BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B16

Length=177
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU38615.1|  hypothetical protein MIMGU_mgv1a007931mg              80.1    4e-16   Erythranthe guttata [common monkey flower]
ref|XP_004143304.1|  PREDICTED: fructose-bisphosphate aldolase, c...  78.2    2e-15   Cucumis sativus [cucumbers]
ref|XP_011094409.1|  PREDICTED: fructose-bisphosphate aldolase cy...  77.4    3e-15   Sesamum indicum [beniseed]
ref|NP_001274769.1|  uncharacterized protein LOC102577667             77.0    4e-15   Solanum tuberosum [potatoes]
gb|KCW89239.1|  hypothetical protein EUGRSUZ_A01538                   75.9    6e-15   Eucalyptus grandis [rose gum]
ref|XP_010049816.1|  PREDICTED: fructose-bisphosphate aldolase cy...  76.6    7e-15   Eucalyptus grandis [rose gum]
dbj|BAE48790.1|  fructose-bisphosphate aldolase                       76.6    7e-15   Codonopsis lanceolata
ref|XP_009617881.1|  PREDICTED: fructose-bisphosphate aldolase cy...  76.3    9e-15   Nicotiana tomentosiformis
ref|XP_009352992.1|  PREDICTED: fructose-bisphosphate aldolase cy...  75.9    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_008391754.1|  PREDICTED: fructose-bisphosphate aldolase cy...  75.9    1e-14   
ref|XP_008386942.1|  PREDICTED: fructose-bisphosphate aldolase cy...  75.9    1e-14   Malus domestica [apple tree]
ref|XP_009365338.1|  PREDICTED: fructose-bisphosphate aldolase cy...  75.9    1e-14   Pyrus x bretschneideri [bai li]
ref|XP_011101492.1|  PREDICTED: fructose-bisphosphate aldolase cy...  75.1    2e-14   Sesamum indicum [beniseed]
ref|NP_001275379.1|  fructose-bisphosphate aldolase-like protein      75.1    3e-14   Solanum tuberosum [potatoes]
ref|XP_008241286.1|  PREDICTED: fructose-bisphosphate aldolase cy...  74.7    3e-14   Prunus mume [ume]
ref|XP_009778188.1|  PREDICTED: fructose-bisphosphate aldolase cy...  74.7    4e-14   Nicotiana sylvestris
ref|XP_009789131.1|  PREDICTED: fructose-bisphosphate aldolase cy...  74.7    4e-14   Nicotiana sylvestris
ref|XP_007202254.1|  hypothetical protein PRUPE_ppa007696mg           74.7    4e-14   Prunus persica
emb|CBI30253.3|  unnamed protein product                              74.3    4e-14   Vitis vinifera
ref|XP_004249455.1|  PREDICTED: fructose-bisphosphate aldolase cy...  74.3    5e-14   
ref|NP_001275267.1|  uncharacterized LOC102577842                     73.9    5e-14   Solanum tuberosum [potatoes]
gb|ABB16974.1|  unknown                                               73.9    5e-14   Solanum tuberosum [potatoes]
ref|XP_010045253.1|  PREDICTED: fructose-bisphosphate aldolase, c...  73.9    6e-14   
gb|KDO61040.1|  hypothetical protein CISIN_1g018326mg                 73.9    7e-14   Citrus sinensis [apfelsine]
ref|XP_006430290.1|  hypothetical protein CICLE_v10012049mg           73.9    7e-14   Citrus clementina [clementine]
ref|XP_004246552.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.6    7e-14   
ref|XP_006430289.1|  hypothetical protein CICLE_v10012049mg           73.6    7e-14   
ref|XP_009621833.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.6    7e-14   Nicotiana tomentosiformis
ref|XP_006481883.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.6    8e-14   Citrus sinensis [apfelsine]
gb|KDP34381.1|  hypothetical protein JCGZ_11264                       73.6    8e-14   Jatropha curcas
ref|XP_010932289.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.9    9e-14   Elaeis guineensis
ref|XP_002283381.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.6    9e-14   Vitis vinifera
gb|KCW48359.1|  hypothetical protein EUGRSUZ_K02073                   73.2    1e-13   Eucalyptus grandis [rose gum]
ref|XP_009122681.1|  PREDICTED: fructose-bisphosphate aldolase, c...  73.2    1e-13   Brassica rapa
