPLWLPFLTTLLTFGASSL  142

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+S D  +EGS LG  + Q
Sbjct  143  GIAYGALSTSLDAEKEGSFLGVEQLQ  168



>ref|XP_006401783.1| hypothetical protein EUTSA_v10014707mg [Eutrema salsugineum]
 gb|ESQ43236.1| hypothetical protein EUTSA_v10014707mg [Eutrema salsugineum]
Length=204

 Score = 51.6 bits (122),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 19/46 (41%), Positives = 32/46 (70%), Gaps = 0/46 (0%)
 Frame = +2

Query  386  DVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            DVP W+PF+ + + FG + LG++YG +S++ DP +  S+ G  EA+
Sbjct  148  DVPLWVPFLTTLVTFGASALGIAYGSLSTNLDPTKTNSVFGLEEAK  193



>ref|XP_002505889.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO67147.1| predicted protein [Micromonas sp. RCC299]
Length=249

 Score = 52.0 bits (123),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 36/86 (42%), Positives = 53/86 (62%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++VT+RM+ R+ +  G+PL +G    P FY  K     D+  W  F  S   FG AL+
Sbjct  134  IPQVVTDRMLKRITIFSGVPLLLGFSTGPLFYLGKTVAHFDLAPWQFFFASTATFGAALV  193

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG++S+SW+P REGS  G  E +
Sbjct  194  GITYGVLSASWEPGREGSFWGVTEVK  219



>ref|WP_007357191.1| MULTISPECIES: hypothetical protein [Kamptonema]
 emb|CBN58005.1| conserved hypothetical protein [ [[Oscillatoria] sp. PCC 6506]
Length=150

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ RM L  G+P   G+  F   Y +       +P     ++S  FFG  +L
Sbjct  48   IPDVVSKRMIRRMALLCGVPTAAGISTFIASYLVVSKGWFALPNSAVVLLSMGFFGLGVL  107

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD    GS++GW E
Sbjct  108  GLSYGVLSASWDEENPGSIIGWEE  131



>ref|WP_015216757.1| hypothetical protein [Anabaena cylindrica]
 gb|AFZ60141.1| hypothetical protein Anacy_4796 [Anabaena cylindrica PCC 7122]
Length=156

 Score = 50.1 bits (118),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 31/84 (37%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ R+    G+P  +G++     Y L +   I +P     +V+   FG  +L
Sbjct  53   IPEVVSQRMIRRVAAFCGVPTTLGIVSLVASYLLVIYAHIQLPPIAVLLVNMGLFGLGVL  112

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R G+LLG +E
Sbjct  113  GITYGVLSASWDEERPGNLLGLDE  136



>gb|KIJ81069.1| hypothetical protein SD80_25805 [Scytonema tolypothrichoides 
VB-61278]
Length=155

 Score = 50.1 bits (118),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+ +  GIP  +GL      Y L +   + +      +V+  FFG  +
Sbjct  51   AIPQVVSQRMIRRVAVFCGIPTALGLSTLIASYLLLIYAGVKLTPIAVLLVNMGFFGLGV  110

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG++S+SWD  R G  LGWNE
Sbjct  111  LGITYGVLSASWDEHRVGGWLGWNE  135



>ref|WP_015118841.1| hypothetical protein [Rivularia sp. PCC 7116]
 gb|AFY55271.1| Protein of unknown function (DUF3464) [Rivularia sp. PCC 7116]
Length=155

 Score = 49.7 bits (117),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 52/84 (62%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ R+    G+P  +G+L     Y L +   I  P  +  +V+   FG  +L
Sbjct  52   IPQVVSQRMVRRVAWLCGVPTILGILTLVVSYLLIIYADIKFPPLLVLLVNMGLFGLGVL  111

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SW+  R G+L+GW+E
Sbjct  112  GITYGVLSASWEEQRVGTLIGWSE  135



>ref|WP_015198544.1| hypothetical protein [Calothrix parietina]
 gb|AFZ01914.1| hypothetical protein Cal6303_2965 [Calothrix sp. PCC 6303]
Length=160

 Score = 49.7 bits (117),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+    GIP F+G+      Y L     I +P     +V+  FFG  +
Sbjct  53   AIPKVVSQRMIRRVAAFCGIPTFLGITTLVVSYLLVSFAHIKLPPIAVLLVNMGFFGLGV  112

