BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B20

Length=592
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010316764.1|  PREDICTED: squamosa promoter-binding protein...    183   3e-55   
ref|XP_009602314.1|  PREDICTED: squamosa promoter-binding protein...    182   8e-55   Nicotiana tomentosiformis
gb|ABL89185.1|  squamosa promoter binding protein-like protein          179   1e-53   Capsicum annuum
ref|XP_006347010.1|  PREDICTED: squamosa promoter-binding protein...    179   1e-53   Solanum tuberosum [potatoes]
emb|CDO99517.1|  unnamed protein product                                178   3e-53   Coffea canephora [robusta coffee]
ref|XP_009763062.1|  PREDICTED: squamosa promoter-binding protein...    177   4e-53   Nicotiana sylvestris
ref|XP_009602313.1|  PREDICTED: squamosa promoter-binding protein...    177   7e-53   Nicotiana tomentosiformis
ref|XP_009763061.1|  PREDICTED: squamosa promoter-binding protein...    172   4e-51   Nicotiana sylvestris
ref|XP_009622640.1|  PREDICTED: squamosa promoter-binding protein 1     171   3e-50   
ref|XP_009760116.1|  PREDICTED: squamosa promoter-binding protein 1     169   2e-49   Nicotiana sylvestris
ref|XP_011096328.1|  PREDICTED: squamosa promoter-binding protein 1     167   6e-49   Sesamum indicum [beniseed]
gb|AIE89804.1|  SQUAMOSA promoter binding protein-like 15               166   9e-49   Salvia miltiorrhiza [Chinese salvia]
ref|XP_006361029.1|  PREDICTED: squamosa promoter-binding protein...    165   4e-48   Solanum tuberosum [potatoes]
gb|AGR34081.1|  squamosa promoter binding protein-like 4                165   2e-47   Pogostemon cablin
ref|XP_004248108.1|  PREDICTED: squamosa promoter-binding protein...    163   2e-47   
sp|Q38741.1|SBP1_ANTMA  RecName: Full=Squamosa promoter-binding p...    162   7e-47   Antirrhinum majus [garden snapdragon]
ref|XP_007025578.1|  Squamosa promoter binding protein-like 3           157   5e-45   
gb|EYU27990.1|  hypothetical protein MIMGU_mgv1a015969mg                155   4e-44   Erythranthe guttata [common monkey flower]
gb|KJB68767.1|  hypothetical protein B456_011G029400                    151   2e-42   Gossypium raimondii
gb|KJB68768.1|  hypothetical protein B456_011G029400                    151   7e-42   Gossypium raimondii
ref|XP_002280052.1|  PREDICTED: squamosa promoter-binding protein...    149   1e-41   Vitis vinifera
ref|XP_011043824.1|  PREDICTED: squamosa promoter-binding protein...    150   1e-41   Populus euphratica
ref|XP_002305783.2|  hypothetical protein POPTR_0004s04630g             147   4e-41   Populus trichocarpa [western balsam poplar]
ref|XP_006467766.1|  PREDICTED: squamosa promoter-binding-like pr...    149   5e-41   
ref|XP_006370233.1|  hypothetical protein POPTR_0001s40870g             148   6e-41   Populus trichocarpa [western balsam poplar]
gb|ADY75712.1|  SPL3-like protein                                       147   7e-41   Eucalyptus globulus [blue gum]
gb|KDO77620.1|  hypothetical protein CISIN_1g032310mg                   145   2e-40   Citrus sinensis [apfelsine]
ref|XP_010057392.1|  PREDICTED: squamosa promoter-binding-like pr...    145   3e-40   Eucalyptus grandis [rose gum]
ref|XP_011027797.1|  PREDICTED: squamosa promoter-binding-like pr...    145   4e-40   Populus euphratica
gb|AIL95848.1|  SQUAMOSA promoter binding-like transcription factor     144   1e-39   Gossypium hirsutum [American cotton]
gb|ADG59812.1|  SQUAMOSA-promoter binding protein 1                     142   1e-39   Erythranthe guttata [common monkey flower]
ref|XP_010675500.1|  PREDICTED: squamosa promoter-binding-like pr...    146   2e-39   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010479860.1|  PREDICTED: squamosa promoter-binding-like pr...    142   9e-39   Camelina sativa [gold-of-pleasure]
ref|XP_004146058.1|  PREDICTED: squamosa promoter-binding-like pr...    142   1e-38   Cucumis sativus [cucumbers]
ref|XP_002533086.1|  Squamosa promoter-binding protein, putative        142   1e-38   Ricinus communis
ref|XP_010500948.1|  PREDICTED: squamosa promoter-binding-like pr...    142   1e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006449372.1|  hypothetical protein CICLE_v10017104mg             140   1e-38   Citrus clementina [clementine]
ref|XP_010500947.1|  PREDICTED: squamosa promoter-binding-like pr...    141   2e-38   Camelina sativa [gold-of-pleasure]
ref|XP_007148144.1|  hypothetical protein PHAVU_006G183900g             140   2e-38   Phaseolus vulgaris [French bean]
ref|XP_006451806.1|  hypothetical protein CICLE_v10009879mg             139   3e-38   Citrus clementina [clementine]
emb|CDY25876.1|  BnaA05g14670D                                          141   3e-38   Brassica napus [oilseed rape]
ref|XP_002509450.1|  Squamosa promoter-binding protein, putative        140   3e-38   Ricinus communis
ref|XP_007159345.1|  hypothetical protein PHAVU_002G230300g             142   3e-38   Phaseolus vulgaris [French bean]
ref|XP_010545847.1|  PREDICTED: squamosa promoter-binding-like pr...    141   3e-38   
ref|XP_010462181.1|  PREDICTED: squamosa promoter-binding-like pr...    141   3e-38   
ref|XP_010655440.1|  PREDICTED: squamosa promoter-binding protein...    140   4e-38   Vitis vinifera
ref|XP_003547153.1|  PREDICTED: squamosa promoter-binding protein...    139   4e-38   Glycine max [soybeans]
ref|XP_010035775.1|  PREDICTED: squamosa promoter-binding protein...    140   4e-38   Eucalyptus grandis [rose gum]
ref|XP_010462180.1|  PREDICTED: squamosa promoter-binding-like pr...    141   4e-38   Camelina sativa [gold-of-pleasure]
gb|AGI62049.1|  SQUAMOSA promoter-binding-like 1                        140   5e-38   Erycina pusilla
ref|XP_011043410.1|  PREDICTED: squamosa promoter-binding-like pr...    139   5e-38   Populus euphratica
ref|XP_010260271.1|  PREDICTED: squamosa promoter-binding protein 1     140   7e-38   Nelumbo nucifera [Indian lotus]
ref|XP_006303186.1|  hypothetical protein CARUB_v10010422mg             140   8e-38   
ref|XP_009144795.1|  PREDICTED: squamosa promoter-binding-like pr...    140   1e-37   Brassica rapa
ref|XP_002275728.1|  PREDICTED: squamosa promoter-binding protein...    139   1e-37   Vitis vinifera
gb|AFK42236.1|  unknown                                                 138   1e-37   Medicago truncatula
ref|XP_007021543.1|  Squamosa promoter binding protein-like 3 iso...    140   2e-37   
gb|AGP03027.1|  SQUAMOSA promoter binding protein-like protein 3        137   2e-37   Arabis alpina [alpine rockcress]
ref|XP_010469422.1|  PREDICTED: squamosa promoter-binding-like pr...    137   2e-37   Camelina sativa [gold-of-pleasure]
ref|XP_002879473.1|  hypothetical protein ARALYDRAFT_482334             137   2e-37   
ref|XP_008383704.1|  PREDICTED: squamosa promoter-binding-like pr...    139   2e-37   Malus domestica [apple tree]
ref|XP_007021544.1|  Squamosa promoter binding protein-like 3 iso...    141   2e-37   
gb|AHC08502.1|  SBP-box transcription factor                            138   2e-37   Malus domestica [apple tree]
dbj|BAM15475.1|  SBP-box protein                                        137   3e-37   Torenia fournieri [bluewings]
ref|XP_003541730.1|  PREDICTED: squamosa promoter-binding protein...    137   3e-37   Glycine max [soybeans]
ref|XP_002891731.1|  hypothetical protein ARALYDRAFT_474435             138   3e-37   
ref|NP_565771.1|  squamosa promoter-binding-like protein 3              137   4e-37   Arabidopsis thaliana [mouse-ear cress]
emb|CAB94233.1|  Squamosa promoter binding protein-like 3               136   5e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008463797.1|  PREDICTED: squamosa promoter-binding protein...    137   7e-37   
ref|XP_008367070.1|  PREDICTED: squamosa promoter-binding protein...    137   8e-37   
ref|XP_002317486.2|  hypothetical protein POPTR_0011s11770g             137   1e-36   
ref|XP_010502692.1|  PREDICTED: squamosa promoter-binding-like pr...    137   1e-36   Camelina sativa [gold-of-pleasure]
ref|XP_010062855.1|  PREDICTED: squamosa promoter-binding-like pr...    137   2e-36   Eucalyptus grandis [rose gum]
gb|KCW47238.1|  hypothetical protein EUGRSUZ_K01046                     137   2e-36   Eucalyptus grandis [rose gum]
emb|CDP14818.1|  unnamed protein product                                137   2e-36   Coffea canephora [robusta coffee]
gb|AAM67271.1|  putative squamosa-promoter binding protein              135   2e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006447265.1|  hypothetical protein CICLE_v10016841mg             136   2e-36   
gb|AAY16440.1|  squamosa promoter binding-like protein                  136   3e-36   Betula platyphylla [Asian white birch]
ref|XP_006298553.1|  hypothetical protein CARUB_v10014636mg             137   3e-36   
ref|NP_188145.1|  squamosa promoter-binding-like protein 5              135   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009356783.1|  PREDICTED: squamosa promoter-binding protein...    136   4e-36   Pyrus x bretschneideri [bai li]
gb|KCW47237.1|  hypothetical protein EUGRSUZ_K01046                     137   4e-36   Eucalyptus grandis [rose gum]
ref|XP_002517882.1|  Squamosa promoter-binding protein, putative        136   4e-36   Ricinus communis
gb|KDO42134.1|  hypothetical protein CISIN_1g029650mg                   135   4e-36   Citrus sinensis [apfelsine]
emb|CDX98540.1|  BnaC05g38350D                                          135   4e-36   
ref|NP_175723.1|  squamosa promoter binding protein-like 4              135   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487346.1|  PREDICTED: squamosa promoter-binding-like pr...    135   5e-36   Camelina sativa [gold-of-pleasure]
ref|XP_007043635.1|  Squamosa promoter binding protein-like 4           137   5e-36   
ref|XP_010465475.1|  PREDICTED: squamosa promoter-binding-like pr...    135   5e-36   Camelina sativa [gold-of-pleasure]
emb|CAB56584.1|  squamosa promoter binding protein-like 4               135   6e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007212177.1|  hypothetical protein PRUPE_ppa012607mg             134   6e-36   Prunus persica
ref|XP_007213489.1|  hypothetical protein PRUPE_ppa022739mg             134   7e-36   Prunus persica
ref|XP_011029504.1|  PREDICTED: squamosa promoter-binding-like pr...    137   7e-36   Populus euphratica
ref|XP_008226482.1|  PREDICTED: squamosa promoter-binding-like pr...    134   8e-36   Prunus mume [ume]
gb|KEH38697.1|  squamosa promoter-binding-like protein                  134   8e-36   Medicago truncatula
gb|KDP45880.1|  hypothetical protein JCGZ_15324                         135   1e-35   Jatropha curcas
gb|KDP20990.1|  hypothetical protein JCGZ_21461                         133   1e-35   Jatropha curcas
ref|XP_002309744.2|  hypothetical protein POPTR_0007s01030g             135   1e-35   Populus trichocarpa [western balsam poplar]
emb|CDY27935.1|  BnaCnng05200D                                          133   1e-35   Brassica napus [oilseed rape]
ref|XP_010272389.1|  PREDICTED: squamosa promoter-binding protein...    134   1e-35   Nelumbo nucifera [Indian lotus]
ref|XP_009146272.1|  PREDICTED: squamosa promoter-binding-like pr...    134   1e-35   Brassica rapa
gb|AGP03028.1|  SQUAMOSA promoter binding protein-like protein 4        134   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010542291.1|  PREDICTED: squamosa promoter-binding-like pr...    132   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_006295226.1|  hypothetical protein CARUB_v10024311mg             132   2e-35   Capsella rubella
ref|XP_006410530.1|  hypothetical protein EUTSA_v10017406mg             132   2e-35   Eutrema salsugineum [saltwater cress]
ref|XP_010108163.1|  Squamosa promoter-binding protein 1                133   2e-35   Morus notabilis
ref|XP_010549337.1|  PREDICTED: squamosa promoter-binding-like pr...    133   2e-35   Tarenaya hassleriana [spider flower]
ref|XP_011005939.1|  PREDICTED: squamosa promoter-binding-like pr...    142   3e-35   Populus euphratica
ref|XP_002302799.2|  hypothetical protein POPTR_0002s18970g             142   3e-35   
ref|XP_003526029.1|  PREDICTED: squamosa promoter-binding protein...    133   3e-35   Glycine max [soybeans]
gb|AGR34080.1|  squamosa promoter binding protein-like 3                133   3e-35   Pogostemon cablin
ref|XP_010929104.1|  PREDICTED: squamosa promoter-binding protein...    133   3e-35   Elaeis guineensis
gb|AFK36644.1|  unknown                                                 132   4e-35   Lotus japonicus
emb|CDY50515.1|  BnaC06g10070D                                          132   4e-35   Brassica napus [oilseed rape]
emb|CDP05939.1|  unnamed protein product                                132   4e-35   Coffea canephora [robusta coffee]
ref|XP_009340759.1|  PREDICTED: squamosa promoter-binding protein...    133   5e-35   Pyrus x bretschneideri [bai li]
ref|XP_009781601.1|  PREDICTED: squamosa promoter-binding-like pr...    132   6e-35   Nicotiana sylvestris
emb|CDX79544.1|  BnaC03g18800D                                          132   6e-35   
ref|XP_008225122.1|  PREDICTED: squamosa promoter-binding-like pr...    132   6e-35   Prunus mume [ume]
pdb|1UL4|A  Chain A, Solution Structure Of The Dna-Binding Domain...    130   6e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004303145.1|  PREDICTED: squamosa promoter-binding protein...    132   6e-35   Fragaria vesca subsp. vesca
emb|CDY57212.1|  BnaC04g44230D                                          131   7e-35   Brassica napus [oilseed rape]
gb|ADL36826.1|  SPL domain class transcription factor                   132   7e-35   Malus domestica [apple tree]
ref|XP_008810376.1|  PREDICTED: squamosa promoter-binding protein...    132   7e-35   Phoenix dactylifera
ref|XP_006406996.1|  hypothetical protein EUTSA_v10021617mg             132   7e-35   Eutrema salsugineum [saltwater cress]
gb|ABO80946.1|  SBP                                                     134   7e-35   Medicago truncatula
ref|XP_009626190.1|  PREDICTED: squamosa promoter-binding-like pr...    132   9e-35   Nicotiana tomentosiformis
emb|CDY24113.1|  BnaA06g01110D                                          131   1e-34   Brassica napus [oilseed rape]
gb|KDP28324.1|  hypothetical protein JCGZ_14095                         141   1e-34   Jatropha curcas
ref|XP_009382775.1|  PREDICTED: squamosa promoter-binding protein...    132   1e-34   
ref|XP_011458918.1|  PREDICTED: squamosa promoter-binding protein...    132   1e-34   Fragaria vesca subsp. vesca
ref|XP_011047666.1|  PREDICTED: squamosa promoter-binding protein...    134   1e-34   Populus euphratica
ref|XP_008386198.1|  PREDICTED: squamosa promoter-binding protein 1     132   1e-34   
ref|XP_004485802.1|  PREDICTED: squamosa promoter-binding-like pr...    130   1e-34   Cicer arietinum [garbanzo]
ref|XP_009147623.1|  PREDICTED: squamosa promoter-binding-like pr...    131   1e-34   
ref|XP_010656994.1|  PREDICTED: squamosa promoter-binding protein...    131   1e-34   Vitis vinifera
ref|XP_008442764.1|  PREDICTED: squamosa promoter-binding-like pr...    131   2e-34   Cucumis melo [Oriental melon]
ref|XP_002515202.1|  conserved hypothetical protein                     140   2e-34   Ricinus communis
ref|XP_003540122.1|  PREDICTED: squamosa promoter-binding protein...    131   2e-34   Glycine max [soybeans]
ref|XP_010091480.1|  Squamosa promoter-binding-like protein 5           132   2e-34   Morus notabilis
dbj|BAJ34525.1|  unnamed protein product                                131   2e-34   Eutrema halophilum
emb|CDY61210.1|  BnaC06g41420D                                          131   2e-34   Brassica napus [oilseed rape]
ref|XP_009147622.1|  PREDICTED: squamosa promoter-binding-like pr...    131   2e-34   Brassica rapa
gb|KEH24442.1|  squamosa promoter-binding-like protein                  139   3e-34   Medicago truncatula
ref|XP_009132954.1|  PREDICTED: squamosa promoter-binding-like pr...    129   3e-34   Brassica rapa
gb|KDO86821.1|  hypothetical protein CISIN_1g001971mg                   139   3e-34   Citrus sinensis [apfelsine]
ref|XP_004505078.1|  PREDICTED: squamosa promoter-binding protein...    129   3e-34   
ref|XP_009141347.1|  PREDICTED: squamosa promoter-binding-like pr...    129   3e-34   Brassica rapa
ref|XP_011005940.1|  PREDICTED: squamosa promoter-binding-like pr...    139   3e-34   Populus euphratica
emb|CDY37684.1|  BnaA04g19840D                                          129   3e-34   Brassica napus [oilseed rape]
gb|AAV51939.1|  SBP transcription factor                                130   3e-34   Gossypium hirsutum [American cotton]
gb|AIL95850.1|  SQUAMOSA promoter binding-like transcription factor     130   3e-34   Gossypium hirsutum [American cotton]
ref|XP_009392815.1|  PREDICTED: squamosa promoter-binding-like pr...    130   4e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010509826.1|  PREDICTED: squamosa promoter-binding-like pr...    129   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010413803.1|  PREDICTED: squamosa promoter-binding-like pr...    129   4e-34   Camelina sativa [gold-of-pleasure]
ref|XP_006444595.1|  hypothetical protein CICLE_v10018697mg             139   4e-34   Citrus clementina [clementine]
emb|CAD90156.1|  squamosa promoter binding like-protein                 129   4e-34   Betula pendula [white birch]
gb|KEH19523.1|  squamosa promoter-binding-like protein                  130   5e-34   Medicago truncatula
ref|XP_004488737.1|  PREDICTED: squamosa promoter-binding-like pr...    130   6e-34   Cicer arietinum [garbanzo]
ref|XP_006582910.1|  PREDICTED: uncharacterized protein LOC100789...    129   7e-34   
gb|KHN15472.1|  Squamosa promoter-binding protein 1                     129   8e-34   Glycine soja [wild soybean]
ref|XP_004488736.1|  PREDICTED: squamosa promoter-binding-like pr...    129   9e-34   Cicer arietinum [garbanzo]
gb|KFK38868.1|  spl5                                                    129   9e-34   Arabis alpina [alpine rockcress]
ref|XP_009115660.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-33   Brassica rapa
emb|CDY20128.1|  BnaA01g28740D                                          129   1e-33   Brassica napus [oilseed rape]
ref|XP_004510032.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-33   Cicer arietinum [garbanzo]
ref|XP_004293885.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-33   Fragaria vesca subsp. vesca
ref|XP_008447446.1|  PREDICTED: squamosa promoter-binding-like pr...    138   1e-33   Cucumis melo [Oriental melon]
ref|XP_004148578.1|  PREDICTED: squamosa promoter-binding-like pr...    138   1e-33   Cucumis sativus [cucumbers]
ref|XP_004166093.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    138   1e-33   
ref|XP_008439842.1|  PREDICTED: squamosa promoter-binding protein 1     128   1e-33   Cucumis melo [Oriental melon]
ref|XP_009617582.1|  PREDICTED: squamosa promoter-binding-like pr...    137   1e-33   Nicotiana tomentosiformis
ref|XP_011100353.1|  PREDICTED: squamosa promoter-binding protein...    129   2e-33   Sesamum indicum [beniseed]
ref|XP_007198845.1|  hypothetical protein PRUPE_ppa011968mg             129   2e-33   Prunus persica
gb|KHN18285.1|  Squamosa promoter-binding protein 1                     129   2e-33   Glycine soja [wild soybean]
ref|XP_007133260.1|  hypothetical protein PHAVU_011G164800g             129   2e-33   Phaseolus vulgaris [French bean]
gb|EPS70852.1|  squamosa promoter-binding protein 2                     126   2e-33   Genlisea aurea
ref|XP_009620386.1|  PREDICTED: squamosa promoter-binding-like pr...    128   2e-33   Nicotiana tomentosiformis
ref|XP_011082696.1|  PREDICTED: squamosa promoter-binding protein...    129   2e-33   Sesamum indicum [beniseed]
ref|XP_009143829.1|  PREDICTED: squamosa promoter-binding-like pr...    127   2e-33   Brassica rapa
ref|XP_006392823.1|  hypothetical protein EUTSA_v10011728mg             130   2e-33   
gb|KDO86825.1|  hypothetical protein CISIN_1g001971mg                   135   2e-33   Citrus sinensis [apfelsine]
ref|XP_010694791.1|  PREDICTED: squamosa promoter-binding-like pr...    137   2e-33   Beta vulgaris subsp. vulgaris [field beet]
gb|KDO86826.1|  hypothetical protein CISIN_1g001971mg                   135   2e-33   Citrus sinensis [apfelsine]
ref|XP_009352877.1|  PREDICTED: squamosa promoter-binding-like pr...    128   2e-33   Pyrus x bretschneideri [bai li]
gb|KDO86828.1|  hypothetical protein CISIN_1g001971mg                   134   2e-33   Citrus sinensis [apfelsine]
ref|XP_008229071.1|  PREDICTED: squamosa promoter-binding-like pr...    128   3e-33   Prunus mume [ume]
emb|CAB56772.1|  Squamosa promoter binding protein-like 5               126   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004232901.1|  PREDICTED: squamosa promoter-binding protein...    126   4e-33   Solanum lycopersicum
ref|XP_004146615.1|  PREDICTED: squamosa promoter-binding protein...    126   4e-33   
gb|EMT03959.1|  Squamosa promoter-binding-like protein 7                128   4e-33   
ref|XP_004134953.1|  PREDICTED: squamosa promoter-binding protein...    126   5e-33   Cucumis sativus [cucumbers]
ref|XP_007145109.1|  hypothetical protein PHAVU_007G210600g             136   5e-33   Phaseolus vulgaris [French bean]
gb|KDO86824.1|  hypothetical protein CISIN_1g001971mg                   134   5e-33   Citrus sinensis [apfelsine]
gb|KJB13326.1|  hypothetical protein B456_002G068300                    127   5e-33   Gossypium raimondii
ref|XP_010678887.1|  PREDICTED: squamosa promoter-binding-like pr...    136   5e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002282598.1|  PREDICTED: squamosa promoter-binding-like pr...    128   5e-33   Vitis vinifera
gb|KGN64693.1|  hypothetical protein Csa_1G074980                       127   6e-33   Cucumis sativus [cucumbers]
gb|KJB49739.1|  hypothetical protein B456_008G135700                    135   6e-33   Gossypium raimondii
ref|XP_007046540.1|  Squamosa promoter-binding protein-like 12          128   6e-33   Theobroma cacao [chocolate]
gb|EYU42136.1|  hypothetical protein MIMGU_mgv1a014682mg                127   6e-33   Erythranthe guttata [common monkey flower]
gb|KDP24104.1|  hypothetical protein JCGZ_25761                         125   6e-33   Jatropha curcas
ref|XP_003593617.1|  Squamosa promoter binding-like protein             126   7e-33   Medicago truncatula
ref|XP_004164023.1|  PREDICTED: squamosa promoter-binding protein...    126   7e-33   
emb|CBI37021.3|  unnamed protein product                                135   7e-33   Vitis vinifera
gb|KHG24779.1|  Squamosa promoter-binding-like protein 5                127   8e-33   Gossypium arboreum [tree cotton]
ref|XP_004239889.1|  PREDICTED: squamosa promoter-binding-like pr...    135   9e-33   Solanum lycopersicum
gb|KJB49738.1|  hypothetical protein B456_008G135700                    135   1e-32   Gossypium raimondii
ref|XP_011040504.1|  PREDICTED: squamosa promoter-binding-like pr...    135   1e-32   Populus euphratica
ref|XP_002320264.2|  hypothetical protein POPTR_0014s10960g             135   1e-32   Populus trichocarpa [western balsam poplar]
gb|KDO86822.1|  hypothetical protein CISIN_1g001971mg                   134   1e-32   Citrus sinensis [apfelsine]
gb|KJB22424.1|  hypothetical protein B456_004G047200                    135   1e-32   Gossypium raimondii
gb|KDO86823.1|  hypothetical protein CISIN_1g001971mg                   134   1e-32   Citrus sinensis [apfelsine]
gb|KHG26890.1|  Squamosa promoter-binding-like protein 1                135   1e-32   Gossypium arboreum [tree cotton]
ref|XP_003543233.1|  PREDICTED: squamosa promoter-binding protein...    127   1e-32   Glycine max [soybeans]
emb|CDY17204.1|  BnaA05g09840D                                          125   1e-32   Brassica napus [oilseed rape]
ref|XP_010652308.1|  PREDICTED: squamosa promoter-binding-like pr...    135   1e-32   Vitis vinifera
gb|EPS64133.1|  hypothetical protein M569_10651                         124   1e-32   Genlisea aurea
ref|XP_006367482.1|  PREDICTED: squamosa promoter-binding protein...    126   1e-32   Solanum tuberosum [potatoes]
gb|AIL95861.1|  SQUAMOSA promoter binding-like transcription factor     134   2e-32   Gossypium hirsutum [American cotton]
ref|XP_010661347.1|  PREDICTED: squamosa promoter-binding-like pr...    131   2e-32   Vitis vinifera
emb|CBI16615.3|  unnamed protein product                                131   2e-32   Vitis vinifera
emb|CDP20025.1|  unnamed protein product                                130   2e-32   Coffea canephora [robusta coffee]
ref|XP_007149828.1|  hypothetical protein PHAVU_005G101900g             125   2e-32   Phaseolus vulgaris [French bean]
ref|XP_003626036.1|  SQUAMOSA promoter binding protein                  134   2e-32   
gb|AES82254.2|  squamosa promoter-binding-like protein                  134   2e-32   Medicago truncatula
gb|KDO86820.1|  hypothetical protein CISIN_1g001971mg                   134   2e-32   Citrus sinensis [apfelsine]
emb|CDY32310.1|  BnaC01g36290D                                          125   2e-32   Brassica napus [oilseed rape]
ref|XP_009398957.1|  PREDICTED: squamosa promoter-binding protein...    125   3e-32   
ref|XP_006347009.1|  PREDICTED: squamosa promoter-binding protein...    124   3e-32   Solanum tuberosum [potatoes]
ref|XP_009765576.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-32   Nicotiana sylvestris
ref|NP_001236309.1|  uncharacterized protein LOC100527199               124   3e-32   Glycine max [soybeans]
ref|XP_006653653.1|  PREDICTED: squamosa promoter-binding-like pr...    128   4e-32   Oryza brachyantha
ref|XP_010045710.1|  PREDICTED: squamosa promoter-binding-like pr...    134   4e-32   Eucalyptus grandis [rose gum]
ref|XP_010106183.1|  hypothetical protein L484_009607                   124   4e-32   Morus notabilis
gb|ACU24116.1|  unknown                                                 125   4e-32   Glycine max [soybeans]
gb|KHN09987.1|  Squamosa promoter-binding protein 1                     124   4e-32   Glycine soja [wild soybean]
gb|ADL36825.1|  SPL domain class transcription factor                   124   5e-32   Malus domestica [apple tree]
gb|KJB81972.1|  hypothetical protein B456_013G169800                    125   5e-32   Gossypium raimondii
ref|XP_010091413.1|  Squamosa promoter-binding-like protein 1           133   5e-32   Morus notabilis
ref|XP_006858268.1|  hypothetical protein AMTR_s00062p00211520          125   6e-32   Amborella trichopoda
dbj|BAM15477.1|  SBP-box protein                                        124   6e-32   Torenia fournieri [bluewings]
ref|XP_004494461.1|  PREDICTED: squamosa promoter-binding-like pr...    133   6e-32   Cicer arietinum [garbanzo]
ref|XP_010469241.1|  PREDICTED: squamosa promoter-binding-like pr...    133   6e-32   Camelina sativa [gold-of-pleasure]
ref|XP_004243367.2|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-32   Solanum lycopersicum
gb|EPS59677.1|  hypothetical protein M569_15126                         121   7e-32   Genlisea aurea
ref|XP_003560169.2|  PREDICTED: squamosa promoter-binding-like pr...    124   8e-32   
ref|XP_003534999.1|  PREDICTED: squamosa promoter-binding-like pr...    132   8e-32   Glycine max [soybeans]
gb|KHN29773.1|  Squamosa promoter-binding-like protein 1                132   8e-32   Glycine soja [wild soybean]
ref|XP_004252249.1|  PREDICTED: squamosa promoter-binding-like pr...    129   9e-32   Solanum lycopersicum
ref|XP_003540473.1|  PREDICTED: squamosa promoter-binding protein 2     124   9e-32   Glycine max [soybeans]
ref|XP_011042488.1|  PREDICTED: squamosa promoter-binding-like pr...    129   9e-32   Populus euphratica
ref|XP_010649307.1|  PREDICTED: squamosa promoter-binding-like pr...    125   9e-32   Vitis vinifera
gb|KEH22349.1|  squamosa promoter-binding-like protein                  127   9e-32   Medicago truncatula
ref|XP_010316763.1|  PREDICTED: squamosa promoter-binding protein...    123   1e-31   
ref|XP_009622387.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-31   Nicotiana tomentosiformis
gb|AAC34221.1|  putative squamosa-promoter binding protein              125   1e-31   Arabidopsis thaliana [mouse-ear cress]
gb|AIE89792.1|  SQUAMOSA promoter binding protein-like 3                124   1e-31   Salvia miltiorrhiza [Chinese salvia]
ref|XP_007035970.1|  Squamosa promoter-binding protein, putative ...    132   1e-31   
ref|XP_011090056.1|  PREDICTED: squamosa promoter-binding-like pr...    128   1e-31   Sesamum indicum [beniseed]
ref|XP_007149482.1|  hypothetical protein PHAVU_005G074000g             124   1e-31   Phaseolus vulgaris [French bean]
ref|XP_011090065.1|  PREDICTED: squamosa promoter-binding-like pr...    128   1e-31   Sesamum indicum [beniseed]
gb|EYU31933.1|  hypothetical protein MIMGU_mgv1a020120mg                129   1e-31   Erythranthe guttata [common monkey flower]
ref|XP_003547557.2|  PREDICTED: squamosa promoter-binding-like pr...    132   1e-31   
ref|XP_009397190.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    123   1e-31   
ref|XP_006375256.1|  hypothetical protein POPTR_0014s05690g             128   2e-31   Populus trichocarpa [western balsam poplar]
ref|XP_003625236.1|  Squamosa promoter-binding-like protein             127   2e-31   
ref|XP_006349151.1|  PREDICTED: squamosa promoter-binding-like pr...    132   2e-31   Solanum tuberosum [potatoes]
ref|XP_009793310.1|  PREDICTED: squamosa promoter-binding-like pr...    132   2e-31   Nicotiana sylvestris
ref|XP_006354100.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-31   Solanum tuberosum [potatoes]
gb|KHN09887.1|  Squamosa promoter-binding-like protein 12               132   2e-31   Glycine soja [wild soybean]
ref|XP_008371395.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-31   
ref|XP_003553428.1|  PREDICTED: squamosa promoter-binding-like pr...    127   2e-31   Glycine max [soybeans]
ref|XP_006397898.1|  hypothetical protein EUTSA_v10001295mg             131   2e-31   Eutrema salsugineum [saltwater cress]
dbj|BAM15478.1|  SBP-box protein                                        123   2e-31   Torenia fournieri [bluewings]
ref|XP_006397897.1|  hypothetical protein EUTSA_v10001295mg             131   2e-31   
ref|XP_009796558.1|  PREDICTED: squamosa promoter-binding-like pr...    131   2e-31   Nicotiana sylvestris
ref|XP_002878311.1|  hypothetical protein ARALYDRAFT_907523             131   2e-31   Arabidopsis lyrata subsp. lyrata
ref|XP_009342532.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-31   Pyrus x bretschneideri [bai li]
sp|Q38740.1|SBP2_ANTMA  RecName: Full=Squamosa promoter-binding p...    123   3e-31   
ref|XP_010943949.1|  PREDICTED: squamosa promoter-binding protein...    123   3e-31   
gb|AIE89799.1|  SQUAMOSA promoter binding protein-like 10               131   3e-31   
ref|XP_007162307.1|  hypothetical protein PHAVU_001G141000g             127   3e-31   
gb|ABN08632.1|  SBP                                                     127   3e-31   
emb|CDX80078.1|  BnaA05g00780D                                          130   3e-31   
emb|CAB56569.1|  squamosa promoter binding protein-homologue 4          125   3e-31   
gb|KHG05980.1|  Squamosa promoter-binding-like protein 1                130   3e-31   
ref|XP_002532343.1|  LIGULELESS1 protein, putative                      127   3e-31   
ref|XP_011071328.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    130   3e-31   
ref|XP_010559216.1|  PREDICTED: squamosa promoter-binding-like pr...    130   4e-31   
ref|XP_007138555.1|  hypothetical protein PHAVU_009G219200g             130   4e-31   
emb|CDY37783.1|  BnaC04g00420D                                          130   4e-31   
gb|AIE89797.1|  SQUAMOSA promoter binding protein-like 8                125   4e-31   
ref|XP_008796104.1|  PREDICTED: squamosa promoter-binding-like pr...    126   4e-31   
gb|KJB41707.1|  hypothetical protein B456_007G116100                    130   4e-31   
gb|AIL95862.1|  SQUAMOSA promoter binding-like transcription factor     130   4e-31   
ref|XP_004493567.1|  PREDICTED: squamosa promoter-binding-like pr...    126   4e-31   
ref|XP_002512054.1|  LIGULELESS1 protein, putative                      127   5e-31   
emb|CDP17026.1|  unnamed protein product                                130   5e-31   
ref|XP_004513942.1|  PREDICTED: squamosa promoter-binding-like pr...    125   5e-31   
ref|XP_010559171.1|  PREDICTED: squamosa promoter-binding-like pr...    130   5e-31   
ref|XP_009124485.1|  PREDICTED: squamosa promoter-binding-like pr...    130   5e-31   
ref|XP_009124484.1|  PREDICTED: squamosa promoter-binding-like pr...    130   5e-31   
ref|XP_010258892.1|  PREDICTED: squamosa promoter-binding-like pr...    127   5e-31   
ref|XP_010559170.1|  PREDICTED: squamosa promoter-binding-like pr...    130   5e-31   
gb|ABK23519.1|  unknown                                                 123   5e-31   
emb|CBI30036.3|  unnamed protein product                                126   5e-31   
ref|XP_007028954.1|  Promoter-binding protein SPL9                      127   5e-31   
ref|XP_006845685.1|  hypothetical protein AMTR_s00019p00235390          124   6e-31   
ref|XP_009758722.1|  PREDICTED: squamosa promoter-binding-like pr...    127   6e-31   
ref|XP_002466159.1|  hypothetical protein SORBIDRAFT_01g002530          130   6e-31   
gb|KHN47586.1|  Squamosa promoter-binding-like protein 7                124   6e-31   
ref|NP_001267898.1|  promoter-binding protein SPL9                      126   7e-31   
gb|KJB41038.1|  hypothetical protein B456_007G087900                    126   8e-31   
gb|AGP03025.1|  SQUAMOSA promoter binding protein-like protein 1        129   8e-31   
ref|XP_010943698.1|  PREDICTED: squamosa promoter-binding-like pr...    130   8e-31   
ref|XP_011011660.1|  PREDICTED: squamosa promoter-binding-like pr...    127   9e-31   
ref|XP_004974838.1|  PREDICTED: squamosa promoter-binding-like pr...    126   9e-31   
emb|CAB56570.1|  squamosa promoter binding protein-homologue 5          125   9e-31   
ref|XP_006591581.1|  PREDICTED: squamosa promoter-binding-like pr...    123   9e-31   
ref|XP_010270965.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-30   
gb|AIL95869.1|  SQUAMOSA promoter binding-like transcription factor     126   1e-30   
emb|CAN74605.1|  hypothetical protein VITISV_025316                     129   1e-30   
ref|XP_010943552.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-30   
ref|XP_011011624.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-30   
ref|XP_010661348.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-30   
gb|KJB49223.1|  hypothetical protein B456_008G107300                    125   1e-30   
ref|XP_010933658.1|  PREDICTED: squamosa promoter-binding-like pr...    125   1e-30   
ref|XP_010943550.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-30   
ref|XP_010943551.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-30   
gb|KJB49222.1|  hypothetical protein B456_008G107300                    125   1e-30   
ref|XP_006355718.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-30   
ref|XP_002446904.1|  hypothetical protein SORBIDRAFT_06g024630          126   1e-30   
sp|Q01JD1.1|SPL7_ORYSI  RecName: Full=Squamosa promoter-binding-l...    125   1e-30   
ref|NP_001053497.1|  Os04g0551500                                       125   1e-30   
ref|XP_010943549.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-30   
ref|XP_010661349.1|  PREDICTED: squamosa promoter-binding-like pr...    125   1e-30   
ref|XP_010919590.1|  PREDICTED: squamosa promoter-binding-like pr...    125   1e-30   
ref|XP_008390494.1|  PREDICTED: squamosa promoter-binding-like pr...    129   1e-30   
ref|XP_009393147.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-30   
gb|KDP41332.1|  hypothetical protein JCGZ_15739                         127   2e-30   
emb|CBI27317.3|  unnamed protein product                                126   2e-30   
ref|XP_011070914.1|  PREDICTED: squamosa promoter-binding-like pr...    125   2e-30   
ref|XP_011027798.1|  PREDICTED: squamosa promoter-binding-like pr...    120   2e-30   
gb|KEH37736.1|  squamosa promoter-binding-like protein                  129   2e-30   
ref|NP_191562.1|  squamosa promoter-binding-like protein 12             129   2e-30   
ref|XP_006347011.1|  PREDICTED: squamosa promoter-binding protein...    119   2e-30   
ref|XP_009788762.1|  PREDICTED: squamosa promoter-binding-like pr...    126   2e-30   
ref|XP_007037628.1|  LIGULELESS1 protein, putative                      126   2e-30   
gb|KJB49225.1|  hypothetical protein B456_008G107300                    125   2e-30   
gb|KHN00315.1|  Squamosa promoter-binding-like protein 12               129   2e-30   
ref|XP_010650031.1|  PREDICTED: squamosa promoter-binding-like pr...    126   2e-30   
ref|XP_010650027.1|  PREDICTED: squamosa promoter-binding-like pr...    126   2e-30   
ref|XP_011006290.1|  PREDICTED: uncharacterized protein LOC105112316    126   2e-30   
ref|XP_004981153.1|  PREDICTED: squamosa promoter-binding-like pr...    129   2e-30   
ref|XP_009418241.1|  PREDICTED: squamosa promoter-binding-like pr...    125   2e-30   
ref|XP_010053955.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-30   
ref|XP_010555557.1|  PREDICTED: squamosa promoter-binding-like pr...    125   2e-30   
ref|XP_001781857.1|  predicted protein                                  117   2e-30   
gb|KHN00233.1|  Squamosa promoter-binding-like protein 1                127   2e-30   
ref|XP_003520534.1|  PREDICTED: squamosa promoter-binding-like pr...    124   2e-30   
gb|KHN03238.1|  Squamosa promoter-binding-like protein 1                128   2e-30   
ref|XP_004161490.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-30   
ref|XP_011100677.1|  PREDICTED: squamosa promoter-binding-like pr...    128   3e-30   
ref|XP_004136576.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-30   
ref|XP_007038017.1|  Squamosa promoter-binding protein isoform 1        124   3e-30   
ref|XP_003518623.1|  PREDICTED: squamosa promoter-binding-like pr...    128   3e-30   
dbj|BAM15476.1|  SBP-box protein                                        119   3e-30   
gb|ACL51015.1|  squamosa promoter-binding protein                       124   3e-30   
ref|XP_009402494.1|  PREDICTED: squamosa promoter-binding-like pr...    128   3e-30   
gb|KDO50160.1|  hypothetical protein CISIN_1g046416mg                   124   3e-30   
ref|XP_008443072.1|  PREDICTED: squamosa promoter-binding-like pr...    124   3e-30   
ref|XP_006429837.1|  hypothetical protein CICLE_v10011938mg             124   3e-30   
ref|XP_006492888.1|  PREDICTED: squamosa promoter-binding-like pr...    124   3e-30   
ref|XP_006429836.1|  hypothetical protein CICLE_v10011938mg             124   3e-30   
ref|XP_009788885.1|  PREDICTED: squamosa promoter-binding-like pr...    120   3e-30   
gb|AHW57562.1|  squamosa promoter-binding-like protein 17               124   3e-30   
gb|EMT19900.1|  Squamosa promoter-binding-like protein 17               124   3e-30   
ref|XP_002519316.1|  Squamosa promoter-binding protein, putative        128   3e-30   
ref|XP_004236071.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-30   
ref|XP_004308484.1|  PREDICTED: squamosa promoter-binding-like pr...    125   3e-30   
ref|XP_009627050.1|  PREDICTED: squamosa promoter-binding-like pr...    125   4e-30   
ref|XP_006838197.1|  hypothetical protein AMTR_s00106p00142470          122   4e-30   
gb|KHG15101.1|  Squamosa promoter-binding-like protein 6                125   4e-30   
gb|EYU39920.1|  hypothetical protein MIMGU_mgv1a009499mg                124   4e-30   
ref|XP_010928443.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    124   4e-30   
ref|XP_007051257.1|  Squamosa promoter-binding protein, putative ...    127   4e-30   
ref|XP_007140980.1|  hypothetical protein PHAVU_008G157100g             124   4e-30   
ref|XP_009391832.1|  PREDICTED: squamosa promoter-binding-like pr...    124   4e-30   
ref|XP_007051258.1|  Squamosa promoter-binding protein, putative ...    127   4e-30   
ref|XP_002314996.2|  squamosa promoter-binding protein-like 6           125   4e-30   
ref|XP_004297084.1|  PREDICTED: squamosa promoter-binding-like pr...    127   4e-30   
ref|XP_007153485.1|  hypothetical protein PHAVU_003G039600g             125   4e-30   
gb|AIL95867.1|  SQUAMOSA promoter binding-like transcription factor     125   4e-30   
ref|XP_008782879.1|  PREDICTED: squamosa promoter-binding-like pr...    124   4e-30   
emb|CAI91313.1|  squamosa promoter binding protein 2                    122   5e-30   
ref|XP_009359778.1|  PREDICTED: squamosa promoter-binding-like pr...    127   5e-30   
ref|XP_006573218.1|  PREDICTED: squamosa promoter-binding-like pr...    123   5e-30   
gb|KHG18515.1|  Squamosa promoter-binding-like protein 7                123   5e-30   
gb|EYU44963.1|  hypothetical protein MIMGU_mgv1a015863mg                119   5e-30   
ref|XP_010102560.1|  Squamosa promoter-binding-like protein 15          124   5e-30   
ref|XP_010276543.1|  PREDICTED: squamosa promoter-binding-like pr...    127   5e-30   
ref|XP_004229181.1|  PREDICTED: squamosa promoter-binding-like pr...    127   5e-30   
ref|XP_006374432.1|  hypothetical protein POPTR_0015s07140g             125   5e-30   
ref|XP_006411480.1|  hypothetical protein EUTSA_v10016816mg             124   5e-30   
ref|XP_009381227.1|  PREDICTED: squamosa promoter-binding-like pr...    127   5e-30   
ref|XP_007052205.1|  Squamosa promoter-binding-like protein 10, p...    124   5e-30   
gb|KHG15102.1|  Squamosa promoter-binding-like protein 6                124   6e-30   
ref|XP_004957197.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-30   
ref|XP_009381220.1|  PREDICTED: squamosa promoter-binding-like pr...    127   6e-30   
gb|AIL95855.1|  SQUAMOSA promoter binding-like transcription factor     123   6e-30   
ref|XP_010091609.1|  Squamosa promoter-binding-like protein 6           124   6e-30   
gb|EYU46873.1|  hypothetical protein MIMGU_mgv1a000744mg                127   6e-30   
ref|XP_004168226.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-30   
ref|XP_009405686.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-30   
ref|XP_006856376.1|  hypothetical protein AMTR_s00047p00197010          124   6e-30   
ref|XP_008240879.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-30   
ref|XP_004490242.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    123   6e-30   
ref|XP_009400684.1|  PREDICTED: squamosa promoter-binding-like pr...    123   6e-30   
ref|XP_006345103.1|  PREDICTED: squamosa promoter-binding-like pr...    124   6e-30   
ref|XP_007225380.1|  hypothetical protein PRUPE_ppa000792mg             127   7e-30   
gb|KHG18540.1|  Squamosa promoter-binding-like protein 6                124   7e-30   
ref|XP_009625590.1|  PREDICTED: squamosa promoter-binding-like pr...    124   7e-30   
ref|XP_004495872.1|  PREDICTED: squamosa promoter-binding-like pr...    127   7e-30   
ref|XP_009336237.1|  PREDICTED: squamosa promoter-binding-like pr...    119   7e-30   
ref|XP_009395001.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-30   
ref|XP_009625592.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-30   
ref|XP_009625591.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-30   
ref|XP_011075166.1|  PREDICTED: squamosa promoter-binding-like pr...    123   7e-30   
ref|XP_010265853.1|  PREDICTED: squamosa promoter-binding-like pr...    124   7e-30   
ref|XP_009789490.1|  PREDICTED: squamosa promoter-binding-like pr...    124   7e-30   
gb|AIE89802.1|  SQUAMOSA promoter binding protein-like 13               127   7e-30   
ref|XP_007205341.1|  hypothetical protein PRUPE_ppa007056mg             123   8e-30   
ref|XP_009415427.1|  PREDICTED: squamosa promoter-binding-like pr...    123   8e-30   
ref|XP_009415426.1|  PREDICTED: squamosa promoter-binding-like pr...    123   8e-30   
ref|XP_002880278.1|  hypothetical protein ARALYDRAFT_483883             127   8e-30   
gb|KDP28000.1|  hypothetical protein JCGZ_19080                         127   8e-30   
gb|KJB19447.1|  hypothetical protein B456_003G102800                    124   8e-30   
ref|XP_006828742.1|  hypothetical protein AMTR_s00001p00058370          119   9e-30   
gb|EPS73767.1|  hypothetical protein M569_00989                         117   9e-30   
gb|KDP31377.1|  hypothetical protein JCGZ_11753                         124   9e-30   
ref|XP_003538904.1|  PREDICTED: squamosa promoter-binding-like pr...    118   9e-30   
gb|AIL95851.1|  SQUAMOSA promoter binding-like transcription factor     124   9e-30   
ref|XP_010663471.1|  PREDICTED: squamosa promoter-binding-like pr...    124   9e-30   
ref|XP_004138332.1|  PREDICTED: uncharacterized protein LOC101221286    124   9e-30   
ref|XP_008392088.1|  PREDICTED: squamosa promoter-binding-like pr...    123   9e-30   
gb|KDO70308.1|  hypothetical protein CISIN_1g009653mg                   124   9e-30   
ref|XP_008810336.1|  PREDICTED: squamosa promoter-binding-like pr...    127   9e-30   
ref|XP_010264332.1|  PREDICTED: squamosa promoter-binding-like pr...    123   9e-30   
gb|KHN29960.1|  Squamosa promoter-binding-like protein 6                122   9e-30   
ref|XP_009789489.1|  PREDICTED: squamosa promoter-binding-like pr...    123   9e-30   
ref|XP_004488200.1|  PREDICTED: squamosa promoter-binding-like pr...    127   9e-30   
gb|EAY95089.1|  hypothetical protein OsI_16903                          123   9e-30   
ref|XP_002265203.1|  PREDICTED: squamosa promoter-binding-like pr...    124   1e-29   
ref|NP_850468.1|  squamosa promoter-binding-like protein 1              126   1e-29   
ref|XP_008453304.1|  PREDICTED: squamosa promoter-binding-like pr...    124   1e-29   
ref|XP_002511638.1|  Squamosa promoter-binding protein, putative        121   1e-29   
gb|KDO70305.1|  hypothetical protein CISIN_1g009653mg                   124   1e-29   
ref|XP_006437881.1|  hypothetical protein CICLE_v10031270mg             124   1e-29   
gb|KJB80408.1|  hypothetical protein B456_013G095700                    124   1e-29   
ref|XP_006484237.1|  PREDICTED: squamosa promoter-binding-like pr...    124   1e-29   
ref|XP_009789491.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-29   
gb|KDP28815.1|  hypothetical protein JCGZ_14586                         123   1e-29   
emb|CAB56580.1|  squamosa promoter binding protein-like 1               126   1e-29   
ref|XP_008795752.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-29   
emb|CDO98702.1|  unnamed protein product                                126   1e-29   
ref|XP_003517942.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
ref|XP_008795751.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-29   
ref|XP_004304380.2|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-29   
ref|XP_006484238.1|  PREDICTED: squamosa promoter-binding-like pr...    123   1e-29   
gb|AIS93133.1|  squamosa promoter binding protein                       123   1e-29   
ref|XP_006437880.1|  hypothetical protein CICLE_v10031270mg             124   1e-29   
ref|XP_006850048.1|  hypothetical protein AMTR_s00022p00198330          122   1e-29   
gb|AIE89795.1|  SQUAMOSA promoter binding protein-like 6                122   1e-29   
ref|XP_006445345.1|  hypothetical protein CICLE_v10020532mg             123   1e-29   
ref|XP_003581504.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
gb|KJB80409.1|  hypothetical protein B456_013G095700                    123   1e-29   
ref|XP_008240953.1|  PREDICTED: LOW QUALITY PROTEIN: squamosa pro...    123   1e-29   
gb|EPS60588.1|  hypothetical protein M569_14215                         117   1e-29   
ref|XP_009376108.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
ref|XP_006348264.1|  PREDICTED: squamosa promoter-binding-like pr...    117   1e-29   
gb|AGP03032.1|  SQUAMOSA promoter binding protein-like protein 9        122   1e-29   
ref|XP_010554861.1|  PREDICTED: squamosa promoter-binding-like pr...    122   1e-29   
ref|XP_007203426.1|  hypothetical protein PRUPE_ppa021582mg             122   1e-29   
ref|XP_004957796.1|  PREDICTED: squamosa promoter-binding-like pr...    119   1e-29   
ref|XP_008666603.1|  PREDICTED: uncharacterized protein LOC100272...    126   1e-29   
ref|XP_010507933.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-29   
ref|XP_009773067.1|  PREDICTED: squamosa promoter-binding-like pr...    126   1e-29   
emb|CAN69561.1|  hypothetical protein VITISV_040028                     125   1e-29   
ref|XP_006419250.1|  hypothetical protein CICLE_v10004227mg             125   2e-29   
gb|KHN31114.1|  Squamosa promoter-binding-like protein 9                122   2e-29   
ref|XP_006378563.1|  hypothetical protein POPTR_0010s16370g             126   2e-29   
ref|XP_002962311.1|  hypothetical protein SELMODRAFT_28635              115   2e-29   
ref|XP_007220957.1|  hypothetical protein PRUPE_ppa024285mg             123   2e-29   
gb|EAZ39937.1|  hypothetical protein OsJ_24374                          118   2e-29   
ref|XP_009792000.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-29   
ref|XP_009596192.1|  PREDICTED: squamosa promoter-binding-like pr...    118   2e-29   
ref|XP_010928832.1|  PREDICTED: squamosa promoter-binding-like pr...    122   2e-29   
ref|XP_010559169.1|  PREDICTED: squamosa promoter-binding-like pr...    126   2e-29   
ref|NP_001051808.1|  Os03g0833300                                       126   2e-29   