ref|XP_010278210.1|  PREDICTED: fructose-bisphosphate aldolase cy...  73.2    1e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010036726.1|  PREDICTED: fructose-bisphosphate aldolase, c...  73.2    1e-13   Eucalyptus grandis [rose gum]
ref|XP_006398826.1|  hypothetical protein EUTSA_v10013921mg           72.8    2e-13   Eutrema salsugineum [saltwater cress]
ref|XP_010456383.1|  PREDICTED: fructose-bisphosphate aldolase, c...  72.0    2e-13   Camelina sativa [gold-of-pleasure]
ref|XP_002533605.1|  fructose-bisphosphate aldolase, putative         72.8    2e-13   Ricinus communis
gb|AAB61592.1|  fructose-biphosphate aldolase                         72.8    2e-13   Mesembryanthemum crystallinum
gb|ABK96406.1|  unknown                                               72.4    2e-13   Populus trichocarpa x Populus deltoides
ref|XP_010683863.1|  PREDICTED: fructose-bisphosphate aldolase, c...  72.4    2e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011043938.1|  PREDICTED: fructose-bisphosphate aldolase cy...  72.4    2e-13   Populus euphratica
ref|XP_009148751.1|  PREDICTED: fructose-bisphosphate aldolase, c...  68.9    2e-13   Brassica rapa
ref|XP_002528593.1|  fructose-bisphosphate aldolase, putative         72.0    4e-13   Ricinus communis
gb|EPS71641.1|  fructose-bisphosphate aldolase                        71.6    4e-13   Genlisea aurea
gb|ABK21911.1|  unknown                                               71.6    4e-13   Picea sitchensis
gb|AAL32644.1|  fructose-bisphosphate aldolase-like protein           71.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243792.1|  PREDICTED: fructose-bisphosphate aldolase cy...  71.6    5e-13   Nelumbo nucifera [Indian lotus]
ref|NP_850759.1|  fructose-bisphosphate aldolase 4                    71.6    5e-13   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490860.1|  PREDICTED: fructose-bisphosphate aldolase, c...  71.2    5e-13   Camelina sativa [gold-of-pleasure]
ref|XP_004303022.1|  PREDICTED: fructose-bisphosphate aldolase cy...  71.2    6e-13   Fragaria vesca subsp. vesca
ref|XP_008385438.1|  PREDICTED: fructose-bisphosphate aldolase cy...  71.2    6e-13   Malus domestica [apple tree]
gb|AAG21429.1|AF308587_1  cytosolic aldolase                          71.2    6e-13   Fragaria x ananassa
gb|AIX10949.1|  fructose-bisphosphate aldolase-like protein           70.9    7e-13   Gardenia jasminoides
ref|NP_001140837.1|  uncharacterized protein LOC100272913             68.9    7e-13   
ref|XP_008351459.1|  PREDICTED: probable fructose-bisphosphate al...  69.3    8e-13   
emb|CDP15370.1|  unnamed protein product                              70.9    1e-12   Coffea canephora [robusta coffee]
ref|XP_009365337.1|  PREDICTED: fructose-bisphosphate aldolase, c...  70.5    1e-12   Pyrus x bretschneideri [bai li]
ref|XP_010543462.1|  PREDICTED: fructose-bisphosphate aldolase, c...  70.5    1e-12   Tarenaya hassleriana [spider flower]
ref|XP_006288022.1|  hypothetical protein CARUB_v10001255mg           70.5    1e-12   Capsella rubella
ref|XP_002325037.1|  fructose-1 family protein                        70.5    1e-12   Populus trichocarpa [western balsam poplar]
gb|ABK93066.1|  unknown                                               70.5    1e-12   Populus trichocarpa [western balsam poplar]
gb|ACU18090.1|  unknown                                               69.3    1e-12   Glycine max [soybeans]
ref|XP_011048929.1|  PREDICTED: fructose-bisphosphate aldolase cy...  70.5    1e-12   Populus euphratica
dbj|BAD82730.1|  putative fructose-bisphosphate aldolase isoenzym...  68.6    1e-12   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006381780.1|  fructose-1 family protein                        70.1    1e-12   Populus trichocarpa [western balsam poplar]
gb|KFK24834.1|  hypothetical protein AALP_AA8G030900                  70.1    2e-12   Arabis alpina [alpine rockcress]