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG +S+SWD  R G+ LGWNE
Sbjct  113  LGITYGTLSASWDEDRTGTWLGWNE  137



>ref|WP_028947886.1| hypothetical protein [Synechocystis sp. PCC 6714]
 gb|AIE74640.1| ABC-type Co2+ transport system, permease component [Synechocystis 
sp. PCC 6714]
Length=158

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 55/84 (65%), Gaps = 1/84 (1%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP +V+ RM+ RM L  GIP  +G+L F  FY +      ++PT++ F VS +FFG  ++
Sbjct  51   IPAVVSQRMVKRMALFSGIPTGLGMLSFVLFYLVVSRDWFEIPTYVVFAVSLLFFGLGVV  110

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYGI S+SW+    GS+ GW+E
Sbjct  111  GLSYGIFSTSWED-EPGSVWGWSE  133



>ref|WP_031291683.1| hypothetical protein [Leptolyngbya sp. Heron Island J]
Length=164

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ RM +  G+P  +G+  F   Y L     ++ P  +  +VS  FFG   +
Sbjct  58   IPEVVSRRMIRRMAVFAGVPTALGMSSFVIAYVLLSRHIVEFPNVLVLLVSLGFFGLGTV  117

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SW    EGSLLG +E
Sbjct  118  GLSYGVLSASWQEDLEGSLLGISE  141



>ref|WP_006517795.1| Protein of unknown function (DUF3464) [Leptolyngbya sp. PCC 7375]
 gb|EKV03430.1| Protein of unknown function (DUF3464) [Leptolyngbya sp. PCC 7375]
Length=166

 Score = 49.7 bits (117),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ RM +  G+P  +G+  F   Y L     ++ P  +  IVS  FFG   +
Sbjct  61   IPEVVSRRMIRRMAVFAGVPTALGMSSFVIAYVLLTRHIVEFPNVVVLIVSLGFFGLGTI  120

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SW     GSLLG  E
Sbjct  121  GLSYGVLSASWQEDEAGSLLGIAE  144



>gb|EKD05861.1| hypothetical protein SPLC1_S580100 [Arthrospira platensis C1]
Length=109

 Score = 48.5 bits (114),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/84 (40%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+SRM +  GIPL + +  F   Y++       +P     +VS   FG +++
Sbjct  3    IPEVVSQRMVSRMVVLSGIPLLMAISTFVGSYFIVTNEIFPLPNTAVLLVSLGCFGLSVV  62

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD    GS LGW E
Sbjct  63   GLSYGVLSASWDENLSGSFLGWQE  86



>emb|CBN78153.1| all0748 [Ectocarpus siliculosus]
Length=323

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/100 (34%), Positives = 53/100 (53%), Gaps = 24/100 (24%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRM----------GLSVgiplfigllffpffyylKVGLKID--VPTWI  403
            G IPEIV+NRM+SRM          G+ V + +++            +  K D  +P +I
Sbjct  185  GSIPEIVSNRMLSRMVPFFVLPALGGVGVFVTVYV------------LSHKYDYTIPAYI  232

Query  404  PFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
                +   F  AL G++Y I+S+SWD  REG+  G++EA+
Sbjct  233  VAYATQAPFFVALAGITYAIMSASWDEDREGTFFGFDEAK  272



>ref|WP_008188495.1| hypothetical protein [Moorea producens]
 gb|EGJ29962.1| hypothetical protein LYNGBM3L_57430 [Moorea producens 3L]
Length=169

 Score = 49.3 bits (116),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ RMGL  GIP F+G++ F   Y L   + +++P     +VS   FG  +
Sbjct  66   AIPDVVSKRMVRRMGLMCGIPSFLGIVTFVVSYLLITQVGVELPHVAVILVSMGCFGLGV  125

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYG++S+SW+    G+  GW E
Sbjct  126  LGLSYGVLSASWEEDIPGTFFGWQE  150



>gb|KIE12240.1| hypothetical protein DA73_0211775 [Tolypothrix bouteillei VB521301]
Length=156