>ref|XP_010316764.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Solanum 
lycopersicum]
 gb|ABH07904.1| squamosa promoter binding-like protein [Solanum lycopersicum]
Length=136

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 111/137 (81%), Gaps = 4/137 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            MET+K EGKRSI E    AE  EDE   VEED+K+KR LTLSGRKL G GS    CQV+ 
Sbjct  1    METNKWEGKRSITE----AEKEEDEHGSVEEDSKRKRVLTLSGRKLVGEGSAHPSCQVDQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM DAKPYHRRHKVCE H+K+P VLI+G+Q+RFCQQCSRFH LA+FD+AKRSCRRRL
Sbjct  57   CTADMADAKPYHRRHKVCEFHSKSPIVLISGLQKRFCQQCSRFHLLAEFDDAKRSCRRRL  116

Query  404  AGHNERRRRITYDPRGE  454
            AGHNERRR+ITYD  GE
Sbjct  117  AGHNERRRKITYDSHGE  133



>ref|XP_009602314.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Nicotiana tomentosiformis]
Length=136

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 110/140 (79%), Gaps = 4/140 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            ME +K EGKRS+NE +   E  E+ +ED    NK+KR LTLSGRK + GG     CQ+E 
Sbjct  1    MEDNKWEGKRSMNEAEEEEEEHENVEED----NKRKRVLTLSGRKQSSGGPALPSCQIEQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM DAKPYHRRHKVCE H+KAP VLI+G+QQRFCQQCSRFH+LA+FDEAKRSCRRRL
Sbjct  57   CTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLAEFDEAKRSCRRRL  116

Query  404  AGHNERRRRITYDPRGEGST  463
            AGHNERRR+ +YD  GE S+
Sbjct  117  AGHNERRRKTSYDSHGESSS  136



>gb|ABL89185.1| squamosa promoter binding protein-like protein [Capsicum annuum]
Length=136

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/137 (67%), Positives = 111/137 (81%), Gaps = 4/137 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M+T+K EGKR+INE +   +  E  +ED    NK+KR L+ SGRKL+GGGS+   CQVE 
Sbjct  1    MDTNKWEGKRTINEAEEEEDEHESVEED----NKRKRVLSPSGRKLSGGGSSHPSCQVEQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM +AKPYHRRHKVCE H+K+  VLI+G+QQRFCQQCSRFH LA+FDEAKRSCRRRL
Sbjct  57   CTADMANAKPYHRRHKVCEFHSKSSIVLISGLQQRFCQQCSRFHLLAEFDEAKRSCRRRL  116

Query  404  AGHNERRRRITYDPRGE  454
            AGHNERRR+I+YD +GE
Sbjct  117  AGHNERRRKISYDSQGE  133



>ref|XP_006347010.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Solanum tuberosum]
Length=136

 Score =   179 bits (454),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 108/137 (79%), Gaps = 4/137 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            MET+K EGKRSINE +   +  E  +ED    +K+KR LTLSGRKL G GS    CQV+ 
Sbjct  1    METNKWEGKRSINEAEEEEDEHESVEED----SKRKRVLTLSGRKLAGEGSAHPSCQVDQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT +M DAKPYHRRHKVCE H+K+P VLI+G+QQRFCQQCSRFH LA+FD AKRSCRRRL
Sbjct  57   CTANMADAKPYHRRHKVCEFHSKSPIVLISGLQQRFCQQCSRFHLLAEFDGAKRSCRRRL  116