ref|XP_010089415.1|  Fructose-bisphosphate aldolase cytoplasmic i...  70.1    2e-12   Morus notabilis
ref|XP_010509469.1|  PREDICTED: fructose-bisphosphate aldolase, c...  70.1    2e-12   Camelina sativa [gold-of-pleasure]
gb|KHN45679.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   67.0    2e-12   Glycine soja [wild soybean]
ref|XP_010552992.1|  PREDICTED: fructose-bisphosphate aldolase, c...  69.7    2e-12   Tarenaya hassleriana [spider flower]
gb|AGB05599.1|  fructose-bisphosphate aldolase 2                      69.7    2e-12   Camellia oleifera [abura-tsubaki]
gb|KDP42683.1|  hypothetical protein JCGZ_23623                       69.7    2e-12   Jatropha curcas
gb|AAM81205.1|AF521254_1  fructose-1,6-diphosphate aldolase           68.9    2e-12   Metasequoia glyptostroboides
dbj|BAA76430.1|  fructose-bisphosphate aldolase                       67.4    3e-12   Cicer arietinum [garbanzo]
ref|NP_001150049.1|  fructose-bisphosphate aldolase cytoplasmic i...  69.3    3e-12   
ref|XP_010516868.1|  PREDICTED: fructose-bisphosphate aldolase, c...  69.3    3e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010505193.1|  PREDICTED: fructose-bisphosphate aldolase, c...  69.3    3e-12   
ref|XP_010527812.1|  PREDICTED: fructose-bisphosphate aldolase, c...  69.3    3e-12   
emb|CDY69912.1|  BnaAnng31970D                                        65.1    3e-12   Brassica napus [oilseed rape]
ref|XP_006293487.1|  hypothetical protein CARUB_v10023504mg           69.3    3e-12   Capsella rubella
ref|XP_002881445.1|  hypothetical protein ARALYDRAFT_482625           69.3    3e-12   
ref|XP_007145245.1|  hypothetical protein PHAVU_007G222900g           69.3    3e-12   Phaseolus vulgaris [French bean]
gb|ACU16628.1|  unknown                                               68.2    4e-12   Glycine max [soybeans]
gb|EEC79199.1|  hypothetical protein OsI_19907                        68.9    4e-12   Oryza sativa Indica Group [Indian rice]
ref|NP_001055494.1|  Os05g0402700                                     68.9    4e-12   
ref|XP_010912239.1|  PREDICTED: fructose-bisphosphate aldolase cy...  68.9    4e-12   Elaeis guineensis
gb|AGZ15378.1|  fructose-bisphosphate aldolase                        68.9    5e-12   Phaseolus vulgaris [French bean]
emb|CDY66283.1|  BnaCnng50220D                                        68.9    5e-12   Brassica napus [oilseed rape]
ref|XP_010558953.1|  PREDICTED: fructose-bisphosphate aldolase, c...  68.6    5e-12   Tarenaya hassleriana [spider flower]
ref|XP_010424793.1|  PREDICTED: fructose-bisphosphate aldolase, c...  69.3    6e-12   Camelina sativa [gold-of-pleasure]
ref|XP_008386943.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...  68.6    6e-12   
ref|XP_003521445.1|  PREDICTED: fructose-bisphosphate aldolase, c...  68.6    6e-12   Glycine max [soybeans]
gb|KHN18736.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...  68.6    6e-12   Glycine soja [wild soybean]
gb|EMT05696.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    68.2    7e-12   
ref|XP_003564871.1|  PREDICTED: fructose-bisphosphate aldolase cy...  68.2    7e-12   Brachypodium distachyon [annual false brome]
gb|EMT15181.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    68.2    7e-12   
gb|EMS58841.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    68.2    7e-12   Triticum urartu
dbj|BAJ87658.1|  predicted protein                                    68.2    7e-12   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007141361.1|  hypothetical protein PHAVU_008G189200g           68.2    8e-12   Phaseolus vulgaris [French bean]
gb|ACO44684.1|  fructose-bisphosphate aldolase                        68.2    8e-12   Triticum aestivum [Canadian hard winter wheat]
gb|EAY94426.1|  hypothetical protein OsI_16195                        68.2    8e-12   Oryza sativa Indica Group [Indian rice]