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 32/87 (37%), Positives = 48/87 (55%), Gaps = 4/87 (5%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMG--LSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGT  436
             IP+IV+ RM+ R+     +   L I  L   +      G+K+  P     +V+  FFG 
Sbjct  52   AIPQIVSQRMIRRVAGFCGIPTALGISTLVVSYLLLTYAGIKL--PPVAVLLVNMGFFGL  109

Query  437  ALLGVSYGIVSSSWDPMREGSLLGWNE  517
             ++G++YGI+S+SWD  R G LLG NE
Sbjct  110  GVVGLTYGILSASWDEERAGGLLGLNE  136



>ref|WP_018397062.1| hypothetical protein [filamentous cyanobacterium ESFC-1]
Length=154

 Score = 48.9 bits (115),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 54/85 (64%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM+ RM +  GIP  +G++    FY++     + +P +   +VS  FFG  +
Sbjct  50   AIPDAVSKRMIRRMAILCGIPTSLGVVSLLAFYWIVSQKILVIPPYAAVLVSSGFFGLGV  109

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYG+ S+SWD  R G+LLG++E
Sbjct  110  LGLSYGLFSASWDEERIGNLLGFDE  134



>ref|WP_011244110.1| MULTISPECIES: hypothetical protein [Synechococcus]
 dbj|BAD79990.1| hypothetical protein [Synechococcus elongatus PCC 6301]
 gb|ABB58330.1| conserved hypothetical protein [Synechococcus elongatus PCC 7942]
 gb|AJD57204.1| hypothetical protein M744_04800 [Synechococcus sp. UTEX 2973]
Length=164

 Score = 48.5 bits (114),  Expect = 2e-04, Method: Compositional matrix adjust.
 Identities = 21/45 (47%), Positives = 32/45 (71%), Gaps = 0/45 (0%)
 Frame = +2

Query  383  IDVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNE  517
            I +PT    + S   FG  +LG++YG++S+SWD  ++GSLLGW+E
Sbjct  94   IPLPTSAVVLASMGCFGLGVLGLTYGLLSASWDEQQDGSLLGWDE  138



>ref|WP_010994922.1| hypothetical protein [Nostoc sp. PCC 7120]
 dbj|BAB72705.1| all0748 [Nostoc sp. PCC 7120]
Length=156

 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+    GIP  +G+      Y L +   I +      +V+  FFG  +
Sbjct  52   AIPQVVSQRMIRRVAAFCGIPTALGITTLVSSYLLTIYSDIQLAPIAVLLVNMGFFGLGV  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG++S+SWD  R GSLLG  E
Sbjct  112  LGITYGVLSASWDEERTGSLLGLGE  136



>ref|WP_012165617.1| hypothetical protein [Acaryochloris marina]
 gb|ABW30377.1| conserved hypothetical protein [Acaryochloris marina MBIC11017]
Length=206

 Score = 49.3 bits (116),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIP++V+NRM+ R+G+  GIP  +  L  P  Y++     ++ P+ +   +S    G  L
Sbjct  63   VIPKVVSNRMLRRVGIFSGIPTLLAFLTIPASYFITEQGWVEFPSTVVLFISVTCLGLGL  122

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +GVSYGI+S+SWD   +GS LG +E
Sbjct  123  VGVSYGIISASWDEELKGSALGISE  147



>ref|WP_011321313.1| hypothetical protein [Anabaena variabilis]
 gb|ABA24247.1| conserved hypothetical protein [Anabaena variabilis ATCC 29413]
Length=156

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+    GIP  +G+      Y L +   I +      +V+  FFG  +
Sbjct  52   AIPQVVSQRMIRRVAAFCGIPTALGITTLVSSYLLTIYSDIQLAPIAVLLVNMGFFGLGV  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG++S+SWD  R GSLLG  E
Sbjct  112  LGITYGVLSASWDEERTGSLLGLGE  136



>ref|WP_006195035.1| hypothetical protein [Nodularia spumigena]
 gb|EAW46505.1| hypothetical protein N9414_00320 [Nodularia spumigena CCY9414]
 gb|AHJ30172.1| ABC-type Co2+ transport system, permease component [Nodularia 
spumigena CCY9414]
Length=155