Query  404  AGHNERRRRITYDPRGE  454
            AGHNERRR+ITYD  GE
Sbjct  117  AGHNERRRKITYDSHGE  133



>emb|CDO99517.1| unnamed protein product [Coffea canephora]
Length=137

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/139 (69%), Positives = 113/139 (81%), Gaps = 3/139 (2%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTG-GGSTQLFCQVE  220
            ME SK EGKRS+ +    AE   D+DEDV E++KK+RALTLSG K TG  G  Q  CQV+
Sbjct  1    MEASKAEGKRSMKQV--AAEEDGDDDEDVGEESKKRRALTLSGEKATGISGPIQPSCQVD  58

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DC+ DM D+KPYHRRHKVCE H+KAP VL+ GV+QRFCQQCSRFH+L++FDEAKRSCRRR
Sbjct  59   DCSADMKDSKPYHRRHKVCEHHSKAPIVLVAGVRQRFCQQCSRFHDLSEFDEAKRSCRRR  118

Query  401  LAGHNERRRRITYDPRGEG  457
            LAGHNERRR+ +YD RGEG
Sbjct  119  LAGHNERRRKSSYDSRGEG  137



>ref|XP_009763062.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X2 
[Nicotiana sylvestris]
Length=133

 Score =   177 bits (450),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 107/140 (76%), Gaps = 7/140 (5%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            ME +K EGKRS+NE +   E  E++       NK+KR LTLSGR L+GGG     CQVE 
Sbjct  1    MEDNKWEGKRSMNEAEEEHENAEED-------NKRKRVLTLSGRNLSGGGPALPSCQVEQ  53

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM  AKPYHRRHKVCE H+KAP VLI+G+QQRFCQQCSRFH+L +FDEAKRSCRRRL
Sbjct  54   CTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRFHQLPEFDEAKRSCRRRL  113

Query  404  AGHNERRRRITYDPRGEGST  463
            AGHNERRR+ +YD  GE S+
Sbjct  114  AGHNERRRKTSYDSHGESSS  133



>ref|XP_009602313.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Nicotiana tomentosiformis]
Length=138

 Score =   177 bits (450),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 110/142 (77%), Gaps = 6/142 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            ME +K EGKRS+NE +   E  E+ +ED    NK+KR LTLSGRK + GG     CQ+E 
Sbjct  1    MEDNKWEGKRSMNEAEEEEEEHENVEED----NKRKRVLTLSGRKQSSGGPALPSCQIEQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQC--SRFHELAQFDEAKRSCRR  397
            CT DM DAKPYHRRHKVCE H+KAP VLI+G+QQRFCQQC  SRFH+LA+FDEAKRSCRR
Sbjct  57   CTADMADAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRSRFHQLAEFDEAKRSCRR  116

Query  398  RLAGHNERRRRITYDPRGEGST  463
            RLAGHNERRR+ +YD  GE S+
Sbjct  117  RLAGHNERRRKTSYDSHGESSS  138



>ref|XP_009763061.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Nicotiana sylvestris]
Length=135

 Score =   172 bits (437),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 92/142 (65%), Positives = 107/142 (75%), Gaps = 9/142 (6%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            ME +K EGKRS+NE +   E  E++       NK+KR LTLSGR L+GGG     CQVE 
Sbjct  1    MEDNKWEGKRSMNEAEEEHENAEED-------NKRKRVLTLSGRNLSGGGPALPSCQVEQ  53

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQC--SRFHELAQFDEAKRSCRR  397
            CT DM  AKPYHRRHKVCE H+KAP VLI+G+QQRFCQQC  SRFH+L +FDEAKRSCRR
Sbjct  54   CTADMAGAKPYHRRHKVCEFHSKAPVVLISGIQQRFCQQCSRSRFHQLPEFDEAKRSCRR  113

Query  398  RLAGHNERRRRITYDPRGEGST  463
            RLAGHNERRR+ +YD  GE S+
Sbjct  114  RLAGHNERRRKTSYDSHGESSS  135



>ref|XP_009622640.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana tomentosiformis]
 ref|XP_009622641.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana tomentosiformis]
Length=140

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 114/141 (81%), Gaps = 2/141 (1%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQL-FCQVE  220
            METSK E KRS+   + + E  ++EDEDV EDNK+KR LT SGRK+ GG  ++L  CQ+E
Sbjct  1    METSKWEEKRSMTAAE-MEEEDDEEDEDVVEDNKRKRVLTHSGRKVPGGEGSKLPSCQIE  59

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DCT DM +AK YHRRHKVCE HAKAP+VLI G++QRFCQQCSRFH+L +FDEAKRSCRRR
Sbjct  60   DCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFCQQCSRFHQLGEFDEAKRSCRRR  119

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+ + D  GEGS+
Sbjct  120  LAGHNERRRKSSCDSPGEGSS  140



>ref|XP_009760116.1| PREDICTED: squamosa promoter-binding protein 1 [Nicotiana sylvestris]
Length=136

 Score =   169 bits (427),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 95/141 (67%), Positives = 113/141 (80%), Gaps = 6/141 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQL-FCQVE  220
            METSK E KRS+     + E  ++EDEDV EDNK+KR LT SGRK+ GG  ++L  CQ+E
Sbjct  1    METSKWEEKRSM-----MEEEDDEEDEDVVEDNKRKRVLTRSGRKVPGGEGSKLPSCQIE  55

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DCT DM +AK YHRRHKVCE HAKAP+VLI G++QRFCQQCSRFH+L +FDEAKRSCRRR
Sbjct  56   DCTADMANAKTYHRRHKVCEFHAKAPAVLIGGLRQRFCQQCSRFHQLGEFDEAKRSCRRR  115

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+ + D  GEGS+
Sbjct  116  LAGHNERRRKSSCDSPGEGSS  136



>ref|XP_011096328.1| PREDICTED: squamosa promoter-binding protein 1 [Sesamum indicum]
Length=131

 Score =   167 bits (423),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 87/134 (65%), Positives = 101/134 (75%), Gaps = 6/134 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTG-GGSTQLFCQVE  220
            METSK  GKR     +   E  +  ++     NKKKRAL+ S R+++G GGSTQ  CQVE
Sbjct  1    METSKEAGKRIAELDEEGEEDEDAGED-----NKKKRALSPSKRRVSGAGGSTQRSCQVE  55

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DCT DM DA+PYHRRHKVCE HAKA  V + G+QQRFCQQCSRFHEL +FDEAKRSCRRR
Sbjct  56   DCTADMADARPYHRRHKVCEFHAKAAVVFLAGLQQRFCQQCSRFHELQEFDEAKRSCRRR  115

Query  401  LAGHNERRRRITYD  442
            LAGHNERRR+ +YD
Sbjct  116  LAGHNERRRKSSYD  129



>gb|AIE89804.1| SQUAMOSA promoter binding protein-like 15, partial [Salvia miltiorrhiza]
Length=133

 Score =   166 bits (421),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 91/134 (68%), Positives = 108/134 (81%), Gaps = 3/134 (2%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTG-GGSTQLFCQVE  220
            METSK EGKR +   +   +   ++DED  ED+KKK ALT S R+++G GGSTQ  CQ E
Sbjct  1    METSKEEGKRILLVPE--LDEEGEDDEDTGEDSKKKGALTPSKRRVSGAGGSTQRSCQAE  58

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DCT DM DAKPYHRRHKVCE HAKA  VL++G++QRFCQQCSRFHEL++FDEAKRSCRRR
Sbjct  59   DCTADMADAKPYHRRHKVCEFHAKAAVVLLSGLRQRFCQQCSRFHELSEFDEAKRSCRRR  118

Query  401  LAGHNERRRRITYD  442
            LAGHNERRR+ +YD
Sbjct  119  LAGHNERRRKSSYD  132



>ref|XP_006361029.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
tuberosum]
Length=135

 Score =   165 bits (418),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 107/141 (76%), Gaps = 7/141 (5%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLT-GGGSTQLFCQVE  220
            ME SK EGKR++ E D   +    ED       K+KR LT SGRK++ G GS Q  CQVE
Sbjct  1    MENSKWEGKRNMEEEDDEEDENAVED------TKRKRVLTRSGRKVSMGEGSRQPSCQVE  54

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            DCT DM +AK YH RHKVCE HAKAP+VLI+G++QRFCQQCSRFH+LA+FD+AK+SCRRR
Sbjct  55   DCTADMVNAKTYHCRHKVCEFHAKAPAVLIDGLRQRFCQQCSRFHQLAEFDDAKKSCRRR  114

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+  +D  GEGS+
Sbjct  115  LAGHNERRRKSAHDSPGEGSS  135



>gb|AGR34081.1| squamosa promoter binding protein-like 4, partial [Pogostemon 
cablin]
Length=182

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 90/144 (63%), Positives = 109/144 (76%), Gaps = 3/144 (2%)
 Frame = +2

Query  14   FFPTSFTIKEMETSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTG-G  190
            F  +    +EME SK EGKR I   +   EG EDE+   +  NKK+ ALT S R+++G G
Sbjct  39   FTHSLLLAEEMEASKEEGKRIIEVPEYDEEGEEDEEVGDD--NKKRGALTPSKRRVSGAG  96

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            GSTQ  CQVEDCT DM D KPYHRRHKVCE HAKA  VL++G++QRFCQQCSRFH++++F
Sbjct  97   GSTQRSCQVEDCTADMNDVKPYHRRHKVCEYHAKAAVVLLSGIRQRFCQQCSRFHDVSEF  156

Query  371  DEAKRSCRRRLAGHNERRRRITYD  442
            DEAKRSCR RLAGHNERRR+ +YD
Sbjct  157  DEAKRSCRGRLAGHNERRRKSSYD  180



>ref|XP_004248108.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
lycopersicum]
Length=135

 Score =   163 bits (412),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 89/141 (63%), Positives = 105/141 (74%), Gaps = 7/141 (5%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKL-TGGGSTQLFCQVE  220
            ME +K EGKRS+ E D   +    ED       K+KR LT SGRK+ T  GS Q  CQVE
Sbjct  1    MENNKWEGKRSMEEDDDEEDEDVVED------TKRKRVLTRSGRKVSTAEGSRQPSCQVE  54

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DM +AK YHRRHKVCE HAKAP VLI+G++QRFCQQCSRFH+LA+FD+AK+SCRRR
Sbjct  55   ECTADMVNAKTYHRRHKVCEFHAKAPEVLIDGLRQRFCQQCSRFHQLAEFDDAKKSCRRR  114

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+   D  GEGS+
Sbjct  115  LAGHNERRRKSAQDYPGEGSS  135



>sp|Q38741.1|SBP1_ANTMA RecName: Full=Squamosa promoter-binding protein 1 [Antirrhinum 
majus]
 emb|CAA63113.1| squamosa-promoter binding protein 1 [Antirrhinum majus]
Length=131

 Score =   162 bits (409),  Expect = 7e-47, Method: Compositional matrix adjust.
 Identities = 88/133 (66%), Positives = 108/133 (81%), Gaps = 4/133 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M+TSK EGKR I    S  +   +E++D+ ED+KK RALT SG++ +G  STQ  CQVE+
Sbjct  1    MDTSKGEGKRVIKLPGS--QEQGEEEDDIGEDSKKTRALTPSGKRASG--STQRSCQVEN  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            C  +MT+AKPYHRRHKVCE HAKAP VL +G+QQRFCQQCSRFHEL++FDEAKRSCRRRL
Sbjct  57   CAAEMTNAKPYHRRHKVCEFHAKAPVVLHSGLQQRFCQQCSRFHELSEFDEAKRSCRRRL  116

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ ++D
Sbjct  117  AGHNERRRKSSHD  129



>ref|XP_007025578.1| Squamosa promoter binding protein-like 3 [Theobroma cacao]
 gb|EOY28200.1| Squamosa promoter binding protein-like 3 [Theobroma cacao]
Length=141

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 85/140 (61%), Positives = 99/140 (71%), Gaps = 0/140 (0%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M TS+ EGKRS+ E     E  EDED        +++         TGGGS    CQVE+
Sbjct  1    MATSRAEGKRSLKEMAEDEEEEEDEDAGALGFVDEEKKKKGKRGSSTGGGSALPSCQVEN  60

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CTTDM DAK YHRRHKVCE HAKAP V ++G+QQRFCQQCSRFHEL++FDEAKRSCRRRL
Sbjct  61   CTTDMNDAKRYHRRHKVCEFHAKAPVVRVSGLQQRFCQQCSRFHELSEFDEAKRSCRRRL  120

Query  404  AGHNERRRRITYDPRGEGST  463
            AGHNERRR+ + +  GEGS 
Sbjct  121  AGHNERRRKSSSEYHGEGSN  140



>gb|EYU27990.1| hypothetical protein MIMGU_mgv1a015969mg [Erythranthe guttata]
Length=139

 Score =   155 bits (391),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 90/138 (65%), Positives = 106/138 (77%), Gaps = 4/138 (3%)
 Frame = +2

Query  44   METSKPEGKR--SINETDSVAeggedededveedNKKKRALTLSGRKLT--GGGSTQLFC  211
            ME  K EGK+   ++E +   E  ED+DED E+DNKKKRALT   R+ +  GGGSTQ  C
Sbjct  1    MEEDKEEGKKITVVSELEEEGEEEEDDDEDFEDDNKKKRALTPCKRRASSVGGGSTQRSC  60

Query  212  QVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSC  391
            QVEDC  DM  AK YHRRHKVCE HAKA  VL++ ++QRFCQQCSRFHEL++FDEAKRSC
Sbjct  61   QVEDCLADMNAAKAYHRRHKVCEFHAKATVVLLSELRQRFCQQCSRFHELSEFDEAKRSC  120

Query  392  RRRLAGHNERRRRITYDP  445
            RRRLAGHNERRR+ +YD 
Sbjct  121  RRRLAGHNERRRKSSYDS  138



>gb|KJB68767.1| hypothetical protein B456_011G029400 [Gossypium raimondii]
Length=146

 Score =   151 bits (381),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = +2

Query  41   EMETSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVE  220
            EM TSK EGKR + E     E  E+++++    +  K+     G     GGS    CQVE
Sbjct  5    EMATSKAEGKRRLKEMAEEEEEEEEDEDNSTTGDDDKKKKGKRGSSTVVGGSCPPACQVE  64

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DMTDAK YHRRHKVCE HAKAP V + G+ QRFCQQCSRFHEL++FDE KRSCRRR
Sbjct  65   NCTADMTDAKRYHRRHKVCEFHAKAPVVRVAGIHQRFCQQCSRFHELSEFDETKRSCRRR  124

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+ + +  GEGS 
Sbjct  125  LAGHNERRRKSSSEYHGEGSN  145



>gb|KJB68768.1| hypothetical protein B456_011G029400 [Gossypium raimondii]
Length=195

 Score =   151 bits (381),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 81/141 (57%), Positives = 97/141 (69%), Gaps = 0/141 (0%)
 Frame = +2

Query  41   EMETSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVE  220
            EM TSK EGKR + E     E  E+++++    +  K+     G     GGS    CQVE
Sbjct  54   EMATSKAEGKRRLKEMAEEEEEEEEDEDNSTTGDDDKKKKGKRGSSTVVGGSCPPACQVE  113

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DMTDAK YHRRHKVCE HAKAP V + G+ QRFCQQCSRFHEL++FDE KRSCRRR
Sbjct  114  NCTADMTDAKRYHRRHKVCEFHAKAPVVRVAGIHQRFCQQCSRFHELSEFDETKRSCRRR  173

Query  401  LAGHNERRRRITYDPRGEGST  463
            LAGHNERRR+ + +  GEGS 
Sbjct  174  LAGHNERRRKSSSEYHGEGSN  194



>ref|XP_002280052.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI30591.3| unnamed protein product [Vitis vinifera]
Length=140

 Score =   149 bits (375),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 78/130 (60%), Positives = 100/130 (77%), Gaps = 2/130 (2%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGG-GSTQLFCQVE  220
            ME SK +GKR++ E     +  +       ED KKK+A+TL+ +K +GG GST   CQV+
Sbjct  1    MEMSKAQGKRTLMEE-EEEDDEDTVGLGFGEDEKKKKAVTLTNKKGSGGAGSTPPSCQVD  59

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DM++AK YH+RH+VCE HAKAP +LI G+QQRFCQQCSRFHEL++FD+ KRSCRRR
Sbjct  60   NCTADMSEAKRYHKRHRVCEHHAKAPVILIAGIQQRFCQQCSRFHELSEFDDTKRSCRRR  119

Query  401  LAGHNERRRR  430
            LAGHNERRR+
Sbjct  120  LAGHNERRRK  129



>ref|XP_011043824.1| PREDICTED: squamosa promoter-binding protein 1-like [Populus 
euphratica]
Length=196

 Score =   150 bits (379),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 71/108 (66%), Positives = 88/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  143  KKKRALTLSGRKLTG-GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            KKK A  + G++ TG GG++   CQVE C  ++TDAK YHRRHKVCE+HAK+P+V++ G+
Sbjct  49   KKKGAGVMHGKRGTGSGGASPPSCQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGL  108

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +QRFCQQCSRFHELA+FDE KRSCRRRLAGHNERRR+ T +  GEGS 
Sbjct  109  RQRFCQQCSRFHELAEFDETKRSCRRRLAGHNERRRKSTAESYGEGSN  156



>ref|XP_002305783.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa]
 gb|EEE86294.2| hypothetical protein POPTR_0004s04630g [Populus trichocarpa]
Length=148

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 79/87 (91%), Gaps = 0/87 (0%)
 Frame = +2

Query  203  LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAK  382
            + CQV++CTTDMTDAK YH+RHKVCE HAKA SVL+NGV+QRFCQQCSRFH+L++FD++K
Sbjct  62   ISCQVKNCTTDMTDAKRYHKRHKVCEFHAKASSVLVNGVEQRFCQQCSRFHDLSEFDDSK  121

Query  383  RSCRRRLAGHNERRRRITYDPRGEGST  463
            RSCRRRLAGHNERRR+ + D +GEGS 
Sbjct  122  RSCRRRLAGHNERRRKSSSDNQGEGSN  148



>ref|XP_006467766.1| PREDICTED: squamosa promoter-binding-like protein 3-like [Citrus 
sinensis]
Length=195

 Score =   149 bits (375),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 80/145 (55%), Positives = 99/145 (68%), Gaps = 3/145 (2%)
 Frame = +2

Query  38   KEMETSKPEGKRSINETDSVAeggedededveedNK---KKRALTLSGRKLTGGGSTQLF  208
            K+ME S+ EGKRS+ E D   E  +++        +   KK+    S     GG +T + 
Sbjct  51   KKMEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSAGAGGPTTFVS  110

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE+C  DMTDAK YHRRHKVC+ HAKAP V + G+ QRFCQQCSRFHEL++FD+ KRS
Sbjct  111  CQVENCRADMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRS  170

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + D  GEGS 
Sbjct  171  CRRRLAGHNERRRKSSADYHGEGSN  195



>ref|XP_006370233.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa]
 gb|ERP66802.1| hypothetical protein POPTR_0001s40870g [Populus trichocarpa]
Length=196

 Score =   148 bits (374),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/108 (65%), Positives = 87/108 (81%), Gaps = 1/108 (1%)
 Frame = +2

Query  143  KKKRALTLSGRKLTG-GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            KKK A  + G++ TG GG++   CQVE C  ++TDAK YHRRHKVCE+HAK+P+V++ G+
Sbjct  49   KKKGAGVMHGKRGTGSGGASPPSCQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGL  108

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +QRFCQQCSRFHEL +FDE KRSCRRRLAGHNERRR+ T +  GEGS 
Sbjct  109  RQRFCQQCSRFHELVEFDETKRSCRRRLAGHNERRRKSTAESYGEGSN  156



>gb|ADY75712.1| SPL3-like protein [Eucalyptus globulus]
Length=147

 Score =   147 bits (370),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/109 (65%), Positives = 84/109 (77%), Gaps = 2/109 (2%)
 Frame = +2

Query  143  KKKRALTLSGRK--LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLING  316
            K+ RA T S RK     G +    CQ E+C+ DMTDAK YHRRHKVCE HAKA   ++ G
Sbjct  39   KRARAATRSTRKGGSCSGWAPPPMCQAENCSIDMTDAKRYHRRHKVCEFHAKASVAMVAG  98

Query  317  VQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            ++QRFCQQCSRFHEL++FDEAKRSCRRRLAGHNERRR+ +YD +GEGS 
Sbjct  99   LRQRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSYDNQGEGSN  147



>gb|KDO77620.1| hypothetical protein CISIN_1g032310mg [Citrus sinensis]
Length=143

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/143 (55%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNK---KKRALTLSGRKLTGGGSTQLFCQ  214
            ME S+ EGKRS+ E D   E  +++        +   KK+    S     GG +T + CQ
Sbjct  1    MEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSAGAGGPTTFVSCQ  60

Query  215  VEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCR  394
            VE+C  +MTDAK YHRRHKVC+ HAKAP V + G+ QRFCQQCSRFHEL++FD+ KRSCR
Sbjct  61   VENCRANMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRSCR  120

Query  395  RRLAGHNERRRRITYDPRGEGST  463
            RRLAGHNERRR+ + D  GEGS 
Sbjct  121  RRLAGHNERRRKSSADYHGEGSN  143



>ref|XP_010057392.1| PREDICTED: squamosa promoter-binding-like protein 3 [Eucalyptus 
grandis]
 gb|KCW74549.1| hypothetical protein EUGRSUZ_E03260 [Eucalyptus grandis]
Length=147

 Score =   145 bits (366),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 70/109 (64%), Positives = 83/109 (76%), Gaps = 2/109 (2%)
 Frame = +2

Query  143  KKKRALTLSGRK--LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLING  316
            K+ RA T S RK     G +    CQ E+C+ DMTDAK YHRRHKVCE HAKA   ++ G
Sbjct  39   KRARAATRSTRKGGSCSGWAPPPLCQAENCSVDMTDAKRYHRRHKVCEFHAKASVAMVAG  98

Query  317  VQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            ++QRFCQQCSRFHEL++FDE KRSCRRRLAGHNERRR+ +YD +GEGS 
Sbjct  99   LRQRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRKSSYDNQGEGSN  147



>ref|XP_011027797.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Populus euphratica]
Length=148

 Score =   145 bits (365),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/148 (53%), Positives = 98/148 (66%), Gaps = 8/148 (5%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQ-------  202
            M TSK EGKR++NE +   E  ++ED                GRK +             
Sbjct  1    MGTSKAEGKRNLNEIEDEEEDDDEEDVYTGLGFGDDDNTKKKGRKGSAYDGGSGRSSSGP  60

Query  203  -LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEA  379
             + CQ ++CT DMTDAK YH+RHKVCE HAKA SV++NGVQQRFCQQCSRFH+L++FD++
Sbjct  61   PISCQAKNCTADMTDAKRYHKRHKVCEFHAKASSVIVNGVQQRFCQQCSRFHDLSEFDDS  120

Query  380  KRSCRRRLAGHNERRRRITYDPRGEGST  463
            KRSCR RLAGHNERRR+ + D +GEGS 
Sbjct  121  KRSCRMRLAGHNERRRKSSSDNQGEGSN  148



>gb|AIL95848.1| SQUAMOSA promoter binding-like transcription factor [Gossypium 
hirsutum]
Length=141

 Score =   144 bits (362),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 78/140 (56%), Positives = 94/140 (67%), Gaps = 0/140 (0%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M TSK EGKR + E     E  E+++++    +  K+     G     GGS    CQVE+
Sbjct  1    MATSKAEGKRRLKEMGEEEEEEEEDEDNSTTGDDDKKKKGKGGSSTVVGGSCLPACQVEN  60

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DMTDAK YHRRHKVCE HAKA  V + G+ QRFCQQCSRFHEL++ DE KRSCRRRL
Sbjct  61   CTADMTDAKRYHRRHKVCEFHAKAAVVRVAGIHQRFCQQCSRFHELSESDETKRSCRRRL  120

Query  404  AGHNERRRRITYDPRGEGST  463
            AGHNERRR+ + +  GEGS 
Sbjct  121  AGHNERRRKSSSEYHGEGSN  140



>gb|ADG59812.1| SQUAMOSA-promoter binding protein 1, partial [Erythranthe guttata]
Length=93

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
             GGGSTQ  CQVEDC  DM  AK YHRRHKVCE HAKA  VL + ++QRFCQQCSRFHEL
Sbjct  5    VGGGSTQRSCQVEDCLADMNAAKAYHRRHKVCEFHAKATVVLPSELRQRFCQQCSRFHEL  64

Query  362  AQFDEAKRSCRRRLAGHNERRRRITYDP  445
            ++FDEAKRSCRRRLAGHNERRR+ +YD 
Sbjct  65   SEFDEAKRSCRRRLAGHNERRRKSSYDS  92



>ref|XP_010675500.1| PREDICTED: squamosa promoter-binding-like protein 4 [Beta vulgaris 
subsp. vulgaris]
Length=252

 Score =   146 bits (368),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 78/99 (79%), Gaps = 0/99 (0%)
 Frame = +2

Query  203  LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAK  382
            + CQ E CT D+TDAK YHRRHKVCE HAKAPSVL++ ++QRFCQQCSRFHEL++FDE K
Sbjct  124  ISCQAEKCTADLTDAKRYHRRHKVCEFHAKAPSVLVSNLRQRFCQQCSRFHELSEFDETK  183

Query  383  RSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            RSCRRRLAGHNERRR+ + D +GEG +    T G   Q 
Sbjct  184  RSCRRRLAGHNERRRKSSSDTQGEGGSSSNQTKGNNPQF  222



>ref|XP_010479860.1| PREDICTED: squamosa promoter-binding-like protein 4 [Camelina 
sativa]
Length=180

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 74/122 (61%), Positives = 92/122 (75%), Gaps = 6/122 (5%)
 Frame = +2

Query  143  KKKRALTLSGRKLTG----GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLI  310
            +K++ L    R+ +G    GGS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV +
Sbjct  37   EKRKGLMDGVRRSSGSIDRGGSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFL  95

Query  311  NGVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGT  490
            +GV QRFCQQCSRFHEL +FDEAKRSCRRRLAGHNERRR+ + +  GEGS  RR  +G  
Sbjct  96   SGVSQRFCQQCSRFHELQEFDEAKRSCRRRLAGHNERRRKSSGESFGEGSG-RRGITGQV  154

Query  491  NQ  496
             Q
Sbjct  155  IQ  156



>ref|XP_004146058.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 ref|XP_004165557.1| PREDICTED: squamosa promoter-binding-like protein 4-like [Cucumis 
sativus]
 gb|KGN55117.1| Squamosa promoter-binding protein [Cucumis sativus]
Length=202

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 83/107 (78%), Gaps = 0/107 (0%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            KKKR   +SGR  +GG  +   CQ  +C  D+++AK YHRRHKVCE H+KA  V++ G++
Sbjct  54   KKKRGAAVSGRGKSGGSVSLPSCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIR  113

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QRFCQQCSRFHEL +FDEAKRSCRRRLAGHNERRR+ + + +GE ++
Sbjct  114  QRFCQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKSSAESQGESTS  160



>ref|XP_002533086.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF29301.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=198

 Score =   142 bits (359),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D+TDAK YHRRHKVCEIHAKAP+V++ G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  73   CQVERCGADLTDAKRYHRRHKVCEIHAKAPAVVVAGLRQRFCQQCSRFHELVEFDEAKRS  132

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + +  GEGS+
Sbjct  133  CRRRLAGHNERRRKSSAESYGEGSS  157



>ref|XP_010500948.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Camelina sativa]
Length=177

 Score =   142 bits (357),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS++L CQV+ CT+D+ +AK YHRRHKVCE+HAKA SV ++GV QRFCQQCSRFHEL +
Sbjct  57   GGSSRL-CQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQE  115

Query  368  FDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLL  502
            FDEAKRSCRRRLAGHNERRR+ + +  GEGS      +G T Q++
Sbjct  116  FDEAKRSCRRRLAGHNERRRKSSGESFGEGS----GRTGITGQVI  156



>ref|XP_006449372.1| hypothetical protein CICLE_v10017104mg [Citrus clementina]
 gb|ESR62612.1| hypothetical protein CICLE_v10017104mg [Citrus clementina]
Length=143