gb|ABG65931.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...  68.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ACO44685.1|  fructose-bisphosphate aldolase                        68.2    8e-12   Hordeum vulgare [barley]
dbj|BAA02729.1|  cytoplasmic aldolase                                 68.2    8e-12   Oryza sativa Japonica Group [Japonica rice]
gb|ACO44683.1|  fructose-bisphosphate aldolase                        68.2    8e-12   Secale cereale
gb|KJB62232.1|  hypothetical protein B456_009G407500                  68.2    9e-12   Gossypium raimondii
gb|AFK45996.1|  unknown                                               67.4    9e-12   Lotus japonicus
ref|XP_008797227.1|  PREDICTED: fructose-bisphosphate aldolase cy...  68.2    9e-12   Phoenix dactylifera
gb|ACF79162.1|  unknown                                               67.8    1e-11   Zea mays [maize]
emb|CAB77243.2|  fructose-bisphosphate aldolase                       67.8    1e-11   Persea americana
ref|XP_006645191.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.8    1e-11   Oryza brachyantha
gb|EMS60368.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    67.8    1e-11   Triticum urartu
ref|XP_008391753.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.8    1e-11   
ref|XP_011466791.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.8    1e-11   Fragaria vesca subsp. vesca
ref|XP_010553342.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.8    1e-11   Tarenaya hassleriana [spider flower]
gb|KHN46204.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   67.8    1e-11   Glycine soja [wild soybean]
ref|XP_004303023.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.8    1e-11   Fragaria vesca subsp. vesca
ref|NP_001105336.1|  fructose-bisphosphate aldolase, cytoplasmic ...  67.8    1e-11   
ref|XP_002458944.1|  hypothetical protein SORBIDRAFT_03g043140        67.8    1e-11   Sorghum bicolor [broomcorn]
gb|KHN40026.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   67.8    1e-11   Glycine soja [wild soybean]
ref|XP_008241287.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.8    1e-11   Prunus mume [ume]
ref|XP_006654377.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.8    1e-11   Oryza brachyantha
ref|XP_004970966.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.8    1e-11   Setaria italica
ref|NP_001045130.2|  Os01g0905800                                     67.8    1e-11   
emb|CDM85268.1|  unnamed protein product                              67.8    1e-11   Triticum aestivum [Canadian hard winter wheat]
gb|EMT31985.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    67.8    1e-11   
sp|P17784.2|ALF_ORYSJ  RecName: Full=Fructose-bisphosphate aldola...  67.8    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_007202259.1|  hypothetical protein PRUPE_ppa007714mg           67.8    1e-11   Prunus persica
sp|P46257.1|ALF2_PEA  RecName: Full=Fructose-bisphosphate aldolas...  67.8    1e-11   Pisum sativum [garden pea]
ref|XP_009352993.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.4    1e-11   Pyrus x bretschneideri [bai li]
ref|XP_004952502.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.4    1e-11   Setaria italica
ref|XP_002453822.1|  hypothetical protein SORBIDRAFT_04g019020        67.4    1e-11   Sorghum bicolor [broomcorn]
ref|XP_006410823.1|  hypothetical protein EUTSA_v10016856mg           67.4    1e-11   Eutrema salsugineum [saltwater cress]
ref|XP_009115993.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.4    1e-11   Brassica rapa
emb|CAA37290.1|  unnamed protein product                              67.4    1e-11   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009125243.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.4    1e-11   Brassica rapa
ref|XP_008799938.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.4    1e-11   