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/84 (38%), Positives = 50/84 (60%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ R+    GIP  +G+      Y L +  +I +P     +V+   FG  +L
Sbjct  52   IPQVVSQRMIRRVAGFCGIPTALGITTLVVSYLLAMYSEIQLPPIAVLLVNMGLFGIGVL  111

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R GSLLG  E
Sbjct  112  GITYGVLSASWDEERAGSLLGLGE  135



>ref|WP_010478694.1| hypothetical protein [Acaryochloris sp. CCMEE 5410]
Length=206

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 53/85 (62%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
            VIP++V+NRM+ R+G+  GIP  +  L  P  Y++     ++ P+ +   +S    G  L
Sbjct  63   VIPKVVSNRMLRRVGIFSGIPTLLAFLTIPASYFITEQGWVEFPSTVVLFISVTCLGLGL  122

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +GVSYGI+S+SWD   +GS LG +E
Sbjct  123  VGVSYGIISASWDEELKGSALGISE  147



>ref|WP_015138656.1| hypothetical protein [Nostoc sp. PCC 7524]
 gb|AFY48214.1| Protein of unknown function (DUF3464) [Nostoc sp. PCC 7524]
Length=156

 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 32/85 (38%), Positives = 49/85 (58%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP++V+ RM+ R+    GIP  +G+      Y L     I +P     +V+   FG  +
Sbjct  52   AIPQVVSQRMIRRVAAFCGIPTALGISALVVSYLLATYSDIQLPPIAVLLVNMGLFGLGV  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG++YG++S+SWD  R GSLLG+ E
Sbjct  112  LGITYGVLSASWDEERVGSLLGFGE  136



>ref|WP_015167908.1| hypothetical protein [Synechococcus sp. PCC 7502]
 gb|AFY73249.1| Protein of unknown function (DUF3464) [Synechococcus sp. PCC 
7502]
Length=152

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 21/44 (48%), Positives = 28/44 (64%), Gaps = 0/44 (0%)
 Frame = +2

Query  386  DVPTWIPFIVSFIFFGTALLGVSYGIVSSSWDPMREGSLLGWNE  517
            D+P     +VS +F G  +LG+SYG +S+SWD  REG   GW E
Sbjct  83   DLPNSAVVLVSMLFLGIGVLGLSYGALSASWDENREGHWWGWQE  126



>ref|WP_016952466.1| hypothetical protein [Anabaena sp. PCC 7108]
Length=156

 Score = 48.1 bits (113),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ R+    GIP  +G++     Y L     I +P     +V+   FG  +L
Sbjct  53   IPEVVSQRMIRRVAAFCGIPTLLGIITLVASYLLITFADIQLPPIAVLLVNMGLFGLGVL  112

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R GSLLG  E
Sbjct  113  GITYGVLSASWDEERPGSLLGVGE  136



>gb|EMT23713.1| hypothetical protein F775_07395 [Aegilops tauschii]
Length=82

 Score = 46.6 bits (109),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  428  FGTALLGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            FGT+ LG++YG +S+SWDP +EGSLLG +EA+
Sbjct  35   FGTSALGIAYGTLSASWDPEKEGSLLGVDEAR  66



>ref|WP_036485392.1| hypothetical protein [Myxosarcina sp. GI1]
Length=158

 Score = 47.8 bits (112),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM  RM +  G+P F+G+     FY+L +   +D+P ++  +VSF F    +
Sbjct  52   AIPDSVSKRMARRMVVFCGVPSFLGMSSLFIFYWLSIKDIVDLPPYLALVVSFAFLVVGI  111

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
             G+SYGI S+SWD  R GSL+G  E
Sbjct  112  GGLSYGIFSASWDENRVGSLVGVGE  136



>ref|WP_036843652.1| MULTISPECIES: hypothetical protein, partial [Planktothrix]
Length=124

 Score = 47.4 bits (111),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 38/87 (44%), Positives = 54/87 (62%), Gaps = 0/87 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE V+ RM+SRM +  GIPL +GL  F   Y++     + +P     I+S   FG ++
Sbjct  18   AIPEKVSQRMLSRMVVLAGIPLLLGLGSFIGSYFIITQDLLVLPNTAIVILSMGCFGLSV  77

Query  443  LGVSYGIVSSSWDPMREGSLLGWNEAQ  523
            LG+SYG++S+SWD    GS+LGW E Q
Sbjct  78   LGLSYGVLSASWDEDAPGSVLGWQEFQ  104