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 79/143 (55%), Positives = 97/143 (68%), Gaps = 3/143 (2%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNK---KKRALTLSGRKLTGGGSTQLFCQ  214
            ME S+ EGKRS+ E D   E  +++        +   KK+    S     GG +T + CQ
Sbjct  1    MEASRAEGKRSLKEDDQEEEEDDEDSGGGIAGEEDKIKKKGKRGSSSAGAGGATTCVSCQ  60

Query  215  VEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCR  394
            VE+C  DMTDAK YHRRHKVC+ HAKAP V + G+ QRFCQQCSRFHEL++FD+ KRSCR
Sbjct  61   VENCGADMTDAKKYHRRHKVCDFHAKAPVVRVEGLAQRFCQQCSRFHELSEFDDTKRSCR  120

Query  395  RRLAGHNERRRRITYDPRGEGST  463
            RRLAGHNERRR+ + D  GEGS 
Sbjct  121  RRLAGHNERRRKSSADYHGEGSN  143



>ref|XP_010500947.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Camelina sativa]
Length=185

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 85/105 (81%), Gaps = 5/105 (5%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS++L CQV+ CT+D+ +AK YHRRHKVCE+HAKA SV ++GV QRFCQQCSRFHEL +
Sbjct  57   GGSSRL-CQVDRCTSDLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQE  115

Query  368  FDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLL  502
            FDEAKRSCRRRLAGHNERRR+ + +  GEGS      +G T Q++
Sbjct  116  FDEAKRSCRRRLAGHNERRRKSSGESFGEGS----GRTGITGQVI  156



>ref|XP_007148144.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris]
 gb|ESW20138.1| hypothetical protein PHAVU_006G183900g [Phaseolus vulgaris]
Length=138

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/131 (56%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +2

Query  44   METSKPEGKRSIN--ETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQV  217
            M+ S  EGKRS+N  + +   E  E+E+     ++ +K+ +  + R    GGS    CQV
Sbjct  1    MDESWSEGKRSMNYKDDEDDYEEEEEEEGSEYGEDGRKKRVAPNKRASKAGGSMPPSCQV  60

Query  218  EDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRR  397
            + C  D++DAKPYHRRHKVCE HAKAP+VLI    QRFCQQCSRFHEL++FDE+KRSCRR
Sbjct  61   DGCNADLSDAKPYHRRHKVCEYHAKAPAVLIAEHHQRFCQQCSRFHELSEFDESKRSCRR  120

Query  398  RLAGHNERRRR  430
            RLAGHNERRR+
Sbjct  121  RLAGHNERRRK  131



>ref|XP_006451806.1| hypothetical protein CICLE_v10009879mg [Citrus clementina]
 ref|XP_006464784.1| PREDICTED: squamosa promoter-binding-like protein 13-like [Citrus 
sinensis]
 gb|ESR65046.1| hypothetical protein CICLE_v10009879mg [Citrus clementina]
 gb|KDO62546.1| hypothetical protein CISIN_1g032937mg [Citrus sinensis]
Length=130

 Score =   139 bits (351),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            +KK+A   +GR+    G++   C VE C TD+TDA+ YHRRHKVCE H+KAP V++ G++
Sbjct  20   RKKKA---TGRRAAPAGTSSPCCMVEKCGTDLTDARRYHRRHKVCETHSKAPVVIVAGLR  76

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QRFCQQCSRFHEL +FDE KRSCRRRLAGHNERRR+ T +  GEGS+
Sbjct  77   QRFCQQCSRFHELYEFDETKRSCRRRLAGHNERRRKSTAETTGEGSS  123



>emb|CDY25876.1| BnaA05g14670D [Brassica napus]
Length=176

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/99 (68%), Positives = 81/99 (82%), Gaps = 3/99 (3%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CTTD+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  56   LCQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKR  115

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLL  502
            SCRRRLAGHNERRR+ + +  GEG+  RR   G T+Q++
Sbjct  116  SCRRRLAGHNERRRKSSGESFGEGAGGRR---GVTSQVM  151



>ref|XP_002509450.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF50837.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=141

 Score =   140 bits (352),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 77/140 (55%), Positives = 96/140 (69%), Gaps = 1/140 (1%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQ-LFCQVE  220
            M TSK EGKRS+ E +   E  +DED        +        +  +  GS   + CQ E
Sbjct  1    MATSKAEGKRSLKEMEDDEEEEDDEDGGCGLGFSEDEKKRKGKKGSSASGSMPPVSCQAE  60

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DMT+AK YHRRHKVCE HAKAP VL++G+ QRFCQQCSRFHE+++FD+ KRSCRRR
Sbjct  61   NCTFDMTEAKRYHRRHKVCEHHAKAPCVLVSGIHQRFCQQCSRFHEVSEFDDTKRSCRRR  120

Query  401  LAGHNERRRRITYDPRGEGS  460
            LAGHNERRR+ + +  GEGS
Sbjct  121  LAGHNERRRKSSSEYHGEGS  140



>ref|XP_007159345.1| hypothetical protein PHAVU_002G230300g [Phaseolus vulgaris]
 gb|ESW31339.1| hypothetical protein PHAVU_002G230300g [Phaseolus vulgaris]
Length=200

 Score =   142 bits (357),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 105/159 (66%), Gaps = 10/159 (6%)
 Frame = +2

Query  8    SYFFPTSFTIKE--METSKPEGKRSI------NETDSVAeggedededveedNKKKRALT  163
            S+F  T F I E  M+ S+ EGKR +       E +   E  E E    EE  + KR +T
Sbjct  42   SFFLTTFFWISEEFMDASRSEGKRVLRYNEEEEEDEEEEEEEEVETGFGEEGRRNKRVMT  101

Query  164  -LSGRKLT-GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
             L G+K +  GGS    CQV++C  D+++AK YHRRHKVCE HAK  SVL+ G+QQRFCQ
Sbjct  102  DLYGKKGSKAGGSMPPSCQVDNCDADLSEAKQYHRRHKVCEYHAKVHSVLMAGLQQRFCQ  161

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGE  454
            QCSRFHEL++FDE+KRSCR RL GHNERRR+   D RGE
Sbjct  162  QCSRFHELSEFDESKRSCRTRLVGHNERRRKNAVDCRGE  200



>ref|XP_010545847.1| PREDICTED: squamosa promoter-binding-like protein 5 [Tarenaya 
hassleriana]
Length=187

 Score =   141 bits (356),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/97 (69%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQVE CT D+ +AK YHRRHKVCE+HAKA + ++ GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  68   LCQVEKCTADLMEAKQYHRRHKVCEVHAKATAAMVAGVRQRFCQQCSRFHELLEFDEAKR  127

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            SCRRRLAGHNERRR+ + D  GEGS  RR  SG   Q
Sbjct  128  SCRRRLAGHNERRRKSSGDSFGEGSG-RRGVSGQLMQ  163



>ref|XP_010462181.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Camelina sativa]
Length=182

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 1/91 (1%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV ++GV QRFCQQCSRFHEL +
Sbjct  58   GGSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQE  116

Query  368  FDEAKRSCRRRLAGHNERRRRITYDPRGEGS  460
            FDEAKRSCRRRLAGHNERRR+ + +  GEGS
Sbjct  117  FDEAKRSCRRRLAGHNERRRKSSGESFGEGS  147



>ref|XP_010655440.1| PREDICTED: squamosa promoter-binding protein 1 isoform X1 [Vitis 
vinifera]
Length=151

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 100/141 (71%), Gaps = 13/141 (9%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGG-GSTQLFCQVE  220
            ME SK +GKR++ E     +  +       ED KKK+A+TL+ +K +GG GST   CQV+
Sbjct  1    MEMSKAQGKRTLMEE-EEEDDEDTVGLGFGEDEKKKKAVTLTNKKGSGGAGSTPPSCQVD  59

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSR-----------FHELAQ  367
            +CT DM++AK YH+RH+VCE HAKAP +LI G+QQRFCQQCSR           FHEL++
Sbjct  60   NCTADMSEAKRYHKRHRVCEHHAKAPVILIAGIQQRFCQQCSRLGNPNFPKHFWFHELSE  119

Query  368  FDEAKRSCRRRLAGHNERRRR  430
            FD+ KRSCRRRLAGHNERRR+
Sbjct  120  FDDTKRSCRRRLAGHNERRRK  140



>ref|XP_003547153.1| PREDICTED: squamosa promoter-binding protein 1-like [Glycine 
max]
 gb|KHN24765.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   139 bits (351),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 95/130 (73%), Gaps = 1/130 (1%)
 Frame = +2

Query  44   METSKPEGKRSIN-ETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVE  220
            M+ S  EGKRS++ + +   E  E+E+     D+ +K+ +  S R    GGS    CQV+
Sbjct  1    MDESWSEGKRSMSYKEEDEYEEEEEEEVSEYRDDGRKKKVVSSKRGSKAGGSVPPSCQVD  60

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
             C+ D+++AKPYHRRHKVCE HAKAP+VLI    QRFCQQCSRFHEL++FD++KRSCRRR
Sbjct  61   GCSADLSEAKPYHRRHKVCEYHAKAPAVLIGDQHQRFCQQCSRFHELSEFDDSKRSCRRR  120

Query  401  LAGHNERRRR  430
            LAGHNERRR+
Sbjct  121  LAGHNERRRK  130



>ref|XP_010035775.1| PREDICTED: squamosa promoter-binding protein 1-like [Eucalyptus 
grandis]
 gb|KCW47239.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=178

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 69/120 (58%), Positives = 88/120 (73%), Gaps = 4/120 (3%)
 Frame = +2

Query  140  NKKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            +K+K+    SG +  G G+    CQ E CT D+T+A+ YHRRHKVCE HAKAP+V++ G+
Sbjct  37   SKRKKVPPSSGSR-RGSGAASRNCQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGL  95

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
             QRFCQQCSRFHEL +FDE KRSCRRRLAGHNERRR+   +P  EGS+     +GG+ Q+
Sbjct  96   YQRFCQQCSRFHELLEFDENKRSCRRRLAGHNERRRKNPAEPHIEGSS---GKAGGSTQM  152



>ref|XP_010462180.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Camelina sativa]
Length=186

 Score =   141 bits (355),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 66/91 (73%), Positives = 78/91 (86%), Gaps = 1/91 (1%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV ++GV QRFCQQCSRFHEL +
Sbjct  58   GGSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHELQE  116

Query  368  FDEAKRSCRRRLAGHNERRRRITYDPRGEGS  460
            FDEAKRSCRRRLAGHNERRR+ + +  GEGS
Sbjct  117  FDEAKRSCRRRLAGHNERRRKSSGESFGEGS  147



>gb|AGI62049.1| SQUAMOSA promoter-binding-like 1 [Erycina pusilla]
Length=169

 Score =   140 bits (353),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 77/94 (82%), Gaps = 0/94 (0%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
            +G G     CQ E CT D+T+AK YHRRHKVCE HAKA +V++ G++QRFCQQCSRFHEL
Sbjct  49   SGCGGAYPICQAEKCTADLTEAKRYHRRHKVCEAHAKAATVIVAGLRQRFCQQCSRFHEL  108

Query  362  AQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
             +FDE KRSCRRRLAGHNERRR+ + +P+GEGS+
Sbjct  109  PEFDEVKRSCRRRLAGHNERRRKSSSEPQGEGSS  142



>ref|XP_011043410.1| PREDICTED: squamosa promoter-binding-like protein 3 [Populus 
euphratica]
Length=144

 Score =   139 bits (351),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ ++CT+D+TDAK YHRRHKVCE HAKAP V +NG+QQRFCQQCSRFH+L++FD++KRS
Sbjct  60   CQADNCTSDLTDAKRYHRRHKVCEFHAKAPFVPVNGLQQRFCQQCSRFHDLSEFDDSKRS  119

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + + +GEGS 
Sbjct  120  CRRRLAGHNERRRKSSAEYQGEGSN  144



>ref|XP_010260271.1| PREDICTED: squamosa promoter-binding protein 1 [Nelumbo nucifera]
Length=189

 Score =   140 bits (353),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 76/93 (82%), Gaps = 0/93 (0%)
 Frame = +2

Query  185  GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELA  364
            GGG     CQ E CT D+T+AK YHRRHKVCE HAKAP VL+  ++QRFCQQCSRFHEL+
Sbjct  59   GGGVAPPCCQAEKCTADLTEAKRYHRRHKVCEQHAKAPVVLVASLRQRFCQQCSRFHELS  118

Query  365  QFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +FDEAKRSCRRRLAGHNERRR+ + +  GEGS+
Sbjct  119  EFDEAKRSCRRRLAGHNERRRKSSTESHGEGSS  151



>ref|XP_006303186.1| hypothetical protein CARUB_v10010422mg [Capsella rubella]
 gb|EOA36084.1| hypothetical protein CARUB_v10010422mg [Capsella rubella]
Length=180

 Score =   140 bits (352),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 3/100 (3%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT D+ +AK YHRRHKVCE+HAKA SV ++GV QRFCQQCSRFHE+ +FDEAKR
Sbjct  59   LCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLSGVSQRFCQQCSRFHEIQEFDEAKR  118

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLI  505
            SCRRRLAGHNERRR+ + +  GEGS  R    G T Q+LI
Sbjct  119  SCRRRLAGHNERRRKSSGESFGEGSGRR---GGITGQVLI  155



>ref|XP_009144795.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
Length=183

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 76/92 (83%), Gaps = 0/92 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CTTD+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  63   LCQVDRCTTDLKEAKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKR  122

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTS  481
            SCRRRLAGHNERRR+ + +  GEG+  RR  +
Sbjct  123  SCRRRLAGHNERRRKSSGESFGEGAGGRRGVT  154



>ref|XP_002275728.1| PREDICTED: squamosa promoter-binding protein 1 isoform X2 [Vitis 
vinifera]
 emb|CBI21879.3| unnamed protein product [Vitis vinifera]
Length=169

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 76/145 (52%), Positives = 94/145 (65%), Gaps = 12/145 (8%)
 Frame = +2

Query  29   FTIKEMETSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLF  208
               K+M   + EG   ++E D +    +D         KKK A   SG+K     +    
Sbjct  1    MEAKKMVKKEMEGTEEVDEDDQLGCSEDD--------KKKKAAAGGSGKK---AAAAMRC  49

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E CT D+TDAK YHRRHKVCE HAKA  V++ G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  50   CQAERCTADLTDAKQYHRRHKVCEHHAKAQVVVVGGIRQRFCQQCSRFHELSEFDEAKRS  109

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + D   EGS+
Sbjct  110  CRRRLAGHNERRRKNSADH-AEGSS  133



>gb|AFK42236.1| unknown [Medicago truncatula]
 gb|KEH31025.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=144

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 82/144 (57%), Positives = 103/144 (72%), Gaps = 7/144 (5%)
 Frame = +2

Query  44   METSKPEGKRSIN---ETDSVAeggedededveedNKKKRALT--LSGRKLTGGGSTQL-  205
            MET + EGKRS+    + +   E  ED D + EED ++KR +T   S R     GS+ + 
Sbjct  1    METRRSEGKRSLKYKEDHEEEEEEEEDTDFEEEEDGRRKRVVTDLYSKRSSKKAGSSNIP  60

Query  206  -FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAK  382
              CQVE+C  D+++AK YHRRHKVCE HAKAP+V I G+QQRFCQQCSRFH L++FD+AK
Sbjct  61   PCCQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHIAGLQQRFCQQCSRFHGLSEFDDAK  120

Query  383  RSCRRRLAGHNERRRRITYDPRGE  454
            RSCRRRLAGHNERRR+   D +GE
Sbjct  121  RSCRRRLAGHNERRRKSAIDYQGE  144



>ref|XP_007021543.1| Squamosa promoter binding protein-like 3 isoform 1 [Theobroma 
cacao]
 gb|EOY13068.1| Squamosa promoter binding protein-like 3 isoform 1 [Theobroma 
cacao]
Length=232

 Score =   140 bits (354),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            KKK+A    G    G G +   CQVE C  D++DAK YHRRHKVCEIHAKAP V++ G++
Sbjct  47   KKKKAYGKRGSS-GGAGVSPPSCQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLR  105

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QRFCQQCSRFHEL++FDEAKRSCRRRLAGHNERRR+ + +   EGS+
Sbjct  106  QRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSAESSTEGSS  152



>gb|AGP03027.1| SQUAMOSA promoter binding protein-like protein 3 [Arabis alpina]
 gb|KFK24430.1| squamosa promoter binding 4 [Arabis alpina]
Length=131

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 90/131 (69%), Gaps = 5/131 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E   D  E+ E   KK++     G+  +   S    CQVE 
Sbjct  3    MRRSKAEGKRSLREMSEEEEDDYDTPEEEEALEKKQK-----GKGTSSSSSNHGVCQVES  57

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            C+ DM+ AK YH+RH+VCE+HAKAP V I+G+ QRFCQQCSRFHEL +FDEAKRSCRRRL
Sbjct  58   CSVDMSTAKRYHKRHRVCEVHAKAPLVWISGLHQRFCQQCSRFHELGEFDEAKRSCRRRL  117

Query  404  AGHNERRRRIT  436
            AGHNERRR+ T
Sbjct  118  AGHNERRRKST  128



>ref|XP_010469422.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=135

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 74/133 (56%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E  E E+E+ E+++  +    L  ++     S+   CQV+ 
Sbjct  3    MRRSKAEGKRSLRELSEDEEEEEGEEEETEDEDTFEEEEALEKKQKGKVASSSGVCQVQS  62

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT D++ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSRFHEL +FDEAKRSCRRRL
Sbjct  63   CTADVSKAKQYHKRHKVCEFHAKAPLVRISGLHQRFCQQCSRFHELGEFDEAKRSCRRRL  122

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T +
Sbjct  123  AGHNERRRKSTIE  135



>ref|XP_002879473.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55732.1| hypothetical protein ARALYDRAFT_482334 [Arabidopsis lyrata subsp. 
lyrata]
Length=130

 Score =   137 bits (346),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 76/133 (57%), Positives = 89/133 (67%), Gaps = 5/133 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E  E EDE     +  +    L  ++     S+   CQVE 
Sbjct  3    MRRSKAEGKRSLREMSEEEEDEETEDE-----DTFEEEEALEKKQKAKATSSSGVCQVES  57

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM+ AK YH+RHKVCE HAKAP V I G+ QRFCQQCSRFHEL++FDEAKRSCRRRL
Sbjct  58   CTADMSKAKQYHKRHKVCEFHAKAPLVRIYGLHQRFCQQCSRFHELSEFDEAKRSCRRRL  117

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T +
Sbjct  118  AGHNERRRKSTTE  130



>ref|XP_008383704.1| PREDICTED: squamosa promoter-binding-like protein 3 [Malus domestica]
Length=168

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +2

Query  155  ALTLSGRKLTGGGSTQ-LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRF  331
            A T +GR+   GGST    CQV++CT D++D K Y+RRHKVC++HAKAPS+++ G +QRF
Sbjct  63   AATPTGRRSGAGGSTAGPCCQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRF  122

Query  332  CQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            CQQCSRFH L++FD++KRSCRRRLAGHNERRR+ + +  G G T
Sbjct  123  CQQCSRFHSLSEFDDSKRSCRRRLAGHNERRRKTSSEYHGHGGT  166



>ref|XP_007021544.1| Squamosa promoter binding protein-like 3 isoform 2, partial [Theobroma 
cacao]
 gb|EOY13069.1| Squamosa promoter binding protein-like 3 isoform 2, partial [Theobroma 
cacao]
Length=258

 Score =   141 bits (355),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 83/107 (78%), Gaps = 1/107 (1%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            KKK+A    G    G G +   CQVE C  D++DAK YHRRHKVCEIHAKAP V++ G++
Sbjct  92   KKKKAYGKRGSS-GGAGVSPPSCQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLR  150

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QRFCQQCSRFHEL++FDEAKRSCRRRLAGHNERRR+ + +   EGS+
Sbjct  151  QRFCQQCSRFHELSEFDEAKRSCRRRLAGHNERRRKSSAESSTEGSS  197



>gb|AHC08502.1| SBP-box transcription factor [Malus domestica]
Length=168

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 83/104 (80%), Gaps = 1/104 (1%)
 Frame = +2

Query  155  ALTLSGRKLTGGGSTQ-LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRF  331
            A T +GR+   GGST    CQV++CT D++D K Y+RRHKVC++HAKAPS+++ G +QRF
Sbjct  63   AATPTGRRSGAGGSTAGPCCQVDNCTADLSDLKQYYRRHKVCDVHAKAPSIVVGGFRQRF  122

Query  332  CQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            CQQCSRFH L++FD++KRSCRRRLAGHNERRR+ + +  G G T
Sbjct  123  CQQCSRFHSLSEFDDSKRSCRRRLAGHNERRRKTSSEYHGHGGT  166



>dbj|BAM15475.1| SBP-box protein [Torenia fournieri]
Length=134

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 68/98 (69%), Positives = 76/98 (78%), Gaps = 3/98 (3%)
 Frame = +2

Query  146  KKRALTLSGRK---LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLING  316
            K+RA   S  K   LT GGS+   CQ+E C  DM  AKPYHRRHKVCE HAKA  V+  G
Sbjct  35   KRRASNTSSNKRRVLTSGGSSNRTCQIEGCLADMACAKPYHRRHKVCEFHAKASVVVHVG  94

Query  317  VQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRR  430
            +QQRFCQQCSRFHEL++FD+AKRSCRRRLAGHNERRRR
Sbjct  95   LQQRFCQQCSRFHELSEFDDAKRSCRRRLAGHNERRRR  132



>ref|XP_003541730.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Glycine max]
 gb|KHN08505.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=138

 Score =   137 bits (345),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 94/130 (72%), Gaps = 1/130 (1%)
 Frame = +2

Query  44   METSKPEGKRSIN-ETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVE  220
            M+ S  EGKRS++ + +   E  E+E+     D+ KK+ +  + R    GGS    CQV+
Sbjct  1    MDGSWSEGKRSMSYKEEDEYEEEEEEEVSEYGDDGKKKRVVSNKRGSKAGGSVPPSCQVD  60

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
             C  D+++AKPYHRRHKVCE HAKAP+V+I    QRFCQQCSRFHEL++FD++KRSCRRR
Sbjct  61   GCNADLSEAKPYHRRHKVCEYHAKAPAVVIGDQHQRFCQQCSRFHELSEFDDSKRSCRRR  120

Query  401  LAGHNERRRR  430
            LAGHNERRR+
Sbjct  121  LAGHNERRRK  130



>ref|XP_002891731.1| hypothetical protein ARALYDRAFT_474435 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67990.1| hypothetical protein ARALYDRAFT_474435 [Arabidopsis lyrata subsp. 
lyrata]
Length=173

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 70/104 (67%), Positives = 84/104 (81%), Gaps = 3/104 (3%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS++L CQV+ CT+DM +AK YHRRHKVCE+HAKA SV ++G+ QRFCQQCSRFHEL +
Sbjct  48   GGSSRL-CQVDRCTSDMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHELQE  106

Query  368  FDEAKRSCRRRLAGHNERRRRITYDPR-GEGST*RRNTSGGTNQ  496
            FDEAKRSCRRRLAGHNERRR+ + +   GEGS  RR  +G   Q
Sbjct  107  FDEAKRSCRRRLAGHNERRRKSSGESSFGEGSG-RRGITGQVIQ  149



>ref|NP_565771.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana]
 sp|P93015.2|SPL3_ARATH RecName: Full=Squamosa promoter-binding-like protein 3 [Arabidopsis 
thaliana]
 emb|CAA70578.1| squamosa-promoter binding protein like 3 [Arabidopsis thaliana]
 emb|CAB56579.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
 emb|CAB56585.1| squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
 gb|AAC69133.2| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 dbj|BAC42802.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 gb|AAO63863.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
 gb|AEC08889.1| squamosa promoter-binding-like protein 3 [Arabidopsis thaliana]
Length=131

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E  E+ +++   + ++       G+  +  G     CQVE 
Sbjct  3    MRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSG----VCQVES  58

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM+ AK YH+RHKVC+ HAKAP V I+G+ QRFCQQCSRFH L++FDEAKRSCRRRL
Sbjct  59   CTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRL  118

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T D
Sbjct  119  AGHNERRRKSTTD  131



>emb|CAB94233.1| Squamosa promoter binding protein-like 3 [Arabidopsis thaliana]
Length=129

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E  E+ +++   + ++       G+  +  G     CQVE 
Sbjct  1    MRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSG----VCQVES  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM+ AK YH+RHKVC+ HAKAP V I+G+ QRFCQQCSRFH L++FDEAKRSCRRRL
Sbjct  57   CTADMSKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRL  116

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T D
Sbjct  117  AGHNERRRKSTTD  129



>ref|XP_008463797.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
melo]
Length=176

 Score =   137 bits (346),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 80/104 (77%), Gaps = 0/104 (0%)
 Frame = +2

Query  152  RALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRF  331
            +   +SGR  +GG  +   CQ  +C  D+++AK YHRRHKVCE H+KA  V++ G++QRF
Sbjct  32   KGAAVSGRGKSGGSVSSPSCQAHNCAADLSEAKRYHRRHKVCEFHSKAAIVMVAGIRQRF  91

Query  332  CQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            CQQCSRFHEL +FDEAKRSCRRRLAGHNERRR+ + + +GE ++
Sbjct  92   CQQCSRFHELTEFDEAKRSCRRRLAGHNERRRKNSAESQGESTS  135



>ref|XP_008367070.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
 ref|XP_008355373.1| PREDICTED: squamosa promoter-binding protein 1-like [Malus domestica]
Length=191

 Score =   137 bits (346),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/91 (69%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
             Q  CQVE C  D+ DAK Y+RRHKVCE H+KA  V+++G+QQRFCQQCSRFHEL +FDE
Sbjct  72   AQPSCQVERCGADLVDAKRYYRRHKVCEFHSKAAVVIVSGIQQRFCQQCSRFHELIEFDE  131

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST*R  469
            AKRSCRRRLAGHNERRR+ + +P GEGS+ R
Sbjct  132  AKRSCRRRLAGHNERRRKSSGEPYGEGSSRR  162



>ref|XP_002317486.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa]
 gb|EEE98098.2| hypothetical protein POPTR_0011s11770g [Populus trichocarpa]
Length=193

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  ++TDAK YHRRHKVCE+HAK+P+V++ G++QRFCQQCSRFHEL +FDE KRS
Sbjct  69   CQVEKCGANLTDAKRYHRRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELLEFDETKRS  128

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ T +  GEGS+
Sbjct  129  CRRRLAGHNERRRKNTAESYGEGSS  153



>ref|XP_010502692.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/99 (66%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++TDAK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  62   LCQVDRCTANLTDAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLL  502
            SCRRRLAGHNERRR+I+ D  GEGS  R    G ++QL+
Sbjct  122  SCRRRLAGHNERRRKISCDIYGEGSGRR----GFSSQLI  156



>ref|XP_010062855.1| PREDICTED: squamosa promoter-binding-like protein 3 [Eucalyptus 
grandis]
 gb|KCW69992.1| hypothetical protein EUGRSUZ_F03303 [Eucalyptus grandis]
Length=186

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C TD+TDAK YHRRHKVCE+HAKAP V++ G++QRFCQQCSRFHEL +FDE+KRS
Sbjct  67   CQAERCGTDLTDAKRYHRRHKVCEVHAKAPVVMVAGLRQRFCQQCSRFHELMEFDESKRS  126

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + +  GEGS+
Sbjct  127  CRRRLAGHNERRRKSSCEYYGEGSS  151



>gb|KCW47238.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=189

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/97 (65%), Positives = 77/97 (79%), Gaps = 3/97 (3%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E CT D+T+A+ YHRRHKVCE HAKAP+V++ G+ QRFCQQCSRFHEL +FDE KRS
Sbjct  70   CQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEFDENKRS  129

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            CRRRLAGHNERRR+   +P  EGS+     +GG+ Q+
Sbjct  130  CRRRLAGHNERRRKNPAEPHIEGSS---GKAGGSTQM  163