gb|AHY18973.1|  fructose-bisphosphate aldolase                        67.4    1e-11   Brassica rapa subsp. chinensis [bok-choy]
ref|XP_006291269.1|  hypothetical protein CARUB_v10017399mg           67.8    1e-11   
ref|XP_006403749.1|  hypothetical protein EUTSA_v10010492mg           67.4    1e-11   
gb|KFK34541.1|  hypothetical protein AALP_AA5G159400                  67.4    2e-11   Arabis alpina [alpine rockcress]
emb|CDX78134.1|  BnaA09g33290D                                        67.4    2e-11   
ref|NP_190861.1|  fructose-bisphosphate aldolase                      67.4    2e-11   Arabidopsis thaliana [mouse-ear cress]
gb|KJB16669.1|  hypothetical protein B456_002G242100                  67.4    2e-11   Gossypium raimondii
ref|XP_009411974.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.4    2e-11   
gb|ACG68894.1|  fructose-biphosphate aldolase                         67.0    2e-11   Sesuvium portulacastrum [sea-purslane]
ref|XP_008775192.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.0    2e-11   Phoenix dactylifera
gb|KJB62229.1|  hypothetical protein B456_009G407400                  67.0    2e-11   Gossypium raimondii
gb|KHG11048.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   67.0    2e-11   Gossypium arboreum [tree cotton]
gb|KJB62233.1|  hypothetical protein B456_009G407500                  67.0    2e-11   Gossypium raimondii
ref|XP_010927580.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.0    2e-11   Elaeis guineensis
ref|XP_006661653.1|  PREDICTED: fructose-bisphosphate aldolase cy...  67.0    2e-11   Oryza brachyantha
ref|XP_003542562.1|  PREDICTED: fructose-bisphosphate aldolase, c...  67.0    2e-11   Glycine max [soybeans]
gb|KFK32724.1|  hypothetical protein AALP_AA6G280600                  67.0    2e-11   Arabis alpina [alpine rockcress]
ref|XP_009141597.1|  PREDICTED: fructose-bisphosphate aldolase, c...  66.6    3e-11   
ref|XP_010940458.1|  PREDICTED: fructose-bisphosphate aldolase cy...  66.6    3e-11   Elaeis guineensis
ref|XP_010089414.1|  Fructose-bisphosphate aldolase, cytoplasmic ...  66.6    3e-11   Morus notabilis
ref|XP_008442804.1|  PREDICTED: fructose-bisphosphate aldolase cy...  66.6    3e-11   Cucumis melo [Oriental melon]
ref|XP_002877893.1|  hypothetical protein ARALYDRAFT_906673           66.6    3e-11   Arabidopsis lyrata subsp. lyrata
gb|AAR88661.1|  fructose-bisphosphate aldolase                        66.6    3e-11   Pandanus amaryllifolius [pandan rampeh]
dbj|BAI59775.1|  aldolase C-2                                         66.6    3e-11   Phyllostachys edulis [kikko-chiku]
ref|XP_009402715.1|  PREDICTED: fructose-bisphosphate aldolase cy...  66.6    3e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010426925.1|  PREDICTED: fructose-bisphosphate aldolase, c...  66.2    3e-11   Camelina sativa [gold-of-pleasure]
sp|P29356.1|ALF_SPIOL  RecName: Full=Fructose-bisphosphate aldola...  66.2    4e-11   Spinacia oleracea
ref|NP_001242367.1|  uncharacterized protein LOC100778363             66.2    4e-11   
ref|XP_009411827.1|  PREDICTED: fructose-bisphosphate aldolase cy...  66.2    5e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001060880.1|  Os08g0120600                                     66.2    5e-11   
gb|KEH42090.1|  fructose-bisphosphate aldolase                        65.9    5e-11   Medicago truncatula
dbj|BAI59774.1|  aldolase C-1                                         65.9    5e-11   Phyllostachys edulis [kikko-chiku]
gb|AFK34312.1|  unknown                                               64.7    5e-11   Medicago truncatula
ref|NP_181187.1|  fructose-bisphosphate aldolase 6                    65.9    5e-11   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001265896.1|  fructose-bisphosphate aldolase, cytoplasmic ...  65.9    6e-11   