>ref|WP_010871511.1| hypothetical protein [Synechocystis sp. PCC 6803]
 ref|NP_440201.1| hypothetical protein sll0933 [Synechocystis sp. PCC 6803]
 dbj|BAA16881.1| sll0933 [Synechocystis sp. PCC 6803]
 dbj|BAK49053.1| hypothetical protein SYNGTS_0305 [Synechocystis sp. PCC 6803]
 dbj|BAL28052.1| hypothetical protein SYNGTI_0305 [Synechocystis sp. PCC 6803 
substr. GT-I]
 dbj|BAL31222.1| hypothetical protein SYNPCCN_0305 [Synechocystis sp. PCC 6803 
substr. PCC-N]
 dbj|BAL34391.1| hypothetical protein SYNPCCP_0305 [Synechocystis sp. PCC 6803 
substr. PCC-P]
 dbj|BAM50592.1| hypothetical protein BEST7613_1661 [Bacillus subtilis BEST7613]
 gb|AGF50570.1| hypothetical protein MYO_13080 [Synechocystis sp. PCC 6803]
Length=158

 Score = 47.8 bits (112),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 54/84 (64%), Gaps = 1/84 (1%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP +V+ RM+ RM L  GIP  +G+L F  FY +      ++PT++ F VS +FFG  ++
Sbjct  51   IPAVVSQRMVKRMALFSGIPTGLGMLSFVLFYLVVSRDWFEIPTYVVFSVSLLFFGLGVV  110

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYGI S+SW+    GS+ GW E
Sbjct  111  GLSYGIFSTSWED-EPGSVWGWPE  133



>ref|WP_017712570.1| hypothetical protein [Prochlorothrix hollandica]
Length=173

 Score = 48.1 bits (113),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 32/86 (37%), Positives = 54/86 (63%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IPE+V+ RM+ R+ +  G+P  +G++ F   Y++     +++P  +  + S  FFG   L
Sbjct  63   IPEVVSKRMLRRIAVFSGLPTALGIITFILSYFVVTQDFLELPNSVVVVGSLGFFGLGTL  122

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G+SYG++S+SW+   EGSL+G  E Q
Sbjct  123  GISYGVLSASWEEETEGSLIGLTEFQ  148



>ref|WP_019500551.1| hypothetical protein [Pseudanabaena sp. PCC 6802]
Length=141

 Score = 47.4 bits (111),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 47/86 (55%), Gaps = 0/86 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP  V +R++ RM L  GIP   G   F   Y + +    ++P     +VS  F GT +L
Sbjct  36   IPPEVNSRIVRRMALFCGIPTLCGFATFVVSYVIVINKWFELPNTAVVLVSMAFLGTGVL  95

Query  446  GVSYGIVSSSWDPMREGSLLGWNEAQ  523
            G++YG +S+SW+  R GS  GW E Q
Sbjct  96   GLTYGALSASWEEDRVGSWFGWQEFQ  121



>ref|XP_005780389.1| hypothetical protein EMIHUDRAFT_443108 [Emiliania huxleyi CCMP1516]
 ref|XP_005793634.1| hypothetical protein EMIHUDRAFT_433277 [Emiliania huxleyi CCMP1516]
 gb|EOD27960.1| hypothetical protein EMIHUDRAFT_443108 [Emiliania huxleyi CCMP1516]
 gb|EOD41205.1| hypothetical protein EMIHUDRAFT_433277 [Emiliania huxleyi CCMP1516]
Length=261

 Score = 48.5 bits (114),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 49/90 (54%), Gaps = 8/90 (9%)
 Frame = +2

Query  260  GVIPEIVTNRMMSRM----GLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIF  427
            GV+PE+V+NRM+SR+    GL V     + +  +         L +DVP  +    +   
Sbjct  117  GVMPEVVSNRMLSRVVPFAGLPVFGSFLVFVGAYYA----NTQLDLDVPPQVIAYATQAC  172

Query  428  FGTALLGVSYGIVSSSWDPMREGSLLGWNE  517
            F  +  G+++G++S+SWD   EGSLLG  +
Sbjct  173  FALSFAGITWGVLSTSWDEETEGSLLGTEQ  202