>emb|CDP14818.1| unnamed protein product [Coffea canephora]
Length=211

 Score =   137 bits (345),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/107 (61%), Positives = 82/107 (77%), Gaps = 2/107 (2%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
             S+   CQ E CT D++DAK YHRRH+VCE HAKA  V++ G++QRFCQQCSRFHELA+F
Sbjct  82   ASSMKCCQAEKCTADLSDAKQYHRRHRVCEHHAKAQVVIVGGIRQRFCQQCSRFHELAEF  141

Query  371  DEAKRSCRRRLAGHNERRRRITYDP-RGEGST*RRNTSGGTNQLLIG  508
            DEAKRSCRRRLAGHNERRR+ + D  + EGS+ R+ T     +++ G
Sbjct  142  DEAKRSCRRRLAGHNERRRKNSADSTQAEGSS-RKGTGSQMKEIVCG  187



>gb|AAM67271.1| putative squamosa-promoter binding protein [Arabidopsis thaliana]
Length=131

 Score =   135 bits (339),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 90/133 (68%), Gaps = 4/133 (3%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKRS+ E     E  E+ +++   + ++       G+  +  G     CQVE 
Sbjct  3    MRRSKAEGKRSLRELSEEEEEEEETEDEDTFEEEEALEKKQKGKATSSSG----VCQVES  58

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT D++ AK YH+RHKVC+ HAKAP V I+G+ QRFCQQCSRFH L++FDEAKRSCRRRL
Sbjct  59   CTADISKAKQYHKRHKVCQFHAKAPHVRISGLHQRFCQQCSRFHALSEFDEAKRSCRRRL  118

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T D
Sbjct  119  AGHNERRRKSTTD  131



>ref|XP_006447265.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
 ref|XP_006469892.1| PREDICTED: squamosa promoter-binding-like protein 4-like isoform 
X1 [Citrus sinensis]
 gb|ESR60505.1| hypothetical protein CICLE_v10016841mg [Citrus clementina]
Length=189

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV+ C  D++DAK YHRRHKVCE+HAKA  VL+ G++QRFCQQCSRFHEL++FDE KRS
Sbjct  65   CQVDKCAADLSDAKQYHRRHKVCEVHAKAQVVLMGGMRQRFCQQCSRFHELSEFDETKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+   +  GEGS+
Sbjct  125  CRRRLAGHNERRRKNAAESNGEGSS  149



>gb|AAY16440.1| squamosa promoter binding-like protein [Betula platyphylla]
Length=175

 Score =   136 bits (342),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/119 (60%), Positives = 85/119 (71%), Gaps = 11/119 (9%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            KKK+ +  SG K          CQ E CT D++D K YH+RHKVCE HAKA  VL+ G++
Sbjct  38   KKKKGVVGSGGKRC--------CQAEKCTADLSDGKQYHKRHKVCEHHAKAQVVLVGGMR  89

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            QRFCQQCSRFHEL++FDE KRSCRRRLAGHNERRR  T +   EGS+ R+ T  GT+QL
Sbjct  90   QRFCQQCSRFHELSEFDETKRSCRRRLAGHNERRRENTAESHAEGSS-RKGT--GTHQL  145



>ref|XP_006298553.1| hypothetical protein CARUB_v10014636mg, partial [Capsella rubella]
 gb|EOA31451.1| hypothetical protein CARUB_v10014636mg, partial [Capsella rubella]
Length=208

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  89   LCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKR  148

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIGTHKK  520
            SCRRRLAGHNERRR+I+ D  GEGS  RR  SG     LI T +K
Sbjct  149  SCRRRLAGHNERRRKISGDIYGEGSG-RRGFSG----QLIQTQEK  188



>ref|NP_188145.1| squamosa promoter-binding-like protein 5 [Arabidopsis thaliana]
 sp|Q9S758.1|SPL5_ARATH RecName: Full=Squamosa promoter-binding-like protein 5 [Arabidopsis 
thaliana]
 emb|CAB56571.1| squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
 emb|CAB56572.1| squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
 dbj|BAB02156.1| squamosa promoter binding protein-like [Arabidopsis thaliana]
 dbj|BAC43210.1| putative squamosa promoter binding protein-like 5 [Arabidopsis 
thaliana]
 gb|AAO39942.1| At3g15270 [Arabidopsis thaliana]
 gb|AEE75639.1| squamosa promoter-binding-like protein 5 [Arabidopsis thaliana]
Length=181

 Score =   135 bits (341),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 77/93 (83%), Gaps = 1/93 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  62   LCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            SCRRRLAGHNERRR+I+ D  GEGS  RR  SG
Sbjct  122  SCRRRLAGHNERRRKISGDSFGEGSG-RRGFSG  153



>ref|XP_009356783.1| PREDICTED: squamosa promoter-binding protein 1-like [Pyrus x 
bretschneideri]
Length=189

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 74/91 (81%), Gaps = 0/91 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
             Q  CQ E C  D+ DAK Y+RRHKVCE H+KA  V+++G+QQRFCQQCSRFHEL +FDE
Sbjct  70   AQPSCQAERCGADLVDAKRYNRRHKVCEFHSKAAVVIVSGIQQRFCQQCSRFHELTEFDE  129

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST*R  469
            AKRSCRRRLAGHNERRR+ + +P GEGS+ R
Sbjct  130  AKRSCRRRLAGHNERRRKSSGEPYGEGSSRR  160



>gb|KCW47237.1| hypothetical protein EUGRSUZ_K01046 [Eucalyptus grandis]
Length=236

 Score =   137 bits (345),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 79/103 (77%), Gaps = 3/103 (3%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            G+    CQ E CT D+T+A+ YHRRHKVCE HAKAP+V++ G+ QRFCQQCSRFHEL +F
Sbjct  111  GAASRNCQAEKCTADLTEARQYHRRHKVCEQHAKAPAVVVGGLYQRFCQQCSRFHELLEF  170

Query  371  DEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            DE KRSCRRRLAGHNERRR+   +P  EGS+     +GG+ Q+
Sbjct  171  DENKRSCRRRLAGHNERRRKNPAEPHIEGSS---GKAGGSTQM  210



>ref|XP_002517882.1| Squamosa promoter-binding protein, putative [Ricinus communis]
 gb|EEF44400.1| Squamosa promoter-binding protein, putative [Ricinus communis]
Length=198

 Score =   136 bits (342),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 74/100 (74%), Gaps = 1/100 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+ DAKPYHRRHKVCE HAKA  VL+ G++QRFCQQCSRFHEL +FDE KRS
Sbjct  76   CQAEKCMADLNDAKPYHRRHKVCEYHAKAQIVLVAGIRQRFCQQCSRFHELIEFDETKRS  135

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIG  508
            CRRRLAGHNERRR+ T +   EGS+  R T      ++ G
Sbjct  136  CRRRLAGHNERRRKNTTESHTEGSS-HRGTGTQLKDMVFG  174



>gb|KDO42134.1| hypothetical protein CISIN_1g029650mg [Citrus sinensis]
Length=190

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV+ C  D++DAK YHRRHKVCE+HAKA  VL+ G++QRFCQQCSRFHEL++FDE KRS
Sbjct  66   CQVDKCGADLSDAKQYHRRHKVCEVHAKAQVVLMGGIRQRFCQQCSRFHELSEFDETKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+   +  GEGS+
Sbjct  126  CRRRLAGHNERRRKNAAESNGEGSS  150



>emb|CDX98540.1| BnaC05g38350D [Brassica napus]
Length=179

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             C V+ CT ++T+AK Y+RRHKVCE+HAKA S  + GV+QRFCQQCSRFHELA+FDE KR
Sbjct  62   LCLVDRCTANLTEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGS  460
            SCRRRLAGHNERRR+I+ D  GEGS
Sbjct  122  SCRRRLAGHNERRRKISGDSYGEGS  146



>ref|NP_175723.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 ref|NP_974014.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 sp|Q9S7A9.1|SPL4_ARATH RecName: Full=Squamosa promoter-binding-like protein 4 [Arabidopsis 
thaliana]
 gb|AAF69527.1|AC008007_2 F12M16.2 [Arabidopsis thaliana]
 emb|CAB56582.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 emb|CAB56583.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 gb|AAM61465.1| transcription factor, putative [Arabidopsis thaliana]
 gb|AAO22673.1| putative transcription factor [Arabidopsis thaliana]
 gb|AAO42385.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE32896.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
 gb|AEE32897.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
Length=174

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS +L CQV+ CT DM +AK YHRRHKVCE+HAKA SV ++G+ QRFCQQCSRFH+L +
Sbjct  48   GGSLRL-CQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQE  106

Query  368  FDEAKRSCRRRLAGHNERRRRITYDP-RGEGST*RRNTSG  484
            FDEAKRSCRRRLAGHNERRR+ + +   GEGS  RR  +G
Sbjct  107  FDEAKRSCRRRLAGHNERRRKSSGESTYGEGSG-RRGING  145



>ref|XP_010487346.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  62   LCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGS  460
            SCRRRLAGHNERRR+I+ D  GEGS
Sbjct  122  SCRRRLAGHNERRRKISGDIYGEGS  146



>ref|XP_007043635.1| Squamosa promoter binding protein-like 4 [Theobroma cacao]
 gb|EOX99466.1| Squamosa promoter binding protein-like 4 [Theobroma cacao]
Length=235

 Score =   137 bits (344),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 67/110 (61%), Positives = 83/110 (75%), Gaps = 2/110 (2%)
 Frame = +2

Query  179  LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHE  358
            LTG G+ +  CQ E+CT D++DAK YHRRHKVCE H+KA  VL+ G +QRFCQQCSRFH 
Sbjct  104  LTGAGAMRC-CQAENCTADLSDAKQYHRRHKVCENHSKAQVVLVAGFRQRFCQQCSRFHV  162

Query  359  LAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIG  508
            L++FDEAKRSCRRRLAGHNERRR+ + +  GEGS  R+ T      ++ G
Sbjct  163  LSEFDEAKRSCRRRLAGHNERRRKNSTESHGEGSG-RKGTGTQLKDMICG  211



>ref|XP_010465475.1| PREDICTED: squamosa promoter-binding-like protein 5 [Camelina 
sativa]
Length=181

 Score =   135 bits (340),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/99 (65%), Positives = 80/99 (81%), Gaps = 4/99 (4%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  62   LCQVDRCTANLTEAKQYYRRHRVCEVHAKASAATVTGVRQRFCQQCSRFHELPEFDEAKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLL  502
            SCRRRLAGHNERRR+I+ D  GEGS  R    G ++QL+
Sbjct  122  SCRRRLAGHNERRRKISGDIYGEGSGRR----GFSSQLI  156



>emb|CAB56584.1| squamosa promoter binding protein-like 4 [Arabidopsis thaliana]
Length=167

 Score =   135 bits (339),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 81/100 (81%), Gaps = 3/100 (3%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GGS +L CQV+ CT DM +AK YHRRHKVCE+HAKA SV ++G+ QRFCQQCSRFH+L +
Sbjct  41   GGSLRL-CQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDLQE  99

Query  368  FDEAKRSCRRRLAGHNERRRRITYDP-RGEGST*RRNTSG  484
            FDEAKRSCRRRLAGHNERRR+ + +   GEGS  RR  +G
Sbjct  100  FDEAKRSCRRRLAGHNERRRKSSGESTYGEGSG-RRGING  138



>ref|XP_007212177.1| hypothetical protein PRUPE_ppa012607mg [Prunus persica]
 gb|EMJ13376.1| hypothetical protein PRUPE_ppa012607mg [Prunus persica]
Length=162

 Score =   134 bits (338),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 63/113 (56%), Positives = 82/113 (73%), Gaps = 8/113 (7%)
 Frame = +2

Query  140  NKKKRALTLSGRKLT--------GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKA  295
            +++KR LT++    T        GG   +  CQ +DC  D++DAK Y+RRHKVC +HAKA
Sbjct  50   DRRKRVLTVNSATSTPNKRGSGAGGSMARPSCQADDCNADLSDAKQYYRRHKVCGVHAKA  109

Query  296  PSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGE  454
            P+V + GVQQRFCQQCSRFH L++FD+ KRSCRRRLAGHNERRR+ + +  GE
Sbjct  110  PAVRVGGVQQRFCQQCSRFHSLSEFDDNKRSCRRRLAGHNERRRKTSSEYHGE  162



>ref|XP_007213489.1| hypothetical protein PRUPE_ppa022739mg [Prunus persica]
 gb|EMJ14688.1| hypothetical protein PRUPE_ppa022739mg [Prunus persica]
Length=162

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D  +AK Y+RRHKVCE H+KAP V+++G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  66   CQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            CRRRLAGHNERRR+ + +P GEGS+ RR  +    Q+
Sbjct  126  CRRRLAGHNERRRKSSGEPYGEGSS-RRGVASKQFQI  161



>ref|XP_011029504.1| PREDICTED: squamosa promoter-binding-like protein 4 [Populus 
euphratica]
Length=241

 Score =   137 bits (344),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  ++TDAK YH+RHKVCE+HAK+P+V++ G++QRFCQQCSRFHEL +FDE KRS
Sbjct  118  CQVEKCGANLTDAKRYHKRHKVCEVHAKSPAVVVAGLRQRFCQQCSRFHELPEFDETKRS  177

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ T +  GEGS+
Sbjct  178  CRRRLAGHNERRRKNTAESYGEGSS  202



>ref|XP_008226482.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=162

 Score =   134 bits (338),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 62/97 (64%), Positives = 77/97 (79%), Gaps = 1/97 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D  +AK Y+RRHKVCE H+KAP V+++G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  66   CQAERCGADFVEAKRYYRRHKVCEFHSKAPVVMVSGLRQRFCQQCSRFHELTEFDEAKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQL  499
            CRRRLAGHNERRR+ + +P GEGS+ RR  +    Q+
Sbjct  126  CRRRLAGHNERRRKSSGEPYGEGSS-RRGVASKQFQI  161



>gb|KEH38697.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=171

 Score =   134 bits (338),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 70/121 (58%), Positives = 88/121 (73%), Gaps = 3/121 (2%)
 Frame = +2

Query  146  KKRALTLSGRKLT--GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            KK+ + +SGRK    GG  +   CQVE C  D+T +K YHRRHKVCE+H+KA  V++ G+
Sbjct  35   KKKGVCVSGRKEPSRGGRFSSPICQVESCGADLTFSKRYHRRHKVCEVHSKASVVVVAGM  94

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEG-ST*RRNTSGGTNQ  496
            +QRFCQQCSRFHELA+FDE+KRSCRRRLA HNERRR+ T     EG ST ++N  G   Q
Sbjct  95   RQRFCQQCSRFHELAEFDESKRSCRRRLARHNERRRKSTAGTCTEGSSTGQKNNDGDWRQ  154

Query  497  L  499
            +
Sbjct  155  I  155



>gb|KDP45880.1| hypothetical protein JCGZ_15324 [Jatropha curcas]
Length=211

 Score =   135 bits (341),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 74/83 (89%), Gaps = 1/83 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++DAK YHRRHKVCE+HAKAP+V++ G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  77   CQVEKCGADLSDAKRYHRRHKVCEVHAKAPAVIVAGLRQRFCQQCSRFHELSEFDEAKRS  136

Query  389  CRRRLAGHNERRRR-ITYDPRGE  454
            CRRRLAGHNERRR+ ++ +  GE
Sbjct  137  CRRRLAGHNERRRKSLSAESNGE  159



>gb|KDP20990.1| hypothetical protein JCGZ_21461 [Jatropha curcas]
Length=142

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 89/130 (68%), Gaps = 1/130 (1%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQ-LFCQVE  220
            M TSK EGKRS+ E +   E  ++ED               + +   G GS   + CQ +
Sbjct  1    MSTSKAEGKRSLKEMEDEEEEEDEEDCVGGLGFGDDDKKKKNKKGSIGSGSMPPVSCQAD  60

Query  221  DCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRR  400
            +CT DMTDAK YHRRHKVCE HAKAP V++ G+QQRFCQQCSRFH L++FD+ KRSCRRR
Sbjct  61   NCTADMTDAKRYHRRHKVCEFHAKAPLVVVAGIQQRFCQQCSRFHGLSEFDDNKRSCRRR  120

Query  401  LAGHNERRRR  430
            LAGHNERRR+
Sbjct  121  LAGHNERRRK  130



>ref|XP_002309744.2| hypothetical protein POPTR_0007s01030g [Populus trichocarpa]
 gb|EEE90194.2| hypothetical protein POPTR_0007s01030g [Populus trichocarpa]
Length=202

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/94 (67%), Positives = 75/94 (80%), Gaps = 0/94 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE CT ++TDAK YHRRHKVC  HAKA  VL+ G++QRFCQQCSRFHEL++FDE KRS
Sbjct  77   CQVEKCTANLTDAKQYHRRHKVCGHHAKAQVVLVAGIRQRFCQQCSRFHELSEFDETKRS  136

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGT  490
            CRRRLAGHNERRR+   +   EGS+ + N + GT
Sbjct  137  CRRRLAGHNERRRKNVVESHVEGSSRKVNGTHGT  170



>emb|CDY27935.1| BnaCnng05200D [Brassica napus]
Length=147

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 78/141 (55%), Positives = 91/141 (65%), Gaps = 7/141 (5%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededve--edNKKKRALTLSGRKLTGGGSTQLFCQV  217
            M+ SK E KRS+ E     E    E+E+ E     KK++    S    + G      CQV
Sbjct  3    MKGSKAEAKRSLREMSEEEEEDTFEEEEDEEEALEKKQKGKATSSSSSSAGA-----CQV  57

Query  218  EDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRR  397
            E CT DM+ AK YHRRHKVCE HAKAP V I G+ QRFCQQCSRFHEL +FDE+KRSCRR
Sbjct  58   ERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYGLHQRFCQQCSRFHELGEFDESKRSCRR  117

Query  398  RLAGHNERRRRITYDPRGEGS  460
            RLAGHNERRR+   +  GE S
Sbjct  118  RLAGHNERRRKSASEGEGERS  138



>ref|XP_010272389.1| PREDICTED: squamosa promoter-binding protein 1-like [Nelumbo 
nucifera]
Length=187

 Score =   134 bits (338),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E CT D+++AK YHRRHKVCE H+KAP VL+ G++QRFCQQCSRFHEL++FDE KRS
Sbjct  65   CQAEKCTADLSEAKRYHRRHKVCEQHSKAPVVLVAGLKQRFCQQCSRFHELSEFDETKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + +  GEGS+
Sbjct  125  CRRRLAGHNERRRKNSTESHGEGSS  149



>ref|XP_009146272.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
 emb|CDX97645.1| BnaA05g24340D [Brassica napus]
Length=179

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             C V+ CT ++++AK Y+RRHKVCE+HAKA S  + GV+QRFCQQCSRFHELA+FDE KR
Sbjct  62   LCLVDRCTANLSEAKQYYRRHKVCEVHAKASSATVAGVKQRFCQQCSRFHELAEFDETKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGS  460
            SCRRRLAGHNERRR+I+ D  GEGS
Sbjct  122  SCRRRLAGHNERRRKISGDSYGEGS  146



>gb|AGP03028.1| SQUAMOSA promoter binding protein-like protein 4 [Arabis alpina]
 gb|KFK35743.1| hypothetical protein AALP_AA4G030800 [Arabis alpina]
Length=181

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/96 (66%), Positives = 77/96 (80%), Gaps = 1/96 (1%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            ++KR     G     GGS++L CQV+ CT+D+ +AK YHRRHKVCE+HAKA  V ++G+ 
Sbjct  36   EEKRNRVNKGYSGNTGGSSRL-CQVDRCTSDLKEAKQYHRRHKVCEVHAKASYVFLSGIN  94

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRR  430
            QRFCQQCSRFHEL +FDEAKRSCRRRLAGHNERRR+
Sbjct  95   QRFCQQCSRFHELLEFDEAKRSCRRRLAGHNERRRK  130



>ref|XP_010542291.1| PREDICTED: squamosa promoter-binding-like protein 5 [Tarenaya 
hassleriana]
Length=128

 Score =   132 bits (332),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 0/90 (0%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            G +   CQ E CT D+T+AK YHRRH+VCE+HAKA S ++ GV+QRFCQQCSRFHEL +F
Sbjct  32   GVSSRLCQAEKCTADLTEAKQYHRRHRVCEVHAKALSAMVAGVRQRFCQQCSRFHELVEF  91

Query  371  DEAKRSCRRRLAGHNERRRRITYDPRGEGS  460
            D AKRSCR RLAGHNERRR+ + D   +GS
Sbjct  92   DGAKRSCRGRLAGHNERRRKSSLDSSKQGS  121



>ref|XP_006295226.1| hypothetical protein CARUB_v10024311mg [Capsella rubella]
 gb|EOA28124.1| hypothetical protein CARUB_v10024311mg [Capsella rubella]
Length=130

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/83 (72%), Positives = 68/83 (82%), Gaps = 0/83 (0%)
 Frame = +2

Query  194  STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFD  373
            S+   CQVE CT DM+ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSRFHEL +FD
Sbjct  48   SSSRVCQVESCTADMSKAKQYHKRHKVCEFHAKAPIVRISGLHQRFCQQCSRFHELGEFD  107

Query  374  EAKRSCRRRLAGHNERRRRITYD  442
            EAKRSCRRRLAGHNERRR+   +
Sbjct  108  EAKRSCRRRLAGHNERRRKTATE  130



>ref|XP_006410530.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum]
 gb|ESQ51983.1| hypothetical protein EUTSA_v10017406mg [Eutrema salsugineum]
Length=135

 Score =   132 bits (333),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 72/133 (54%), Positives = 93/133 (70%), Gaps = 0/133 (0%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            M  SK EGKR++ E     E  ++E+++   + +++ +      + T   S+   CQVE 
Sbjct  3    MRRSKAEGKRNLREMSEEDEEEDEEEDEDTCEEEEEASEKKQKGRATSSSSSSGVCQVER  62

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRL  403
            CT DM+ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSRFHEL +FDEAKRSCRRRL
Sbjct  63   CTADMSRAKNYHKRHKVCEFHAKAPLVRISGLHQRFCQQCSRFHELGEFDEAKRSCRRRL  122

Query  404  AGHNERRRRITYD  442
            AGHNERRR+ T +
Sbjct  123  AGHNERRRKSTTE  135



>ref|XP_010108163.1| Squamosa promoter-binding protein 1 [Morus notabilis]
 gb|EXC18088.1| Squamosa promoter-binding protein 1 [Morus notabilis]
Length=170

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 73/89 (82%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
            T+  CQ ++C+ D+TD+K YHRRHK+CE HAKA  VL+NG+QQRFCQQCSRFH LA+FD+
Sbjct  82   TRPSCQADNCSVDLTDSKQYHRRHKICEFHAKATVVLVNGLQQRFCQQCSRFHGLAEFDD  141

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST  463
             KRSCRRRLAGHNERRR+ + D   EGS 
Sbjct  142  TKRSCRRRLAGHNERRRKSSSDLHREGSN  170



>ref|XP_010549337.1| PREDICTED: squamosa promoter-binding-like protein 3 [Tarenaya 
hassleriana]
Length=166

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQVE+C  DMT AK YH+RHKVC+ HAKAP V ++G+ QRFCQQCSRFHE+ +FDEAKR
Sbjct  78   VCQVENCNVDMTGAKRYHKRHKVCDFHAKAPVVNVSGLHQRFCQQCSRFHEIGEFDEAKR  137

Query  386  SCRRRLAGHNERRRRITYDPR-GEGST  463
            SCRRRLAGHNERRR+++ + + GEGS 
Sbjct  138  SCRRRLAGHNERRRKVSNEYQSGEGSN  164



>ref|XP_011005939.1| PREDICTED: squamosa promoter-binding-like protein 1 isoform X1 
[Populus euphratica]
Length=1002

 Score =   142 bits (359),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GGG ++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  140  KLVGGGLSRAVCQVEDCGVDLSNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  199

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G GS+   + + G
Sbjct  200  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDTVGNGSSMNDDQNSG  243



>ref|XP_002302799.2| hypothetical protein POPTR_0002s18970g [Populus trichocarpa]
 gb|EEE82072.2| hypothetical protein POPTR_0002s18970g [Populus trichocarpa]
Length=1002

 Score =   142 bits (359),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 63/104 (61%), Positives = 77/104 (74%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GGG ++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  140  KLVGGGLSRAVCQVEDCGVDLSNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  199

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G GS+   + + G
Sbjct  200  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDTVGNGSSMNDDQNSG  243



>ref|XP_003526029.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
Length=185

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFH+LA+FDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+   +   EGST
Sbjct  125  CRRRLAGHNERRRKSNPEASNEGST  149



>gb|AGR34080.1| squamosa promoter binding protein-like 3, partial [Pogostemon 
cablin]
Length=175

 Score =   133 bits (334),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/116 (55%), Positives = 82/116 (71%), Gaps = 2/116 (2%)
 Frame = +2

Query  164  LSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQC  343
            ++G+K     S    CQ E C+ D++DAK YHRRHKVCE+HAKA  V++ G +QRFCQQC
Sbjct  37   VAGKKAGADASIMKSCQAEKCSADLSDAKTYHRRHKVCELHAKAQVVVVAGTRQRFCQQC  96

Query  344  SRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRG-EGST*RRNTSGGTNQLLIG  508
            SRFHEL++FDE KRSCRRRLAGHNERRR+   D    +GST  +   G   +++ G
Sbjct  97   SRFHELSEFDETKRSCRRRLAGHNERRRKNPSDNSSCQGST-SKGGGGAGKEMVCG  151



>ref|XP_010929104.1| PREDICTED: squamosa promoter-binding protein 1 isoform X1 [Elaeis 
guineensis]
Length=181

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  QLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEA  379
            Q  CQ E CT D+T+AK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFHE+++FD++
Sbjct  67   QPCCQAEKCTADLTEAKRYHRRHKVCEAHSKAPVVIVAGLRQRFCQQCSRFHEISEFDDS  126

Query  380  KRSCRRRLAGHNERRRRITYDPRGEGST  463
            KRSCRRRLAGHNERRR+ + + +GEGS+
Sbjct  127  KRSCRRRLAGHNERRRKSSAESQGEGSS  154



>gb|AFK36644.1| unknown [Lotus japonicus]
Length=153

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/92 (67%), Positives = 73/92 (79%), Gaps = 0/92 (0%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
             GG +    CQVE C  D++ AK YHRRHKVCE HAKAPSVL++  QQRFCQQCSRFHEL
Sbjct  59   AGGSAVPPSCQVEGCYADLSGAKAYHRRHKVCEHHAKAPSVLLSEQQQRFCQQCSRFHEL  118

Query  362  AQFDEAKRSCRRRLAGHNERRRRITYDPRGEG  457
            ++FD+ KRSCRRRLAGHNERRR+   + +GEG
Sbjct  119  SEFDDTKRSCRRRLAGHNERRRKNASEFQGEG  150



>emb|CDY50515.1| BnaC06g10070D [Brassica napus]
Length=157

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 66/97 (68%), Positives = 77/97 (79%), Gaps = 0/97 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CTTD+ + K YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  53   LCQVDRCTTDLKEDKQYHRRHKVCEVHAKASSVYLAGVKQRFCQQCSRFHELPEFDEAKR  112

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            SCRRRLAGHNERRR+ + +  GEGS  RR  +G   Q
Sbjct  113  SCRRRLAGHNERRRKSSGESFGEGSGGRRGVTGQVMQ  149



>emb|CDP05939.1| unnamed protein product [Coffea canephora]
Length=158

 Score =   132 bits (332),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 79/96 (82%), Gaps = 1/96 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            C+ E+C  D+TD+K YH+RHKVCE HAKA  V++ G++QRFCQQCSRFH+L++FDEAKRS
Sbjct  38   CRAENCKADLTDSKSYHKRHKVCEYHAKAEVVVVEGLKQRFCQQCSRFHDLSEFDEAKRS  97

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            CRRRLAGHNERRR+   + RGEGS  RR ++ GT +
Sbjct  98   CRRRLAGHNERRRKHFTESRGEGSG-RRGSNPGTKK  132



