BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B18

Length=566
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010100873.1|  hypothetical protein L484_023685                 51.2    9e-06   
gb|KGN60725.1|  hypothetical protein Csa_2G008650                     48.5    9e-05   Cucumis sativus [cucumbers]
ref|XP_011084182.1|  PREDICTED: protein NRT1/ PTR FAMILY 5.5-like     51.2    2e-04   



>ref|XP_010100873.1| hypothetical protein L484_023685 [Morus notabilis]
 gb|EXB85452.1| hypothetical protein L484_023685 [Morus notabilis]
Length=67

 Score = 51.2 bits (121),  Expect = 9e-06, Method: Compositional matrix adjust.
 Identities = 48/70 (69%), Positives = 55/70 (79%), Gaps = 3/70 (4%)
 Frame = +3

Query  81   MLRRRPSKIEVKIEDKVELEEARKRaaaaaaaaavttstssstatgatsLLHHFDRSAVD  260
            MLRR+P+KIEV+IEDK ELEEARKR  AAAAAA  T++ SS+  TGATSLL   DR A D
Sbjct  1    MLRRKPTKIEVRIEDKDELEEARKR--AAAAAATATSTISSAANTGATSLLQQLDR-AKD  57

Query  261  PSSKSHGIGL  290
             SSK+H IGL
Sbjct  58   TSSKAHRIGL  67



>gb|KGN60725.1| hypothetical protein Csa_2G008650 [Cucumis sativus]
Length=68

 Score = 48.5 bits (114),  Expect = 9e-05, Method: Compositional matrix adjust.
 Identities = 42/72 (58%), Positives = 56/72 (78%), Gaps = 4/72 (6%)
 Frame = +3

Query  81   MLRRRPSKIEVKIEDKVELEEARKRaaaaaaaaavttstssstatgatsLLHHFDRSAVD  260
            MLRR+PSKIEVKIEDK ELE+ARKR   AAAAA+ TT+T++   + A SLLH+ +R+  D
Sbjct  1    MLRRQPSKIEVKIEDKEELEQARKR---AAAAASTTTTTTTDATSAAGSLLHNINRNK-D  56

Query  261  PSSKSHGIGLSS  296
             +SK+  +G+SS
Sbjct  57   QASKAQRLGISS  68



>ref|XP_011084182.1| PREDICTED: protein NRT1/ PTR FAMILY 5.5-like [Sesamum indicum]
Length=618

 Score = 51.2 bits (121),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  78   EMLRRRPSKIEVKIEDKVELEEARKR  155
            EMLRR+P+KIEVK+EDK ELEEARKR
Sbjct  554  EMLRRKPTKIEVKVEDKEELEEARKR  579



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920