>ref|WP_006669266.1| MULTISPECIES: hypothetical protein [Arthrospira]
 gb|EDZ94672.1| conserved hypothetical protein [Arthrospira maxima CS-328]
 emb|CCE16066.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
 emb|CDM94642.1| conserved hypothetical protein [Arthrospira sp. PCC 8005]
Length=175

 Score = 47.8 bits (112),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 51/85 (60%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+SRM +  GIPL + +  F   Y++       +P     +VS   FG ++
Sbjct  68   TIPEVVSQRMVSRMVVLSGIPLLMAISTFVGSYFIVTNEIFPLPNTAVLLVSLGCFGLSV  127

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G+SYG++S+SWD    GS LGW E
Sbjct  128  VGLSYGVLSASWDENLSGSFLGWQE  152



>ref|WP_015187896.1| hypothetical protein [Gloeocapsa sp. PCC 7428]
 gb|AFZ30021.1| hypothetical protein Glo7428_1459 [Gloeocapsa sp. PCC 7428]
Length=157

 Score = 47.4 bits (111),  Expect = 7e-04, Method: Compositional matrix adjust.
 Identities = 33/84 (39%), Positives = 49/84 (58%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            +P++V++RM  RM    GIP  +G+  F   Y +       +P     +VS  FFG  +L
Sbjct  54   VPKVVSDRMARRMAAFCGIPTALGMSTFIVSYLIVSHGWFKLPNVAVLLVSMGFFGLGVL  113

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G+SYG++S+SWD    GS+LGW E
Sbjct  114  GLSYGVLSASWDEEIVGSMLGWQE  137



>ref|WP_017720086.1| hypothetical protein [Oscillatoria sp. PCC 10802]
Length=150

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 33/85 (39%), Positives = 46/85 (54%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IP+ V+ RM+ RM L  G+P   G+  F   Y +       +P     + S  FFG  +
Sbjct  48   AIPDAVSKRMIQRMALLCGLPTAFGIGTFIASYIIVSNEWFKLPNVAVVLASMGFFGLGV  107

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            LG+SYG++S+SWD    GS LGW E
Sbjct  108  LGLSYGVLSASWDEEIPGSKLGWKE  132



>ref|WP_029633172.1| hypothetical protein [[Scytonema hofmanni] UTEX B 1581]
Length=153

 Score = 47.0 bits (110),  Expect = 8e-04, Method: Compositional matrix adjust.
 Identities = 30/84 (36%), Positives = 51/84 (61%), Gaps = 0/84 (0%)
 Frame = +2

Query  266  IPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTALL  445
            IP++V+ RM+ R+    G+P F+G+      Y L +  +I +P     +V+   FG  ++
Sbjct  50   IPKVVSQRMIRRVAGFCGVPTFLGIATLVASYLLAMYAQIKLPAIAVLLVNMGLFGLGVI  109

Query  446  GVSYGIVSSSWDPMREGSLLGWNE  517
            G++YG++S+SWD  R G L+G NE
Sbjct  110  GITYGVLSASWDEERVGGLVGLNE  133



>ref|WP_006617942.1| hypothetical protein [Arthrospira platensis]
 dbj|BAI91284.1| hypothetical protein [Arthrospira platensis NIES-39]
 gb|KDR55100.1| hypothetical protein APPUASWS_025175 [Arthrospira platensis str. 
Paraca]
Length=175

 Score = 47.4 bits (111),  Expect = 0.001, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 50/85 (59%), Gaps = 0/85 (0%)
 Frame = +2

Query  263  VIPEIVTNRMMSRMGLSVgiplfigllffpffyylKVGLKIDVPTWIPFIVSFIFFGTAL  442
             IPE+V+ RM+SRM    GIPL + +  F   Y++       +P     +VS   FG ++
Sbjct  68   TIPEVVSQRMVSRMVFLSGIPLLMAISTFVGSYFIVTNEIFPLPNTAVLLVSLGCFGLSV  127

Query  443  LGVSYGIVSSSWDPMREGSLLGWNE  517
            +G+SYG++S+SWD    GS LGW E
Sbjct  128  VGLSYGVLSASWDEDLSGSFLGWQE  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 564104274800