>ref|XP_009340759.1| PREDICTED: squamosa promoter-binding protein 1-like [Pyrus x 
bretschneideri]
Length=189

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
            +Q  CQ E C  D+ DAK YHRRHKVCE H+KA  V+++G +QRFCQQCSRFHEL +FDE
Sbjct  70   SQPSCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDE  129

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST  463
            AKRSCRRRLAGHNERRR+ + +P GE S+
Sbjct  130  AKRSCRRRLAGHNERRRKSSGEPYGESSS  158



>ref|XP_009781601.1| PREDICTED: squamosa promoter-binding-like protein 4 [Nicotiana 
sylvestris]
Length=182

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 2/87 (2%)
 Frame = +2

Query  179  LTGGGST--QLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            L  GGS+  Q  CQ E C+ D++DAK YHRRHKVCE HAKA  V++ G++QRFCQQCSRF
Sbjct  39   LNNGGSSTNQRCCQAEKCSADLSDAKQYHRRHKVCEYHAKAQVVVVAGLRQRFCQQCSRF  98

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRI  433
            HEL +FDE+KRSCRRRLAGHNERRR+I
Sbjct  99   HELTEFDESKRSCRRRLAGHNERRRKI  125



>emb|CDX79544.1| BnaC03g18800D [Brassica napus]
Length=187

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 73/137 (53%), Positives = 93/137 (68%), Gaps = 2/137 (1%)
 Frame = +2

Query  32   TIKEMET--SKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQL  205
             I +M T  S  EGKRS+ E     E   +E++  E++ ++       G+  +   ++ +
Sbjct  49   NILKMSTRRSNAEGKRSLREMSEEEEDTFEEEDGEEQEEEEASEKKQKGKATSSSSNSGV  108

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQVE CT DM+ AK YH+RHKVCE HAKAP V I+G  QRFCQQCSRFH+L +FDEAKR
Sbjct  109  CCQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHDLREFDEAKR  168

Query  386  SCRRRLAGHNERRRRIT  436
            SCRRRLAGHNERRR+ T
Sbjct  169  SCRRRLAGHNERRRKST  185



>ref|XP_008225122.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=161

 Score =   132 bits (331),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 58/91 (64%), Positives = 71/91 (78%), Gaps = 0/91 (0%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
             GG   +  CQ +DC  D++DAK Y+RRHKVC +HAKAP+V + GVQQRFCQQCSRFH L
Sbjct  71   AGGSMARPSCQADDCNADLSDAKQYYRRHKVCGVHAKAPAVRVGGVQQRFCQQCSRFHSL  130

Query  362  AQFDEAKRSCRRRLAGHNERRRRITYDPRGE  454
             +FD+ KRSCRRRLAGHNERRR+ + +  GE
Sbjct  131  PEFDDNKRSCRRRLAGHNERRRKTSSEYHGE  161



>pdb|1UL4|A Chain A, Solution Structure Of The Dna-Binding Domain Of Squamosa 
Promoter Binding Protein-Like 4
Length=94

 Score =   130 bits (326),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/83 (71%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
            + G S    CQV+ CT DM +AK YHRRHKVCE+HAKA SV ++G+ QRFCQQCSRFH+L
Sbjct  2    SSGSSGLRLCQVDRCTADMKEAKLYHRRHKVCEVHAKASSVFLSGLNQRFCQQCSRFHDL  61

Query  362  AQFDEAKRSCRRRLAGHNERRRR  430
             +FDEAKRSCRRRLAGHNERRR+
Sbjct  62   QEFDEAKRSCRRRLAGHNERRRK  84



>ref|XP_004303145.1| PREDICTED: squamosa promoter-binding protein 1-like [Fragaria 
vesca subsp. vesca]
Length=178

 Score =   132 bits (333),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 68/120 (57%), Positives = 86/120 (72%), Gaps = 10/120 (8%)
 Frame = +2

Query  140  NKKKRALTLSGRKLTGGGST----QLF--CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPS  301
            NKKK+   + G    G GS     Q+   CQ + CT D++DAK YHRRHKVC+ H+KAP 
Sbjct  31   NKKKKLQVVGG---CGSGSVKNQNQMMRCCQADKCTADLSDAKLYHRRHKVCDQHSKAPV  87

Query  302  VLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTS  481
            VL++G+ QRFCQQCSRFHEL++FD+ KRSCRRRLAGHNERRR+   +    GS+ R+ TS
Sbjct  88   VLVSGISQRFCQQCSRFHELSEFDDTKRSCRRRLAGHNERRRKNLSETYAGGSS-RKGTS  146



>emb|CDY57212.1| BnaC04g44230D [Brassica napus]
Length=141

 Score =   131 bits (330),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 62/89 (70%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  170  GRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSR  349
            G+  T   S    CQVE CT DM+ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSR
Sbjct  51   GKATTSSSSGTGACQVERCTADMSRAKQYHKRHKVCEFHAKAPLVRISGLYQRFCQQCSR  110

Query  350  FHELAQFDEAKRSCRRRLAGHNERRRRIT  436
            FHEL++FD+ KRSCRRRLAGHNERRRR T
Sbjct  111  FHELSEFDDTKRSCRRRLAGHNERRRRNT  139



>gb|ADL36826.1| SPL domain class transcription factor [Malus domestica]
Length=189

 Score =   132 bits (333),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 60/89 (67%), Positives = 72/89 (81%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
            +Q  CQ E C  D+ DAK YHRRHKVCE H+KA  V+++G +QRFCQQCSRFHEL +FDE
Sbjct  70   SQPSCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDE  129

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST  463
            AKRSCRRRLAGHNERRR+ + +P GE S+
Sbjct  130  AKRSCRRRLAGHNERRRKSSGEPYGESSS  158



>ref|XP_008810376.1| PREDICTED: squamosa promoter-binding protein 1-like [Phoenix 
dactylifera]
Length=172

 Score =   132 bits (332),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 72/82 (88%), Gaps = 0/82 (0%)
 Frame = +2

Query  185  GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELA  364
             GG++Q  CQ E CT D+T+AK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFHEL+
Sbjct  53   AGGASQPCCQAEKCTADLTEAKRYHRRHKVCEAHSKAPVVIVAGLRQRFCQQCSRFHELS  112

Query  365  QFDEAKRSCRRRLAGHNERRRR  430
            +FD++KRSCRRRLAGHNERRR+
Sbjct  113  EFDDSKRSCRRRLAGHNERRRK  134



>ref|XP_006406996.1| hypothetical protein EUTSA_v10021617mg [Eutrema salsugineum]
 gb|ESQ48449.1| hypothetical protein EUTSA_v10021617mg [Eutrema salsugineum]
Length=181

 Score =   132 bits (333),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 75/93 (81%), Gaps = 1/93 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRHKVCE+HAKA +  + GV+QRFCQQCSRFHEL +FDE KR
Sbjct  62   LCQVDRCTANLTEAKQYYRRHKVCEVHAKATAATVAGVKQRFCQQCSRFHELPEFDETKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            SCRRRLAGHNERRR+ + D  GEGS  RR  SG
Sbjct  122  SCRRRLAGHNERRRKSSGDTFGEGSG-RRAFSG  153



>gb|ABO80946.1| SBP [Medicago truncatula]
Length=253

 Score =   134 bits (338),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  173  RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            R   GG S++ FCQVEDC  D+ +AK YHRRHKVCEIH+KA   L+    QRFCQQCSRF
Sbjct  133  RVAGGGSSSRAFCQVEDCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRF  192

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            H L +FDE KRSCRRRLAGHN+RRR+   D    GS+
Sbjct  193  HLLQEFDEGKRSCRRRLAGHNKRRRKTNQDAVPNGSS  229



>ref|XP_009626190.1| PREDICTED: squamosa promoter-binding-like protein 4 [Nicotiana 
tomentosiformis]
 gb|AJO69985.1| SBP-box 4 [Nicotiana tabacum]
Length=181

 Score =   132 bits (332),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 2/86 (2%)
 Frame = +2

Query  179  LTGGGS--TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            L  GGS  TQ  CQ E C+ D++DAK YHRRHKVCE HAKA  V++ G +QRFCQQCSRF
Sbjct  39   LNNGGSSTTQRCCQAEKCSADLSDAKQYHRRHKVCEYHAKAQVVVVAGFRQRFCQQCSRF  98

Query  353  HELAQFDEAKRSCRRRLAGHNERRRR  430
            HEL +FDE+KRSCRRRLAGHNERRR+
Sbjct  99   HELTEFDESKRSCRRRLAGHNERRRK  124



>emb|CDY24113.1| BnaA06g01110D [Brassica napus]
Length=161

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            GS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +F
Sbjct  55   GSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEF  113

Query  371  DEAKRSCRRRLAGHNERRRR  430
            DEAKRSCR+RLAGHNERRR+
Sbjct  114  DEAKRSCRKRLAGHNERRRK  133



>gb|KDP28324.1| hypothetical protein JCGZ_14095 [Jatropha curcas]
Length=983

 Score =   141 bits (355),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 60/96 (63%), Positives = 73/96 (76%), Gaps = 0/96 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG  ++  CQVEDC TD+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  146  KLVGGSMSRAVCQVEDCGTDLSNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  205

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
             L +FDE KRSCRRRLAGHN+RRR+   D    G++
Sbjct  206  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGTS  241



>ref|XP_009382775.1| PREDICTED: squamosa promoter-binding protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=178

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/90 (66%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +2

Query  194  STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFD  373
            ++Q  CQV+DC  D+ +AK YHRRHKVCE H+KA  V++ G++QRFCQQCSRFHELA+FD
Sbjct  70   ASQPCCQVDDCAADLREAKRYHRRHKVCEAHSKAAVVVVAGLRQRFCQQCSRFHELAEFD  129

Query  374  EAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            ++KRSCRRRLAGHNERRR+ + D + EGS 
Sbjct  130  DSKRSCRRRLAGHNERRRKSSTDTQPEGSN  159



>ref|XP_011458918.1| PREDICTED: squamosa promoter-binding protein 1-like [Fragaria 
vesca subsp. vesca]
Length=187

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ + C  D+ DAK YHRRHKVCE H+KA  V+++G +QRFCQQCSRFHE+A+FDE KRS
Sbjct  73   CQADRCGVDLGDAKIYHRRHKVCEFHSKAAVVVVSGARQRFCQQCSRFHEVAEFDETKRS  132

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTS  481
            CRRRLAGHNERRR+ + +P GEGS+ RR+ S
Sbjct  133  CRRRLAGHNERRRKSSGEPYGEGSS-RRSIS  162



>ref|XP_011047666.1| PREDICTED: squamosa promoter-binding protein 2-like isoform X1 
[Populus euphratica]
Length=257

 Score =   134 bits (336),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE CT ++TDAK YHRRHKVC  HAKA  VL+ G++QRFCQQCSRFHEL++FDE KRS
Sbjct  132  CQVEKCTANLTDAKQYHRRHKVCGHHAKAQVVLVAGIRQRFCQQCSRFHELSEFDETKRS  191

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGT  490
            CRRRLAGHNERRR+   +   EGS+ + N +  T
Sbjct  192  CRRRLAGHNERRRKNVVESHVEGSSRKVNGTHST  225



>ref|XP_008386198.1| PREDICTED: squamosa promoter-binding protein 1 [Malus domestica]
Length=189

 Score =   132 bits (331),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  200  QLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEA  379
            Q  CQ E C  D+ DAK YHRRHKVCE H+KA  V+++G +QRFCQQCSRFHEL +FDEA
Sbjct  71   QPSCQAERCGADLVDAKRYHRRHKVCEFHSKAAVVIVSGTRQRFCQQCSRFHELIEFDEA  130

Query  380  KRSCRRRLAGHNERRRRITYDPRGEGST  463
            KRSCRRRLAGHNERRR+ + +P GE S+
Sbjct  131  KRSCRRRLAGHNERRRKSSGEPYGESSS  158



>ref|XP_004485802.1| PREDICTED: squamosa promoter-binding-like protein 3-like [Cicer 
arietinum]
Length=145

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 72/91 (79%), Gaps = 0/91 (0%)
 Frame = +2

Query  185  GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELA  364
             GGS    CQV++C  D++ AK YH+RHKVCE HAKA SVLI  +QQRFCQQCSRFHE++
Sbjct  52   AGGSVLPCCQVDNCNADLSVAKQYHKRHKVCEHHAKAHSVLIQDLQQRFCQQCSRFHEVS  111

Query  365  QFDEAKRSCRRRLAGHNERRRRITYDPRGEG  457
            +FDE KRSCRRRLAGHNERRR+   +  GEG
Sbjct  112  EFDELKRSCRRRLAGHNERRRKNVSEYHGEG  142



>ref|XP_009147623.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Brassica rapa]
 ref|XP_009147624.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X2 
[Brassica rapa]
Length=180

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            GS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +F
Sbjct  55   GSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEF  113

Query  371  DEAKRSCRRRLAGHNERRRR  430
            DEAKRSCR+RLAGHNERRR+
Sbjct  114  DEAKRSCRKRLAGHNERRRK  133



>ref|XP_010656994.1| PREDICTED: squamosa promoter-binding protein 1 isoform X1 [Vitis 
vinifera]
Length=177

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 76/150 (51%), Positives = 94/150 (63%), Gaps = 20/150 (13%)
 Frame = +2

Query  38   KEMETSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQV  217
            K+M   + EG   ++E D +    +D         KKK A   SG+K     +    CQ 
Sbjct  4    KKMVKKEMEGTEEVDEDDQLGCSEDD--------KKKKAAAGGSGKK---AAAAMRCCQA  52

Query  218  EDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCS--------RFHELAQFD  373
            E CT D+TDAK YHRRHKVCE HAKA  V++ G++QRFCQQCS        RFHEL++FD
Sbjct  53   ERCTADLTDAKQYHRRHKVCEHHAKAQVVVVGGIRQRFCQQCSRFYSSGYCRFHELSEFD  112

Query  374  EAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            EAKRSCRRRLAGHNERRR+ + D   EGS+
Sbjct  113  EAKRSCRRRLAGHNERRRKNSADH-AEGSS  141



>ref|XP_008442764.1| PREDICTED: squamosa promoter-binding-like protein 3 isoform X1 
[Cucumis melo]
Length=167

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/117 (55%), Positives = 81/117 (69%), Gaps = 9/117 (8%)
 Frame = +2

Query  140  NKKKRALTLSG--RKLTGGG-------STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAK  292
            NKKK+ LT  G   K +G G       +    CQ ++C  D++ +K YHRRHKVCE HAK
Sbjct  51   NKKKKVLTSGGSSNKKSGSGFGTGPPAAAPPPCQADNCNADLSGSKRYHRRHKVCEFHAK  110

Query  293  APSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            AP+V + G+ QRFCQQCSRFH L +FD+ KRSCR+RLAGHN+RRR+ + D  GE ST
Sbjct  111  APAVAVAGIDQRFCQQCSRFHGLQEFDDTKRSCRKRLAGHNQRRRKSSSDLHGESST  167



>ref|XP_002515202.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF47186.1| conserved hypothetical protein [Ricinus communis]
Length=1012

 Score =   140 bits (353),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG  ++  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  146  KLVGGSMSRAVCQVEDCGADLSSAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  205

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
             L +FDE KRSCRRRLAGHN+RRR+   D  G  ST
Sbjct  206  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDTVGNAST  241



>ref|XP_003540122.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
 gb|KHN05763.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=190

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFH+LA+FDE+KRS
Sbjct  70   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  129

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+   +   EG++
Sbjct  130  CRRRLAGHNERRRKTNPEAANEGNS  154



>ref|XP_010091480.1| Squamosa promoter-binding-like protein 5 [Morus notabilis]
 gb|EXB44631.1| Squamosa promoter-binding-like protein 5 [Morus notabilis]
Length=209

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D++DAK YHRRHKVCE HAKA  VL+ GV+QRFCQQCSRFHEL++FDE +RS
Sbjct  87   CQAEKCAADLSDAKQYHRRHKVCEHHAKAQVVLVAGVRQRFCQQCSRFHELSEFDETRRS  146

Query  389  CRRRLAGHNERRRRITYDPRGEGS  460
            CRRRLAGHNERRR+ + +   EGS
Sbjct  147  CRRRLAGHNERRRKSSAETHAEGS  170



>dbj|BAJ34525.1| unnamed protein product [Thellungiella halophila]
Length=186

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
            T   CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + G+ QRFCQQCSRFHEL +FDE
Sbjct  61   TSRLCQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLAGISQRFCQQCSRFHELLEFDE  120

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            AKRSCRRRLAGHNERRR+ + +  GEGS  RR  +G   Q
Sbjct  121  AKRSCRRRLAGHNERRRKSSGESFGEGSGGRRGITGQMIQ  160



>emb|CDY61210.1| BnaC06g41420D [Brassica napus]
Length=179

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/80 (74%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            GS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +F
Sbjct  55   GSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEF  113

Query  371  DEAKRSCRRRLAGHNERRRR  430
            DEAK+SCR+RLAGHNERRR+
Sbjct  114  DEAKKSCRKRLAGHNERRRK  133



>ref|XP_009147622.1| PREDICTED: squamosa promoter-binding-like protein 4 isoform X1 
[Brassica rapa]
Length=190

 Score =   131 bits (330),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 60/80 (75%), Positives = 71/80 (89%), Gaps = 1/80 (1%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            GS++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + GV+QRFCQQCSRFHEL +F
Sbjct  55   GSSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVYLTGVKQRFCQQCSRFHELLEF  113

Query  371  DEAKRSCRRRLAGHNERRRR  430
            DEAKRSCR+RLAGHNERRR+
Sbjct  114  DEAKRSCRKRLAGHNERRRK  133



>gb|KEH24442.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=860

 Score =   139 bits (351),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  173  RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            R   GG S++ FCQVEDC  D+ +AK YHRRHKVCEIH+KA   L+    QRFCQQCSRF
Sbjct  133  RVAGGGSSSRAFCQVEDCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRF  192

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            H L +FDE KRSCRRRLAGHN+RRR+   D    GS+
Sbjct  193  HLLQEFDEGKRSCRRRLAGHNKRRRKTNQDAVPNGSS  229



>ref|XP_009132954.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=137

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/83 (73%), Positives = 69/83 (83%), Gaps = 0/83 (0%)
 Frame = +2

Query  194  STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFD  373
            S+ + CQVE CT DM+ AK YH+RHKVCE HAKAP V I+G  QRFCQQCSRFHEL +FD
Sbjct  55   SSGVCCQVERCTADMSRAKQYHKRHKVCEFHAKAPVVRISGGYQRFCQQCSRFHELREFD  114

Query  374  EAKRSCRRRLAGHNERRRRITYD  442
            EAKRSCRRRLAGHNERRR+ T +
Sbjct  115  EAKRSCRRRLAGHNERRRKSTNE  137



>gb|KDO86821.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=851

 Score =   139 bits (351),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>ref|XP_004505078.1| PREDICTED: squamosa promoter-binding protein 1-like [Cicer arietinum]
Length=121

 Score =   129 bits (324),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/95 (64%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query  161  TLSGRKLTGGGST-QLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
             + G K  GG S     CQVE+C  D+++AK YHRRHKVCE HAKAP+V I+G+QQRFCQ
Sbjct  27   VVKGSKGAGGSSNIATCCQVENCDADLSEAKQYHRRHKVCEYHAKAPAVHISGLQQRFCQ  86

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYD  442
            QCSRFHEL++FD++KRSCRRRLA HN RRR+   D
Sbjct  87   QCSRFHELSEFDDSKRSCRRRLAEHNLRRRKNAND  121



>ref|XP_009141347.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=141

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  170  GRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSR  349
            G+  T   S    CQVE CT DM+ AK YH+RH+VCE HAKAP V I+G+ QRFCQQCSR
Sbjct  51   GKATTSSSSGTGACQVERCTADMSRAKQYHKRHRVCEFHAKAPLVRISGLYQRFCQQCSR  110

Query  350  FHELAQFDEAKRSCRRRLAGHNERRRRIT  436
            FHEL +FD+ KRSCRRRLAGHNERRRR T
Sbjct  111  FHELGEFDDTKRSCRRRLAGHNERRRRNT  139



>ref|XP_011005940.1| PREDICTED: squamosa promoter-binding-like protein 1 isoform X2 
[Populus euphratica]
Length=974

 Score =   139 bits (351),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 74/96 (77%), Gaps = 0/96 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GGG ++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  140  KLVGGGLSRAVCQVEDCGVDLSNAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  199

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
             L +FDE KRSCRRRLAGHN+RRR+   D  G GS+
Sbjct  200  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDTVGNGSS  235



>emb|CDY37684.1| BnaA04g19840D [Brassica napus]
Length=141

 Score =   129 bits (325),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/89 (69%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  170  GRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSR  349
            G+  T   S    CQVE CT DM  AK YH+RH+VCE HAKAP V I+G+ QRFCQQCSR
Sbjct  51   GKATTSSSSGTGACQVERCTADMNRAKQYHKRHRVCEFHAKAPLVRISGLYQRFCQQCSR  110

Query  350  FHELAQFDEAKRSCRRRLAGHNERRRRIT  436
            FHEL++FD+ KRSCRRRLAGHNERRRR T
Sbjct  111  FHELSEFDDTKRSCRRRLAGHNERRRRNT  139



>gb|AAV51939.1| SBP transcription factor [Gossypium hirsutum]
Length=169

 Score =   130 bits (327),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++DAK YHRRHKVCEIHAKAP V++ G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  42   CQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRS  101

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  102  CRRRLAGHNERRRK  115



>gb|AIL95850.1| SQUAMOSA promoter binding-like transcription factor [Gossypium 
hirsutum]
 gb|KHG05742.1| Squamosa promoter-binding-like protein 5 [Gossypium arboreum]
Length=182

 Score =   130 bits (328),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/74 (80%), Positives = 67/74 (91%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++DAK YHRRHKVCEIHAKAP V++ G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  55   CQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRS  114

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  115  CRRRLAGHNERRRK  128



>ref|XP_009392815.1| PREDICTED: squamosa promoter-binding-like protein 3 [Musa acuminata 
subsp. malaccensis]
Length=187

 Score =   130 bits (328),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 75/91 (82%), Gaps = 1/91 (1%)
 Frame = +2

Query  194  STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFD  373
            + Q  CQ E+CT D+T+AK YHRRHKVCE H+KA  V++ G +QRFCQQCSRFHELA+FD
Sbjct  70   APQPCCQAENCTADLTEAKRYHRRHKVCEAHSKAAVVMVAGFRQRFCQQCSRFHELAEFD  129

Query  374  EAKRSCRRRLAGHNERRRRITYDPR-GEGST  463
            ++KRSCRRRLAGHNERRR+ + D + GEGS 
Sbjct  130  DSKRSCRRRLAGHNERRRKSSSDAQAGEGSN  160



>ref|XP_010509826.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=142

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 67/84 (80%), Gaps = 0/84 (0%)
 Frame = +2

Query  191  GSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
             S+   CQV+ CT DM+ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSRFHEL +F
Sbjct  59   ASSSGVCQVQSCTADMSKAKQYHKRHKVCESHAKAPIVRISGLHQRFCQQCSRFHELGEF  118

Query  371  DEAKRSCRRRLAGHNERRRRITYD  442
            D AKRSCRRRLAGHNERRR+   D
Sbjct  119  DLAKRSCRRRLAGHNERRRKSAID  142



>ref|XP_010413803.1| PREDICTED: squamosa promoter-binding-like protein 3 [Camelina 
sativa]
Length=141

 Score =   129 bits (324),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 57/79 (72%), Positives = 66/79 (84%), Gaps = 0/79 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT DM+ AK YH+RHKVCE HAKAP V I+G+ QRFCQQCSRFHEL +FD+AKR
Sbjct  63   VCQVQSCTVDMSKAKQYHKRHKVCEFHAKAPIVRISGLHQRFCQQCSRFHELGEFDKAKR  122

Query  386  SCRRRLAGHNERRRRITYD  442
            SCRRRLAGHNERRR+   +
Sbjct  123  SCRRRLAGHNERRRKSAIE  141



>ref|XP_006444595.1| hypothetical protein CICLE_v10018697mg [Citrus clementina]
 gb|ESR57835.1| hypothetical protein CICLE_v10018697mg [Citrus clementina]
 gb|KDO86819.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=988

 Score =   139 bits (350),  Expect = 4e-34, Method: Composition-based stats.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>emb|CAD90156.1| squamosa promoter binding like-protein [Betula pendula]
 emb|CAD90157.1| squamosa promoter binding like-protein [Betula pendula]
Length=134

 Score =   129 bits (323),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE+C  D+TDAK YHRRHKVCE HAKAP V + G Q+RFCQQCSRFH+L++FDE K+S
Sbjct  50   CQVENCNADLTDAKHYHRRHKVCESHAKAPIVYVAGGQKRFCQQCSRFHDLSEFDEYKKS  109

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CR+RLAGHNERRR+ + D   EGS 
Sbjct  110  CRKRLAGHNERRRKSSSDFHREGSN  134



>gb|KEH19523.1| squamosa promoter-binding-like protein [Medicago truncatula]
Length=180

 Score =   130 bits (327),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFH+L +FDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGMRQRFCQQCSRFHDLVEFDESKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+   +   EGS+
Sbjct  125  CRRRLAGHNERRRKTNPETANEGSS  149



>ref|XP_004488737.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X2 [Cicer arietinum]
Length=171

 Score =   130 bits (326),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +2

Query  146  KKRALTLSGRK--LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            KK++  ++G+K     G  +  FCQ E C  D T +K YHRRHKVCE+H+KAPSV++ G+
Sbjct  32   KKKSACVNGKKRPSKSGRFSPPFCQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGL  91

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +QRFCQQCSRFHEL +FDEAKRSCRRRLA HNERRR+       EGS+
Sbjct  92   RQRFCQQCSRFHELMEFDEAKRSCRRRLARHNERRRKSPSGICNEGSS  139



>ref|XP_006582910.1| PREDICTED: uncharacterized protein LOC100789055 isoform X1 [Glycine 
max]
Length=146

 Score =   129 bits (323),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV++C  D+++AK YHRRHKVCE HAKAPSV + G+QQRFCQQCSRFHEL++FD++KRS
Sbjct  65   CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGE  454
            CR RLAGHNERRR+   D  GE
Sbjct  125  CRTRLAGHNERRRKNAVDYHGE  146



>gb|KHN15472.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=146

 Score =   129 bits (323),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 58/82 (71%), Positives = 70/82 (85%), Gaps = 0/82 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV++C  D+++AK YHRRHKVCE HAKAPSV + G+QQRFCQQCSRFHEL++FD++KRS
Sbjct  65   CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHELSEFDDSKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGE  454
            CR RLAGHNERRR+   D  GE
Sbjct  125  CRTRLAGHNERRRKNAVDYHGE  146



>ref|XP_004488736.1| PREDICTED: squamosa promoter-binding-like protein 5-like isoform 
X1 [Cicer arietinum]
Length=181

 Score =   129 bits (325),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 2/108 (2%)
 Frame = +2

Query  146  KKRALTLSGRK--LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGV  319
            KK++  ++G+K     G  +  FCQ E C  D T +K YHRRHKVCE+H+KAPSV++ G+
Sbjct  42   KKKSACVNGKKRPSKSGRFSPPFCQAESCDADFTLSKRYHRRHKVCEVHSKAPSVVVAGL  101

Query  320  QQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +QRFCQQCSRFHEL +FDEAKRSCRRRLA HNERRR+       EGS+
Sbjct  102  RQRFCQQCSRFHELMEFDEAKRSCRRRLARHNERRRKSPSGICNEGSS  149



>gb|KFK38868.1| spl5 [Arabis alpina]
Length=181

 Score =   129 bits (325),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ C  ++T+AK YHRRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDE KR
Sbjct  62   LCQVDRCAANLTEAKQYHRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDETKR  121

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            SCRRRLAGHNERRR+ + +  GEGS  RR  SG
Sbjct  122  SCRRRLAGHNERRRKSSGESFGEGSG-RRGFSG  153



>ref|XP_009115660.1| PREDICTED: squamosa promoter-binding-like protein 5 [Brassica 
rapa]
Length=176

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV  CT ++T+AK Y+RRHKVCE+HAKA +  ++G +QRFCQQCSRFHEL +FDEAKR
Sbjct  60   LCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAKR  119

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            SCR RLAGHNERRR+++ D  GE S  RR  SG
Sbjct  120  SCRMRLAGHNERRRKVSGDSFGERSG-RRGFSG  151



>emb|CDY20128.1| BnaA01g28740D [Brassica napus]
Length=176

 Score =   129 bits (324),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/93 (66%), Positives = 74/93 (80%), Gaps = 1/93 (1%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV  CT ++T+AK Y+RRHKVCE+HAKA +  ++G +QRFCQQCSRFHEL +FDEAKR
Sbjct  60   LCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKQRFCQQCSRFHELPEFDEAKR  119

Query  386  SCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            SCR RLAGHNERRR+++ D  GE S  RR  SG
Sbjct  120  SCRMRLAGHNERRRKVSGDSFGERSG-RRGFSG  151



>ref|XP_004510032.1| PREDICTED: squamosa promoter-binding-like protein 13-like [Cicer 
arietinum]
Length=187

 Score =   129 bits (325),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 73/96 (76%), Gaps = 4/96 (4%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFH+L +FDE+KRS
Sbjct  71   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLVEFDESKRS  130

Query  389  CRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            CRRRLAGHNERRR+   +   EG +     S G NQ
Sbjct  131  CRRRLAGHNERRRKTNPEAANEGCS----HSKGQNQ  162



>ref|XP_004293885.1| PREDICTED: squamosa promoter-binding-like protein 3 [Fragaria 
vesca subsp. vesca]
Length=157

 Score =   129 bits (323),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/154 (45%), Positives = 95/154 (62%), Gaps = 21/154 (14%)
 Frame = +2

Query  44   METSKPEGKRSIN-----------ETDSVAeggedededveedNKKKRALTLSGRKLT--  184
            ME +K +GKRS+N             +              ED+++KR + ++    T  
Sbjct  1    MEPNKAQGKRSLNLDIEEEEEEEEADEDEDHTSRPSVLVHGEDDRRKRVMVMNSASATSP  60

Query  185  ------GGGS--TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQ  340
                   GGS  T+  CQ + C  D++DAK Y+RRHKVC+ H+KAP V+I G++QRFCQQ
Sbjct  61   SKKGSAAGGSMTTRPSCQAQSCNADLSDAKQYYRRHKVCDFHSKAPVVVIGGLRQRFCQQ  120

Query  341  CSRFHELAQFDEAKRSCRRRLAGHNERRRRITYD  442
            CSRFH+L++FDE KRSCRRRLAGHNERRR+ + D
Sbjct  121  CSRFHDLSEFDENKRSCRRRLAGHNERRRKNSSD  154



>ref|XP_008447446.1| PREDICTED: squamosa promoter-binding-like protein 12 [Cucumis 
melo]
Length=1013

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG S +  CQVEDC  D+++AK YHRRHKVCE H+KA + L+  V QRFCQQCSRFH
Sbjct  145  KLAGGNSNRAVCQVEDCGADLSNAKDYHRRHKVCETHSKASNALVANVMQRFCQQCSRFH  204

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+I  D
Sbjct  205  VLQEFDEGKRSCRRRLAGHNKRRRKINPD  233



>ref|XP_004148578.1| PREDICTED: squamosa promoter-binding-like protein 12-like [Cucumis 
sativus]
 gb|KGN58531.1| hypothetical protein Csa_3G664550 [Cucumis sativus]
Length=1013

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG S +  CQVEDC  D+++AK YHRRHKVCE H+KA + L+  V QRFCQQCSRFH
Sbjct  145  KLAGGNSNRAVCQVEDCGADLSNAKDYHRRHKVCETHSKASNALVANVMQRFCQQCSRFH  204

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+I  D
Sbjct  205  VLQEFDEGKRSCRRRLAGHNKRRRKINPD  233



>ref|XP_004166093.1| PREDICTED: LOW QUALITY PROTEIN: squamosa promoter-binding-like 
protein 12-like [Cucumis sativus]
Length=1014

 Score =   138 bits (347),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/89 (67%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG S +  CQVEDC  D+++AK YHRRHKVCE H+KA + L+  V QRFCQQCSRFH
Sbjct  145  KLAGGNSNRAVCQVEDCGADLSNAKDYHRRHKVCETHSKASNALVANVMQRFCQQCSRFH  204

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+I  D
Sbjct  205  VLQEFDEGKRSCRRRLAGHNKRRRKINPD  233



>ref|XP_008439842.1| PREDICTED: squamosa promoter-binding protein 1 [Cucumis melo]
Length=142

 Score =   128 bits (321),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/107 (57%), Positives = 77/107 (72%), Gaps = 0/107 (0%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQ  322
            +++  LT       GG ST   CQ + C  D+T A+PYHRRHKVCE HAKA  V++ G++
Sbjct  35   RRRSGLTTGRGGGGGGRSTVARCQADGCNADLTGARPYHRRHKVCEFHAKAAVVILAGLE  94

Query  323  QRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QRFCQQCSRFH +++FD+ KRSCR RLAGHNERRR+I  D  G+ ST
Sbjct  95   QRFCQQCSRFHAVSEFDDTKRSCRSRLAGHNERRRKILPDFHGQSST  141



>ref|XP_009617582.1| PREDICTED: squamosa promoter-binding-like protein 12 [Nicotiana 
tomentosiformis]
Length=1001

 Score =   137 bits (346),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 65/116 (56%), Positives = 82/116 (71%), Gaps = 5/116 (4%)
 Frame = +2

Query  167  SGRKLTGGG---STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
            SG+K   GG   +  + CQV+DC TD+++AK YHRRHKVC++H+KA   L+  V QRFCQ
Sbjct  135  SGKKTKIGGVLSNRAVCCQVQDCRTDLSNAKDYHRRHKVCDVHSKAAKALVGNVMQRFCQ  194

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLI  505
            QCSRFH L +FDE KRSCRRRLAGHN RRR+   +    G++   N  GG+N LLI
Sbjct  195  QCSRFHVLQEFDEGKRSCRRRLAGHNRRRRKTHPENVANGAS--MNDEGGSNYLLI  248



>ref|XP_011100353.1| PREDICTED: squamosa promoter-binding protein 1-like [Sesamum 
indicum]
Length=183

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 75/95 (79%), Gaps = 1/95 (1%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C+ D+++AK YHR HKVCE HAKA  V++ G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  75   CQAEKCSADLSEAKTYHRLHKVCEHHAKAQVVVVAGIRQRFCQQCSRFHELSEFDEAKRS  134

Query  389  CRRRLAGHNERRRR-ITYDPRGEGST*RRNTSGGT  490
            CRRRLAGHNERRR+  T + + EGST  R   G T
Sbjct  135  CRRRLAGHNERRRKNPTENTQAEGSTGSRIKGGNT  169



>ref|XP_007198845.1| hypothetical protein PRUPE_ppa011968mg [Prunus persica]
 gb|EMJ00044.1| hypothetical protein PRUPE_ppa011968mg [Prunus persica]
Length=189

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/117 (57%), Positives = 85/117 (73%), Gaps = 6/117 (5%)
 Frame = +2

Query  143  KKKRALTLSG---RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLIN  313
            KKK  +  SG   R  T GG T+  CQ + C  D++DAK YHRRHKVC++H+KA  VL++
Sbjct  44   KKKGIVGGSGSVKRSGTSGGGTRC-CQADRCPADLSDAKQYHRRHKVCDLHSKAQVVLVS  102

Query  314  GVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSG  484
            G++QRFCQQCSRFHEL +FD+ KRSCRRRLAGHNERRR+ + +   EG    RN +G
Sbjct  103  GLRQRFCQQCSRFHELPEFDDTKRSCRRRLAGHNERRRKNSVESNAEGPN--RNGTG  157



>gb|KHN18285.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=181

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 70/85 (82%), Gaps = 4/85 (5%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP V++ G++QRFCQQCSRFH+LA+FDE+KRS
Sbjct  65   CQAERCGADLTDAKRYHRRHKVCEFHSKAPVVVVAGLRQRFCQQCSRFHDLAEFDESKRS  124

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR  +     EGST
Sbjct  125  CRRRLAGHNERRREAS----NEGST  145



>ref|XP_007133260.1| hypothetical protein PHAVU_011G164800g [Phaseolus vulgaris]
 gb|ESW05254.1| hypothetical protein PHAVU_011G164800g [Phaseolus vulgaris]
Length=186

 Score =   129 bits (323),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE H+KAP+V++ G++QRFCQQCSRFH+LA+FDE+KRS
Sbjct  66   CQAERCGADLTDAKRYHRRHKVCEFHSKAPAVVVAGLRQRFCQQCSRFHDLAEFDESKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGS  460
            CRRRLAGHNERRR+   +   +GS
Sbjct  126  CRRRLAGHNERRRKSNPEACSDGS  149



>gb|EPS70852.1| squamosa promoter-binding protein 2, partial [Genlisea aurea]
Length=87

 Score =   126 bits (316),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/83 (66%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            C VEDC  D++  K YH+RHKVCE+HAK+P VL++G++QRFCQQCSRFHE++QFD  KRS
Sbjct  5    CLVEDCGADLSACKKYHQRHKVCEVHAKSPVVLVDGIRQRFCQQCSRFHEVSQFDHTKRS  64

Query  389  CRRRLAGHNERRRRITYDPRGEG  457
            CRRRLAGHNERRR+ T + + +G
Sbjct  65   CRRRLAGHNERRRKSTAESQKQG  87



>ref|XP_009620386.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
tomentosiformis]
Length=172

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K+ G  ++   CQ + CT D++DAK YH+RHKVCE HAKA +V++ G++QRFCQQCSRFH
Sbjct  40   KIKGSSTSMRCCQADKCTVDLSDAKQYHKRHKVCEYHAKAQAVVVAGLRQRFCQQCSRFH  99

Query  356  ELAQFDEAKRSCRRRLAGHNERRRR  430
            E+ +FDE+KRSCRRRLAGHNERRR+
Sbjct  100  EVGEFDESKRSCRRRLAGHNERRRK  124



>ref|XP_011082696.1| PREDICTED: squamosa promoter-binding protein 2-like [Sesamum 
indicum]
Length=198

 Score =   129 bits (324),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            C VE+C  D++  K YH+RH+VCE+HAKAP VL++G++QRFCQQCSRFHEL++FD+ KRS
Sbjct  83   CLVENCEADLSCCKKYHQRHRVCEVHAKAPVVLVDGLRQRFCQQCSRFHELSEFDQTKRS  142

Query  389  CRRRLAGHNERRRRITYDPRGEGST*R  469
            CRRRLAGHNERRR+ + + R EGS  R
Sbjct  143  CRRRLAGHNERRRKSSLESRREGSNRR  169



>ref|XP_009143829.1| PREDICTED: squamosa promoter-binding-like protein 3 [Brassica 
rapa]
Length=150

 Score =   127 bits (320),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/74 (78%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE CT DM+ AK YHRRHKVCE HAKAP V I G+ QRFCQQCSRFH+L +FDE+KRS
Sbjct  61   CQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYGLHQRFCQQCSRFHDLGEFDESKRS  120

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  121  CRRRLAGHNERRRK  134



>ref|XP_006392823.1| hypothetical protein EUTSA_v10011728mg [Eutrema salsugineum]
 gb|ESQ30109.1| hypothetical protein EUTSA_v10011728mg [Eutrema salsugineum]
Length=255

 Score =   130 bits (328),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 83/106 (78%), Gaps = 1/106 (1%)
 Frame = +2

Query  179  LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHE  358
            ++  G+++L CQV+ CT D+ +AK YHRRHKVCE+HAKA SV + G+ QRFCQQCSRFHE
Sbjct  125  ISDRGTSRL-CQVDRCTADLKEAKQYHRRHKVCEVHAKASSVFLAGISQRFCQQCSRFHE  183

Query  359  LAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQ  496
            L +FDEAKRSCRRRLAGHNERRR+ + +  GEGS  RR  +G   Q
Sbjct  184  LLEFDEAKRSCRRRLAGHNERRRKSSGESFGEGSGGRRGITGQMIQ  229



>gb|KDO86825.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=578

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>ref|XP_010694791.1| PREDICTED: squamosa promoter-binding-like protein 1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694792.1| PREDICTED: squamosa promoter-binding-like protein 1 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010694793.1| PREDICTED: squamosa promoter-binding-like protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=999

 Score =   137 bits (345),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/96 (64%), Positives = 71/96 (74%), Gaps = 0/96 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG S +  CQVEDC  D+T AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  135  KLVGGSSNRAVCQVEDCGADLTKAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  194

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
             L +FDE KRSCRRRLAGHN+RRR+   D    G++
Sbjct  195  VLQEFDEGKRSCRRRLAGHNKRRRKTQPDTAVHGNS  230



>gb|KDO86826.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
 gb|KDO86827.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=586

 Score =   135 bits (339),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>ref|XP_009352877.1| PREDICTED: squamosa promoter-binding-like protein 3 [Pyrus x 
bretschneideri]
Length=174

 Score =   128 bits (322),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 54/85 (64%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV++CT D++D K Y+RRHKVC++HAKA S+++ G +QRFCQQCSRFH L++FD++KRS
Sbjct  88   CQVDNCTADLSDLKQYYRRHKVCDVHAKASSIVVGGFRQRFCQQCSRFHSLSEFDDSKRS  147

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+ + +  G G T
Sbjct  148  CRRRLAGHNERRRKTSSEYHGHGGT  172



>gb|KDO86828.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=592

 Score =   134 bits (338),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>ref|XP_008229071.1| PREDICTED: squamosa promoter-binding-like protein 3 [Prunus mume]
Length=189

 Score =   128 bits (322),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 82/110 (75%), Gaps = 4/110 (4%)
 Frame = +2

Query  143  KKKRALTLSG---RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLIN  313
            KKK  +  SG   R  T GG T+  CQ + C  D++DAK YHRRHKVC++H+KA  VL++
Sbjct  44   KKKGIVGGSGSVKRSGTSGGGTRC-CQADRCPADLSDAKQYHRRHKVCDLHSKAQVVLVS  102

Query  314  GVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            G++QRFCQQCSRFHEL +FD+ KRSCRRRLAGHNERRR+ + +   EG +
Sbjct  103  GLRQRFCQQCSRFHELPEFDDTKRSCRRRLAGHNERRRKNSVESHAEGPS  152



>emb|CAB56772.1| Squamosa promoter binding protein-like 5 [Arabidopsis thaliana]
Length=138

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 55/77 (71%), Positives = 68/77 (88%), Gaps = 0/77 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV+ CT ++T+AK Y+RRH+VCE+HAKA +  + GV+QRFCQQCSRFHEL +FDEAKR
Sbjct  62   LCQVDRCTVNLTEAKQYYRRHRVCEVHAKASAATVAGVRQRFCQQCSRFHELPEFDEAKR  121

Query  386  SCRRRLAGHNERRRRIT  436
            SCRRRLAGHNERRR+I+
Sbjct  122  SCRRRLAGHNERRRKIS  138



>ref|XP_004232901.1| PREDICTED: squamosa promoter-binding protein 1 isoform X3 [Solanum 
lycopersicum]
Length=126

 Score =   126 bits (316),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/103 (69%), Positives = 80/103 (78%), Gaps = 4/103 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            MET+K EGKRSI E    AE  EDE   VEED+K+KR LTLSGRKL G GS    CQV+ 
Sbjct  1    METNKWEGKRSITE----AEKEEDEHGSVEEDSKRKRVLTLSGRKLVGEGSAHPSCQVDQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            CT DM DAKPYHRRHKVCE H+K+P VLI+G+Q+RFCQQCSRF
Sbjct  57   CTADMADAKPYHRRHKVCEFHSKSPIVLISGLQKRFCQQCSRF  99



>ref|XP_004146615.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
Length=139

 Score =   126 bits (317),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 73/142 (51%), Positives = 92/142 (65%), Gaps = 5/142 (4%)
 Frame = +2

Query  44   METSKPEGKRSIN--ETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQV  217
            M T K +GKR ++  E +   E  E+EDED E  + KK A    G       +    CQ 
Sbjct  1    MATGKADGKRRLSYYEMEEEDEEDEEEDEDEERSSNKKSASAFGGAPAA---APPPPCQA  57

Query  218  EDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRR  397
            ++C  D++ +K YHRRHKVCE HAKAP V + G+ QRFCQQCSRFH L +FDE KRSCR+
Sbjct  58   DNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRSCRK  117

Query  398  RLAGHNERRRRITYDPRGEGST  463
            RLAGHN+RRR+ + D  GE ST
Sbjct  118  RLAGHNQRRRKSSSDLHGESST  139



>gb|EMT03959.1| Squamosa promoter-binding-like protein 7 [Aegilops tauschii]
Length=185

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 71/143 (50%), Positives = 88/143 (62%), Gaps = 13/143 (9%)
 Frame = +2

Query  176  KLTGGGSTQLF--CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSR  349
            K  GGG+T     CQVE C   +  AK YHRRHKVCE H+KAP V+++G +QRFCQQCSR
Sbjct  46   KAAGGGATASMPRCQVEGCHMALAGAKEYHRRHKVCEAHSKAPRVIVHGAEQRFCQQCSR  105

Query  350  FHELAQFDEAKRSCRRRLAGHNERRRRITY-DPRGEGST*RRNTSGGTNQLLIGTHK---  517
            FH +A+FD+AKRSCRRRLAGHNERRR+    D    GS      + G  Q L+ T +   
Sbjct  106  FHAMAEFDDAKRSCRRRLAGHNERRRKSNASDAMARGSA----HAHGAPQRLLATRQWSR  161

Query  518  ---KIGL*TT*LINVISSMLSIF  577
                +   +  L  VI  M SI+
Sbjct  162  CRWPLLAFSDVLALVIEEMASIY  184



>ref|XP_004134953.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 ref|XP_004155646.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
 gb|KGN49239.1| hypothetical protein Csa_6G517960 [Cucumis sativus]
Length=141

 Score =   126 bits (317),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 70/90 (78%), Gaps = 0/90 (0%)
 Frame = +2

Query  194  STQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFD  373
            ST   CQ + C  D+T AKPYHRRHKVCE H++A  V++ G++QRFCQQCSRFH L++FD
Sbjct  51   STVARCQADGCNADLTGAKPYHRRHKVCEFHSRAAVVILAGLEQRFCQQCSRFHALSEFD  110

Query  374  EAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            + KRSCR RLAGHNERRR+I  D  G+ ST
Sbjct  111  DTKRSCRMRLAGHNERRRKILPDFHGQSST  140



>ref|XP_007145109.1| hypothetical protein PHAVU_007G210600g [Phaseolus vulgaris]
 gb|ESW17103.1| hypothetical protein PHAVU_007G210600g [Phaseolus vulgaris]
Length=1014

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 59/102 (58%), Positives = 77/102 (75%), Gaps = 2/102 (2%)
 Frame = +2

Query  164  LSGRK--LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
            ++G+K  ++G  S +  CQVEDC+ D++ AK YHRRHKVCE+H+KA   L+    QRFCQ
Sbjct  139  MNGKKSRVSGSTSNRAVCQVEDCSADLSKAKDYHRRHKVCEMHSKASRALVGNAMQRFCQ  198

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QCSRFH L +FDE KRSCRRRLAGHN+RRR+  ++P   GS+
Sbjct  199  QCSRFHMLQEFDEGKRSCRRRLAGHNKRRRKTNHEPVPNGSS  240



>gb|KDO86824.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=658

 Score =   134 bits (338),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>gb|KJB13326.1| hypothetical protein B456_002G068300 [Gossypium raimondii]
Length=182

 Score =   127 bits (320),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++ AK YHRRHKVCEIHAKAP V++ G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  59   CQVEKCGVDLSVAKRYHRRHKVCEIHAKAPVVVVAGIRQRFCQQCSRFHELSEFDEAKRS  118

Query  389  CRRRLAGHNERRRR  430
            CR RLAGHNERRR+
Sbjct  119  CRSRLAGHNERRRK  132



>ref|XP_010678887.1| PREDICTED: squamosa promoter-binding-like protein 1 [Beta vulgaris 
subsp. vulgaris]
Length=996

 Score =   136 bits (342),  Expect = 5e-33, Method: Composition-based stats.
 Identities = 62/102 (61%), Positives = 73/102 (72%), Gaps = 3/102 (3%)
 Frame = +2

Query  167  SGRKL---TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
            SG+K     GG S +  CQVEDC  D+T AK YHRRHKVCE+H+KA   L+  V QRFCQ
Sbjct  124  SGKKTKLAAGGSSNRALCQVEDCGADLTKAKDYHRRHKVCEMHSKATKALVANVMQRFCQ  183

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            QCSRFH L +FDE KRSCRRRLAGHN+RRR+   D    G++
Sbjct  184  QCSRFHALQEFDEGKRSCRRRLAGHNKRRRKTQPDTVAGGNS  225



>ref|XP_002282598.1| PREDICTED: squamosa promoter-binding-like protein 3 [Vitis vinifera]
 emb|CBI20271.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   128 bits (321),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+TDAK YHRRHKVCE+HAKA  V + G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  84   CQAEKCGADLTDAKRYHRRHKVCEVHAKAAMVEVAGLRQRFCQQCSRFHELSEFDEAKRS  143

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  144  CRRRLAGHNERRRK  157



>gb|KGN64693.1| hypothetical protein Csa_1G074980 [Cucumis sativus]
Length=162

 Score =   127 bits (318),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ ++C  D++ +K YHRRHKVCE HAKAP V + G+ QRFCQQCSRFH L +FDE KRS
Sbjct  78   CQADNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRS  137

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CR+RLAGHN+RRR+ + D  GE ST
Sbjct  138  CRKRLAGHNQRRRKSSSDLHGESST  162



>gb|KJB49739.1| hypothetical protein B456_008G135700 [Gossypium raimondii]
Length=888

 Score =   135 bits (341),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL+GG   +  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  145  KLSGGSGNRAVCQVEDCGADLSHAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  204

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+   D
Sbjct  205  VLQEFDEGKRSCRRRLAGHNKRRRKTNPD  233



>ref|XP_007046540.1| Squamosa promoter-binding protein-like 12 [Theobroma cacao]
 gb|EOX90697.1| Squamosa promoter-binding protein-like 12 [Theobroma cacao]
Length=198

 Score =   128 bits (321),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 75/98 (77%), Gaps = 1/98 (1%)
 Frame = +2

Query  161  TLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQ  340
            + S R+  GGGS  L CQ ++C TD+ DAK YHRRHKVCE HAKA  V + G++QRFCQQ
Sbjct  60   SASCRRGDGGGSL-LCCQADECDTDLRDAKQYHRRHKVCERHAKAAFVSVKGIRQRFCQQ  118

Query  341  CSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGE  454
            CSRFHE+++FD  KRSCR RLAGHNERRR++  D + E
Sbjct  119  CSRFHEISEFDSTKRSCRDRLAGHNERRRKVQSDQQAE  156



>gb|EYU42136.1| hypothetical protein MIMGU_mgv1a014682mg [Erythranthe guttata]
Length=181

 Score =   127 bits (320),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 56/89 (63%), Positives = 70/89 (79%), Gaps = 0/89 (0%)
 Frame = +2

Query  197  TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDE  376
            T   CQ E C+ D++DAK YHRRHKVCE HAKA  V++ G++QRFCQQCSRFH++ +FDE
Sbjct  52   TMKSCQAEKCSADLSDAKTYHRRHKVCEHHAKAQVVVVAGIRQRFCQQCSRFHDILEFDE  111

Query  377  AKRSCRRRLAGHNERRRRITYDPRGEGST  463
            +KRSCRRRLAGHNERRR+   D   +G+ 
Sbjct  112  SKRSCRRRLAGHNERRRKNPADSYSQGAA  140



>gb|KDP24104.1| hypothetical protein JCGZ_25761 [Jatropha curcas]
Length=127

 Score =   125 bits (315),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E CT D+T AKPYH+RHKVCE H+KA  V+++G++QRFCQQCSRFHEL++FDE KRS
Sbjct  4    CQAEKCTADLTYAKPYHKRHKVCEYHSKAQIVVVDGIRQRFCQQCSRFHELSEFDETKRS  63

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  64   CRRRLAGHNERRRK  77



>ref|XP_003593617.1| Squamosa promoter binding-like protein [Medicago truncatula]
 gb|AES63868.1| squamosa promoter-binding-like protein [Medicago truncatula]
 gb|AFK46131.1| unknown [Medicago truncatula]
 gb|AFK48393.1| unknown [Medicago truncatula]
Length=143

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 3/99 (3%)
 Frame = +2

Query  143  KKKRALT--LSGRKLT-GGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLIN  313
            K+KR +T  L  +K +  GGS    CQV++C  D++ AK YH+RHKVCE H+KA SVLI+
Sbjct  39   KRKRVVTDHLYNKKGSKAGGSVTPSCQVDNCNADLSAAKQYHKRHKVCENHSKAHSVLIS  98

Query  314  GVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRR  430
             +QQRFCQQCSRFHE+++FD+ KRSCRRRLAGHNERRR+
Sbjct  99   ELQQRFCQQCSRFHEVSEFDDLKRSCRRRLAGHNERRRK  137



>ref|XP_004164023.1| PREDICTED: squamosa promoter-binding protein 1-like [Cucumis 
sativus]
Length=142

 Score =   126 bits (316),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 55/85 (65%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ ++C  D++ +K YHRRHKVCE HAKAP V + G+ QRFCQQCSRFH L +FDE KRS
Sbjct  58   CQADNCNADLSSSKRYHRRHKVCEFHAKAPVVPVTGIDQRFCQQCSRFHGLQEFDETKRS  117

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CR+RLAGHN+RRR+ + D  GE ST
Sbjct  118  CRKRLAGHNQRRRKSSSDLHGESST  142



>emb|CBI37021.3| unnamed protein product [Vitis vinifera]
Length=860

 Score =   135 bits (340),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL G  S++  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+    QRFCQQCSRFH
Sbjct  120  KLAGVSSSRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKAGCALVGNDMQRFCQQCSRFH  179

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G G++   + + G
Sbjct  180  VLQEFDEGKRSCRRRLAGHNKRRRKTHPDAAGNGNSLNDDQASG  223



>gb|KHG24779.1| Squamosa promoter-binding-like protein 5 [Gossypium arboreum]
Length=182

 Score =   127 bits (319),  Expect = 8e-33, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 66/74 (89%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++ AK YHRRHKVCEIHAKAP V++ G++QRFCQQCSRFHEL++FDEAKRS
Sbjct  59   CQVEKCGVDLSVAKRYHRRHKVCEIHAKAPIVVVAGIRQRFCQQCSRFHELSEFDEAKRS  118

Query  389  CRRRLAGHNERRRR  430
            CR RLAGHNERRR+
Sbjct  119  CRSRLAGHNERRRK  132



>ref|XP_004239889.1| PREDICTED: squamosa promoter-binding-like protein 1 [Solanum 
lycopersicum]
Length=1003

 Score =   135 bits (340),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/110 (57%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K++G  S +  CQV+DC  D++ AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KISGVSSNRAVCQVQDCRADLSSAKDYHRRHKVCEVHSKAAKALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLI  505
             L +FDE KRSCRRRLAGHN+RRR+   +    G++   N  GG+N LLI
Sbjct  199  VLEEFDEGKRSCRRRLAGHNKRRRKTHPENVANGAS--VNDEGGSNYLLI  246



>gb|KJB49738.1| hypothetical protein B456_008G135700 [Gossypium raimondii]
Length=987

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/89 (65%), Positives = 68/89 (76%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL+GG   +  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  145  KLSGGSGNRAVCQVEDCGADLSHAKDYHRRHKVCEMHSKASKALVGNVMQRFCQQCSRFH  204

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+   D
Sbjct  205  VLQEFDEGKRSCRRRLAGHNKRRRKTNPD  233



>ref|XP_011040504.1| PREDICTED: squamosa promoter-binding-like protein 1 [Populus 
euphratica]
Length=1004

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL G G ++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+    QRFCQQCSRFH
Sbjct  140  KLAGSGLSRAVCQVEDCGVDLSNAKDYHRRHKVCEMHSKASKALVGNAMQRFCQQCSRFH  199

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G GS+   + + G
Sbjct  200  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVGNGSSMNDDQTSG  243



>ref|XP_002320264.2| hypothetical protein POPTR_0014s10960g [Populus trichocarpa]
 gb|EEE98579.2| hypothetical protein POPTR_0014s10960g [Populus trichocarpa]
Length=1004

 Score =   135 bits (340),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL G G ++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+    QRFCQQCSRFH
Sbjct  140  KLVGSGLSRAVCQVEDCGVDLSNAKDYHRRHKVCEMHSKASKALVGNAMQRFCQQCSRFH  199

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G GS+   + + G
Sbjct  200  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDTVGNGSSMNDDQTSG  243



>gb|KDO86822.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=774

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>gb|KJB22424.1| hypothetical protein B456_004G047200 [Gossypium raimondii]
 gb|KJB22425.1| hypothetical protein B456_004G047200 [Gossypium raimondii]
Length=982

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL+GG   +  CQV+DC  D++DAK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  142  KLSGGSGNRAVCQVDDCRADLSDAKDYHRRHKVCEMHSKASKTLVGNVMQRFCQQCSRFH  201

Query  356  ELAQFDEAKRSCRRRLAGHNERRRR  430
             L +FD+ KRSCRRRLAGHN+RRR+
Sbjct  202  VLQEFDDGKRSCRRRLAGHNKRRRK  226



>gb|KDO86823.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=766

 Score =   134 bits (338),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>gb|KHG26890.1| Squamosa promoter-binding-like protein 1 [Gossypium arboreum]
Length=982

 Score =   135 bits (340),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL+GG   +  CQV+DC  D++DAK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  142  KLSGGSGNRAVCQVDDCRADLSDAKDYHRRHKVCEMHSKASKTLVGNVMQRFCQQCSRFH  201

Query  356  ELAQFDEAKRSCRRRLAGHNERRRR  430
             L +FD+ KRSCRRRLAGHN+RRR+
Sbjct  202  VLQEFDDGKRSCRRRLAGHNKRRRK  226



>ref|XP_003543233.1| PREDICTED: squamosa promoter-binding protein 2-like [Glycine 
max]
Length=187

 Score =   127 bits (318),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+T AK YHRRHKVCE+H+KAPSV++ G++QRFCQQCSRFHELA+FDEAKRS
Sbjct  66   CQAEICGADLTVAKRYHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFHELAEFDEAKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLA HNERRR+   +   EG +
Sbjct  126  CRRRLARHNERRRKSNAETCNEGCS  150



>emb|CDY17204.1| BnaA05g09840D [Brassica napus]
Length=142

 Score =   125 bits (315),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/74 (77%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE CT DM+ AK YHRRHKVCE HAKAP V I  + QRFCQQCSRFH+L +FDE+KRS
Sbjct  53   CQVERCTADMSRAKQYHRRHKVCEFHAKAPVVRIYSLHQRFCQQCSRFHDLGEFDESKRS  112

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  113  CRRRLAGHNERRRK  126



>ref|XP_010652308.1| PREDICTED: squamosa promoter-binding-like protein 1 [Vitis vinifera]
Length=1016

 Score =   135 bits (339),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL G  S++  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+    QRFCQQCSRFH
Sbjct  141  KLAGVSSSRAVCQVEDCGADLSKAKDYHRRHKVCEMHSKAGCALVGNDMQRFCQQCSRFH  200

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D  G G++   + + G
Sbjct  201  VLQEFDEGKRSCRRRLAGHNKRRRKTHPDAAGNGNSLNDDQASG  244



>gb|EPS64133.1| hypothetical protein M569_10651, partial [Genlisea aurea]
Length=112

 Score =   124 bits (312),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 55/79 (70%), Positives = 64/79 (81%), Gaps = 0/79 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ ++CT DM   KPYHRRH+VCE HAKA  VL++G  QRFCQQCSRFH L++FD+ KRS
Sbjct  33   CQADNCTADMAAEKPYHRRHRVCEFHAKAVGVLLDGSWQRFCQQCSRFHGLSEFDDVKRS  92

Query  389  CRRRLAGHNERRRRITYDP  445
            CRRRLAGHNERRR+ T D 
Sbjct  93   CRRRLAGHNERRRKSTSDS  111



>ref|XP_006367482.1| PREDICTED: squamosa promoter-binding protein 1-like [Solanum 
tuberosum]
Length=165

 Score =   126 bits (316),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D++DAK YH+RHKVCE HAKA  V++ G++QRFCQQCSRFHEL +FDE+KRS
Sbjct  59   CQAEKCNVDLSDAKQYHKRHKVCEYHAKAQVVVVAGLRQRFCQQCSRFHELTEFDESKRS  118

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  119  CRRRLAGHNERRRK  132



>gb|AIL95861.1| SQUAMOSA promoter binding-like transcription factor [Gossypium 
hirsutum]
Length=982

 Score =   134 bits (338),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 56/85 (66%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL+GG   +  CQV+DC  D++DAK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  142  KLSGGSGNRAVCQVDDCRADLSDAKDYHRRHKVCEMHSKASKTLVGNVMQRFCQQCSRFH  201

Query  356  ELAQFDEAKRSCRRRLAGHNERRRR  430
             L +FD+ KRSCRRRLAGHN+RRR+
Sbjct  202  VLQEFDDGKRSCRRRLAGHNKRRRK  226



>ref|XP_010661347.1| PREDICTED: squamosa promoter-binding-like protein 7 isoform X1 
[Vitis vinifera]
Length=399

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +2

Query  179  LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHE  358
            + G  +T   CQVE C   + +AK YHRRHKVCE+H+KAP V++ G++QRFCQQCSRFH 
Sbjct  152  VVGSPATVPRCQVEGCHVALVNAKDYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHA  211

Query  359  LAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIG  508
            +++FD++KRSCRRRLAGHNERRR+ ++D      +  RN S   N+L+ G
Sbjct  212  VSEFDDSKRSCRRRLAGHNERRRKSSHD------SVARNPSQAANKLMTG  255



>emb|CBI16615.3| unnamed protein product [Vitis vinifera]
Length=404

 Score =   131 bits (329),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 60/110 (55%), Positives = 81/110 (74%), Gaps = 6/110 (5%)
 Frame = +2

Query  179  LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHE  358
            + G  +T   CQVE C   + +AK YHRRHKVCE+H+KAP V++ G++QRFCQQCSRFH 
Sbjct  152  VVGSPATVPRCQVEGCHVALVNAKDYHRRHKVCEMHSKAPKVVVLGLEQRFCQQCSRFHA  211

Query  359  LAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIG  508
            +++FD++KRSCRRRLAGHNERRR+ ++D      +  RN S   N+L+ G
Sbjct  212  VSEFDDSKRSCRRRLAGHNERRRKSSHD------SVARNPSQAANKLMTG  255



>emb|CDP20025.1| unnamed protein product [Coffea canephora]
Length=359

 Score =   130 bits (327),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 54/81 (67%), Positives = 67/81 (83%), Gaps = 0/81 (0%)
 Frame = +2

Query  188  GGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQ  367
            GG     CQVE C  D++DAKPY+ RHKVC  H+K+P+V++ G+QQRFCQQCSRFH+L +
Sbjct  51   GGGQPPRCQVEGCKLDLSDAKPYYSRHKVCGAHSKSPTVIVAGLQQRFCQQCSRFHQLPE  110

Query  368  FDEAKRSCRRRLAGHNERRRR  430
            FD+ KRSCRRRLAGHNERRR+
Sbjct  111  FDQGKRSCRRRLAGHNERRRK  131



>ref|XP_007149828.1| hypothetical protein PHAVU_005G101900g [Phaseolus vulgaris]
 gb|ESW21822.1| hypothetical protein PHAVU_005G101900g [Phaseolus vulgaris]
Length=169

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  203  LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAK  382
            L CQ E C  D+ +AK YHRRHKVCE HAKA  VL++G++QRFCQQCSRFHEL++FD+AK
Sbjct  43   LCCQAEKCNADLHEAKQYHRRHKVCECHAKAQVVLVHGIKQRFCQQCSRFHELSEFDDAK  102

Query  383  RSCRRRLAGHNERRRRITYD-PRGEGST  463
            RSCRRRLA HNERRR+ + D  + EGS+
Sbjct  103  RSCRRRLAVHNERRRKNSSDQSQAEGSS  130



>ref|XP_003626036.1| SQUAMOSA promoter binding protein [Medicago truncatula]
Length=994

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  173  RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            R   GG S++ FCQVEDC  D+ +AK YHRRHKVCEIH+KA   L+    QRFCQQCSRF
Sbjct  133  RVAGGGSSSRAFCQVEDCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRF  192

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            H L +FDE KRSCRRRLAGHN+RRR+   D    GS+
Sbjct  193  HLLQEFDEGKRSCRRRLAGHNKRRRKTNQDAVPNGSS  229



>gb|AES82254.2| squamosa promoter-binding-like protein [Medicago truncatula]
Length=1001

 Score =   134 bits (338),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/97 (63%), Positives = 71/97 (73%), Gaps = 0/97 (0%)
 Frame = +2

Query  173  RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            R   GG S++ FCQVEDC  D+ +AK YHRRHKVCEIH+KA   L+    QRFCQQCSRF
Sbjct  133  RVAGGGSSSRAFCQVEDCRADLNNAKDYHRRHKVCEIHSKASKALVGNAMQRFCQQCSRF  192

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST  463
            H L +FDE KRSCRRRLAGHN+RRR+   D    GS+
Sbjct  193  HLLQEFDEGKRSCRRRLAGHNKRRRKTNQDAVPNGSS  229



>gb|KDO86820.1| hypothetical protein CISIN_1g001971mg [Citrus sinensis]
Length=964

 Score =   134 bits (337),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 61/104 (59%), Positives = 75/104 (72%), Gaps = 0/104 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K  GG S++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  V QRFCQQCSRFH
Sbjct  139  KFGGGSSSRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKASRALVGNVMQRFCQQCSRFH  198

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
             L +FDE KRSCRRRLAGHN+RRR+   D    GS+   + + G
Sbjct  199  VLQEFDEGKRSCRRRLAGHNKRRRKTNPDAVANGSSPNNDQTSG  242



>emb|CDY32310.1| BnaC01g36290D [Brassica napus]
Length=176

 Score =   125 bits (315),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  206  FCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKR  385
             CQV  CT ++T+AK Y+RRHKVCE+HAKA +  ++G + RFCQQCSRFHEL +FDEAKR
Sbjct  60   LCQVHRCTANLTEAKQYYRRHKVCEVHAKASAATVSGAKHRFCQQCSRFHELPEFDEAKR  119

Query  386  SCRRRLAGHNERRRRITYDPRGEGS  460
            SCR RLAGHNERRR+++ D  GE S
Sbjct  120  SCRMRLAGHNERRRKVSGDSFGERS  144



>ref|XP_009398957.1| PREDICTED: squamosa promoter-binding protein 1-like [Musa acuminata 
subsp. malaccensis]
Length=166

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/83 (64%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+ +AK YHRRH+VCE H+KA  V++ G++QRFCQQCSRFHE+++FD++KRS
Sbjct  55   CQAEKCAADLAEAKRYHRRHRVCEAHSKAAVVIVAGLRQRFCQQCSRFHEVSEFDDSKRS  114

Query  389  CRRRLAGHNERRRRITYDPRGEG  457
            CRRRLAGHNERRR+ + D +G+G
Sbjct  115  CRRRLAGHNERRRKSSSDSQGDG  137



>ref|XP_006347009.1| PREDICTED: squamosa promoter-binding protein 1-like isoform X1 
[Solanum tuberosum]
Length=136

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 66/109 (61%), Positives = 80/109 (73%), Gaps = 4/109 (4%)
 Frame = +2

Query  44   METSKPEGKRSINETDSVAeggedededveedNKKKRALTLSGRKLTGGGSTQLFCQVED  223
            MET+K EGKRSINE +   +  E  +ED    +K+KR LTLSGRKL G GS    CQV+ 
Sbjct  1    METNKWEGKRSINEAEEEEDEHESVEED----SKRKRVLTLSGRKLAGEGSAHPSCQVDQ  56

Query  224  CTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQF  370
            CT +M DAKPYHRRHKVCE H+K+P VLI+G+QQRFCQQCSRF  +  +
Sbjct  57   CTANMADAKPYHRRHKVCEFHSKSPIVLISGLQQRFCQQCSRFPSIGVY  105



>ref|XP_009765576.1| PREDICTED: squamosa promoter-binding-like protein 3 [Nicotiana 
sylvestris]
Length=167

 Score =   125 bits (314),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 53/85 (62%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K+ G  ++   CQ + CT +++DAK YH+RHKVCE HAK+ +V++ G++QRFCQQCSRFH
Sbjct  36   KIKGSSTSMRCCQADKCTVNLSDAKQYHKRHKVCEYHAKSQAVVVAGLRQRFCQQCSRFH  95

Query  356  ELAQFDEAKRSCRRRLAGHNERRRR  430
            E+ +FDE+KRSCRRRLAGHNERRR+
Sbjct  96   EVGEFDESKRSCRRRLAGHNERRRK  120



>ref|NP_001236309.1| uncharacterized protein LOC100527199 [Glycine max]
 gb|ACU16251.1| unknown [Glycine max]
Length=142

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV++C  D+++AK YHRRHKVCE HAKAPSV + G+QQRFCQQCSRFH L++FD++KRS
Sbjct  65   CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDDSKRS  124

Query  389  CRRRLAGHNERRRRITYD  442
            CR RLAGHNERRR+   D
Sbjct  125  CRTRLAGHNERRRKYAVD  142



>ref|XP_006653653.1| PREDICTED: squamosa promoter-binding-like protein 7-like [Oryza 
brachyantha]
Length=278

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/74 (74%), Positives = 65/74 (88%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C   +T  K YHRRHKVCE+HAKAP V+++G++QRFCQQCSRFH LA+FD+AK+S
Sbjct  105  CQVEGCDVTLTGVKEYHRRHKVCEVHAKAPRVVVHGIEQRFCQQCSRFHVLAEFDDAKKS  164

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRRR
Sbjct  165  CRRRLAGHNERRRR  178



>ref|XP_010045710.1| PREDICTED: squamosa promoter-binding-like protein 1 [Eucalyptus 
grandis]
 gb|KCW88656.1| hypothetical protein EUGRSUZ_A01019 [Eucalyptus grandis]
Length=983

 Score =   134 bits (336),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/116 (53%), Positives = 80/116 (69%), Gaps = 2/116 (2%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            KL GG +++  CQVEDC  D+++AK YHRRHKVCE+H+KA   L+  + QRFCQQCSRFH
Sbjct  143  KLAGGSASRAVCQVEDCGADLSNAKDYHRRHKVCEMHSKATKALVGNIMQRFCQQCSRFH  202

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIGTHKKI  523
             L +FDE KRSCRRRLAGHN+RRR+   +P    +    N    ++ LLI   K +
Sbjct  203  ALQEFDEGKRSCRRRLAGHNKRRRKT--NPEATPNANSVNDEQASSYLLISLLKIL  256



>ref|XP_010106183.1| hypothetical protein L484_009607 [Morus notabilis]
 gb|EXC08464.1| hypothetical protein L484_009607 [Morus notabilis]
Length=159

 Score =   124 bits (312),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/95 (62%), Positives = 74/95 (78%), Gaps = 1/95 (1%)
 Frame = +2

Query  182  TGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHEL  361
            +GG  + L CQ      D +DAK  HRRHKVCE+H+KAP VL+ G++QRFCQQCSRFHE+
Sbjct  59   SGGAVSPLSCQAGRGGADPSDAKRSHRRHKVCEVHSKAPVVLVAGLRQRFCQQCSRFHEV  118

Query  362  AQFDEAKRSCRRRLAGHNERRRRITYDP-RGEGST  463
            ++FDEAKRSCRRRLAGHNERRR+ + +   GE S+
Sbjct  119  SEFDEAKRSCRRRLAGHNERRRKSSVESCHGESSS  153



>gb|ACU24116.1| unknown [Glycine max]
Length=187

 Score =   125 bits (314),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+T AK +HRRHKVCE+H+KAPSV++ G++QRFCQQCSRFHELA+FDEAKRS
Sbjct  66   CQAEICGADLTVAKRFHRRHKVCELHSKAPSVMVAGLRQRFCQQCSRFHELAEFDEAKRS  125

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLA HNERRR+   +   EG +
Sbjct  126  CRRRLARHNERRRKSNAETCNEGCS  150



>gb|KHN09987.1| Squamosa promoter-binding protein 1 [Glycine soja]
Length=141

 Score =   124 bits (311),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 55/78 (71%), Positives = 67/78 (86%), Gaps = 0/78 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQV++C  D+++AK YHRRHKVCE HAKAPSV + G+QQRFCQQCSRFH L++FD++KRS
Sbjct  64   CQVDNCDADLSEAKQYHRRHKVCEYHAKAPSVHMAGLQQRFCQQCSRFHVLSEFDDSKRS  123

Query  389  CRRRLAGHNERRRRITYD  442
            CR RLAGHNERRR+   D
Sbjct  124  CRTRLAGHNERRRKYAVD  141



>gb|ADL36825.1| SPL domain class transcription factor [Malus domestica]
 gb|AHC08500.1| SBP-box transcription factor [Malus domestica]
Length=149

 Score =   124 bits (311),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/91 (62%), Positives = 74/91 (81%), Gaps = 1/91 (1%)
 Frame = +2

Query  167  SGRKLTGGGSTQ-LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQC  343
            +GR+   GGST    C+V+ C  D++D K Y+RRHKVC++HAKAP+V + G++QRFCQQC
Sbjct  57   TGRRSGAGGSTAGPCCKVDCCNADLSDLKQYYRRHKVCDVHAKAPAVFMGGIRQRFCQQC  116

Query  344  SRFHELAQFDEAKRSCRRRLAGHNERRRRIT  436
            SRFH L++FD+ KRSCRRRLAGHNERRR+ +
Sbjct  117  SRFHSLSEFDDRKRSCRRRLAGHNERRRKTS  147



>gb|KJB81972.1| hypothetical protein B456_013G169800 [Gossypium raimondii]
Length=182

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 56/70 (80%), Positives = 63/70 (90%), Gaps = 0/70 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C  D++DAK YHRRHKVCEIHAKAP V++ G++QRFCQQCSRFHEL +FDEAKRS
Sbjct  55   CQVEKCGLDLSDAKRYHRRHKVCEIHAKAPFVVVAGLRQRFCQQCSRFHELPEFDEAKRS  114

Query  389  CRRRLAGHNE  418
            CRRRLAGHNE
Sbjct  115  CRRRLAGHNE  124



>ref|XP_010091413.1| Squamosa promoter-binding-like protein 1 [Morus notabilis]
 gb|EXB44450.1| Squamosa promoter-binding-like protein 1 [Morus notabilis]
Length=1026

 Score =   133 bits (335),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 78/110 (71%), Gaps = 3/110 (3%)
 Frame = +2

Query  167  SGRK---LTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQ  337
            SG+K     GG S++  CQVEDC  D++ AK YHRRHKVCE+H+KA   L+  V QRFCQ
Sbjct  156  SGKKTKLAAGGSSSRAVCQVEDCGADLSSAKDYHRRHKVCEMHSKACKALVGNVLQRFCQ  215

Query  338  QCSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGG  487
            QCSRFH L +FDE KRSCRRRLAGHN+RRR+   DP   GS+   + + G
Sbjct  216  QCSRFHVLQEFDEGKRSCRRRLAGHNKRRRKTNPDPVVNGSSLNDDQTSG  265



>ref|XP_006858268.1| hypothetical protein AMTR_s00062p00211520 [Amborella trichopoda]
 gb|ERN19735.1| hypothetical protein AMTR_s00062p00211520 [Amborella trichopoda]
Length=195

 Score =   125 bits (314),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 3/85 (4%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D++ AK YHRRHKVCE+H+K+PS L+ G+ QRFCQQCSRFHEL++FDEAKRS
Sbjct  53   CQAERCRADLSAAKRYHRRHKVCEVHSKSPSTLVAGLLQRFCQQCSRFHELSEFDEAKRS  112

Query  389  CRRRLAGHNERRRRITYDPRGEGST  463
            CRRRLAGHNERRR+    P  EG  
Sbjct  113  CRRRLAGHNERRRKT---PSTEGGV  134



>dbj|BAM15477.1| SBP-box protein [Torenia fournieri]
Length=139

 Score =   124 bits (310),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/106 (55%), Positives = 77/106 (73%), Gaps = 10/106 (9%)
 Frame = +2

Query  143  KKKRALTLSGRKLTGGGS----------TQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAK  292
            K+KRA     +++   GS          +QL C V++C +D+   K YH+RH+VCE+HAK
Sbjct  20   KEKRACEFKKKRVAVEGSKNKNSTMKVASQLCCVVDNCESDLNGCKKYHQRHRVCELHAK  79

Query  293  APSVLINGVQQRFCQQCSRFHELAQFDEAKRSCRRRLAGHNERRRR  430
            A   L++G +QRFCQQCSRFHEL++FD+AKRSCRRRLAGHNERRR+
Sbjct  80   AAMALVDGTRQRFCQQCSRFHELSEFDQAKRSCRRRLAGHNERRRK  125



>ref|XP_004494461.1| PREDICTED: squamosa promoter-binding-like protein 12-like [Cicer 
arietinum]
Length=995

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 61/96 (64%), Positives = 70/96 (73%), Gaps = 0/96 (0%)
 Frame = +2

Query  173  RKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRF  352
            R   GG S++ FCQVEDC  D+ +AK YHRRHKVCEIH+KA   L+    QRFCQQCSRF
Sbjct  126  RVAAGGTSSRAFCQVEDCRADLNNAKDYHRRHKVCEIHSKACKALVGNTMQRFCQQCSRF  185

Query  353  HELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGS  460
            H L +FDE KRSCRRRLAGHN+RRR+   D    GS
Sbjct  186  HMLQEFDEGKRSCRRRLAGHNKRRRKTNQDAVPNGS  221



>ref|XP_010469241.1| PREDICTED: squamosa promoter-binding-like protein 12 [Camelina 
sativa]
Length=904

 Score =   133 bits (334),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 66/121 (55%), Positives = 83/121 (69%), Gaps = 6/121 (5%)
 Frame = +2

Query  170  GRKLTGGGSTQ---LFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQ  340
             +K   GG+ Q   + CQVE+C  D+T AK YHRRHKVCE+H+KA S L+  + QRFCQQ
Sbjct  101  AKKTKLGGALQTRAISCQVENCGADLTKAKDYHRRHKVCEMHSKATSALVGSIMQRFCQQ  160

Query  341  CSRFHELAQFDEAKRSCRRRLAGHNERRRRITYDPRGEGST*RRNTSGGTNQLLIGTHKK  520
            CSRFH L +FDE KRSCRRRLAGHN+RRR+   D  G+G+     + G T+  L+ T  K
Sbjct  161  CSRFHVLEEFDEGKRSCRRRLAGHNKRRRKANPDTLGDGTP---TSDGQTSNYLLITLLK  217

Query  521  I  523
            I
Sbjct  218  I  218



>ref|XP_004243367.2| PREDICTED: squamosa promoter-binding-like protein 3 [Solanum 
lycopersicum]
Length=157

 Score =   124 bits (311),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 53/74 (72%), Positives = 64/74 (86%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D++DAK YH+RHKVCE HAK+  V++ G++QRFCQQCSRFHEL +FDE+KRS
Sbjct  53   CQAEKCNVDLSDAKQYHKRHKVCEYHAKSQVVVVAGLRQRFCQQCSRFHELTEFDESKRS  112

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  113  CRRRLAGHNERRRK  126



>gb|EPS59677.1| hypothetical protein M569_15126, partial [Genlisea aurea]
Length=76

 Score =   121 bits (304),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 54/74 (73%), Positives = 63/74 (85%), Gaps = 0/74 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQVE C+ DM   K YHRRH+VCE HAKA +VL++G  QRFCQQCSRFHEL++FD+ KRS
Sbjct  1    CQVESCSADMAAEKQYHRRHRVCESHAKAVAVLLDGAWQRFCQQCSRFHELSEFDDVKRS  60

Query  389  CRRRLAGHNERRRR  430
            CRRRLAGHNERRR+
Sbjct  61   CRRRLAGHNERRRK  74



>ref|XP_003560169.2| PREDICTED: squamosa promoter-binding-like protein 13 [Brachypodium 
distachyon]
Length=176

 Score =   124 bits (312),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 66/81 (81%), Gaps = 0/81 (0%)
 Frame = +2

Query  209  CQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFHELAQFDEAKRS  388
            CQ E C  D+T+AK YHRRHKVCE HAKA  VL+ G++QRFCQQCSRFHEL +FD+ KRS
Sbjct  69   CQAERCPADLTEAKRYHRRHKVCEAHAKAAVVLVAGLRQRFCQQCSRFHELLEFDDTKRS  128

Query  389  CRRRLAGHNERRRRITYDPRG  451
            CRRRLAGHNERRR+ + D  G
Sbjct  129  CRRRLAGHNERRRKSSADANG  149



>ref|XP_003534999.1| PREDICTED: squamosa promoter-binding-like protein 12-like [Glycine 
max]
Length=1032

 Score =   132 bits (333),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K+T   S++  CQVEDC  D+++AK YHRRHKVC++H+KA   L+  V QRFCQQCSRFH
Sbjct  137  KMTASTSSRAVCQVEDCRADLSNAKDYHRRHKVCDMHSKATQALVGNVMQRFCQQCSRFH  196

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+   D
Sbjct  197  VLQEFDEGKRSCRRRLAGHNKRRRKTLPD  225



>gb|KHN29773.1| Squamosa promoter-binding-like protein 1 [Glycine soja]
Length=1033

 Score =   132 bits (333),  Expect = 8e-32, Method: Composition-based stats.
 Identities = 56/89 (63%), Positives = 69/89 (78%), Gaps = 0/89 (0%)
 Frame = +2

Query  176  KLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRFCQQCSRFH  355
            K+T   S++  CQVEDC  D+++AK YHRRHKVC++H+KA   L+  V QRFCQQCSRFH
Sbjct  137  KMTASTSSRAVCQVEDCRADLSNAKDYHRRHKVCDMHSKATQALVGNVMQRFCQQCSRFH  196

Query  356  ELAQFDEAKRSCRRRLAGHNERRRRITYD  442
             L +FDE KRSCRRRLAGHN+RRR+   D
Sbjct  197  VLQEFDEGKRSCRRRLAGHNKRRRKTLPD  225



>ref|XP_004252249.1| PREDICTED: squamosa promoter-binding-like protein 6 [Solanum 
lycopersicum]
Length=447

 Score =   129 bits (325),  Expect = 9e-32, Method: Compositional matrix adjust.
 Identities = 57/93 (61%), Positives = 70/93 (75%), Gaps = 0/93 (0%)
 Frame = +2

Query  152  RALTLSGRKLTGGGSTQLFCQVEDCTTDMTDAKPYHRRHKVCEIHAKAPSVLINGVQQRF  331
            +  +LS  K    G    FCQV+ C  D+T  K YH+RHKVCEIH+K   V++NG+QQRF
Sbjct  74   KNFSLSSTKRNRAGGLNSFCQVQGCGKDLTSCKDYHKRHKVCEIHSKTAKVIVNGIQQRF  133

Query  332  CQQCSRFHELAQFDEAKRSCRRRLAGHNERRRR  430
            CQQCSRFH LA+FD+ KRSCR+RLAGHNERRR+
Sbjct  134  CQQCSRFHLLAEFDDGKRSCRKRLAGHNERRRK  166



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 764930893160