ref|XP_009412699.1|  PREDICTED: fructose-bisphosphate aldolase cy...  65.9    7e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010246553.1|  PREDICTED: fructose-bisphosphate aldolase, c...  65.5    7e-11   Nelumbo nucifera [Indian lotus]
gb|AFK43805.1|  unknown                                               65.5    8e-11   Medicago truncatula
gb|AGV08373.1|  fructose-bisphosphate aldolase                        65.5    8e-11   Arachis hypogaea [goober]
ref|XP_011095600.1|  PREDICTED: fructose-bisphosphate aldolase, c...  65.5    9e-11   Sesamum indicum [beniseed]
ref|XP_007027627.1|  Aldolase superfamily protein isoform 2           65.5    9e-11   Theobroma cacao [chocolate]
ref|XP_004137873.1|  PREDICTED: fructose-bisphosphate aldolase cy...  65.1    1e-10   Cucumis sativus [cucumbers]
emb|CDX94320.1|  BnaC01g18640D                                        66.2    1e-10   
ref|NP_001242086.1|  uncharacterized protein LOC100795446             65.1    1e-10   Glycine max [soybeans]
sp|P46256.1|ALF1_PEA  RecName: Full=Fructose-bisphosphate aldolas...  64.7    1e-10   Pisum sativum [garden pea]
ref|XP_003617895.1|  Fructose-bisphosphate aldolase                   64.7    1e-10   Medicago truncatula
ref|XP_002263794.1|  PREDICTED: fructose-bisphosphate aldolase, c...  64.3    2e-10   Vitis vinifera
emb|CAN83666.1|  hypothetical protein VITISV_008795                   64.3    2e-10   Vitis vinifera
ref|XP_003615520.1|  Fructose-bisphosphate aldolase                   65.5    2e-10   
ref|XP_006659075.1|  PREDICTED: fructose-bisphosphate aldolase cy...  64.3    2e-10   Oryza brachyantha
ref|XP_004491539.1|  PREDICTED: fructose-bisphosphate aldolase, c...  64.3    2e-10   Cicer arietinum [garbanzo]
ref|XP_007142455.1|  hypothetical protein PHAVU_008G282000g           63.9    2e-10   Phaseolus vulgaris [French bean]
ref|XP_003544567.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   Glycine max [soybeans]
ref|NP_001237315.1|  fructose-bisphosphate aldolase                   63.9    3e-10   Glycine max [soybeans]
ref|XP_009141596.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   Brassica rapa
ref|XP_008353167.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   
ref|XP_009620969.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   Nicotiana tomentosiformis
ref|XP_008363363.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   
ref|XP_008355755.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.9    3e-10   
emb|CDY43716.1|  BnaAnng07310D                                        63.5    3e-10   Brassica napus [oilseed rape]
ref|XP_010942543.1|  PREDICTED: fructose-bisphosphate aldolase, c...  63.2    6e-10   Elaeis guineensis
ref|XP_002978503.1|  hypothetical protein SELMODRAFT_176914           63.2    6e-10   Selaginella moellendorffii
ref|XP_008782993.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    7e-10   Phoenix dactylifera
ref|XP_009142435.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    7e-10   Brassica rapa
gb|EMT11738.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...  62.8    7e-10   
gb|KDO37191.1|  hypothetical protein CISIN_1g016748mg                 62.8    7e-10   Citrus sinensis [apfelsine]
ref|XP_010448258.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    7e-10   Camelina sativa [gold-of-pleasure]
gb|ACN85313.1|  fructose-bisphosphate aldolase cytoplasmic isozyme    62.8    8e-10   Oryza brachyantha
ref|XP_004497605.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Cicer arietinum [garbanzo]
ref|XP_008218850.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Prunus mume [ume]
ref|XP_006284000.1|  hypothetical protein CARUB_v10005122mg           62.8    8e-10   Capsella rubella
ref|XP_010438739.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_010433486.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Camelina sativa [gold-of-pleasure]
ref|XP_011039825.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Populus euphratica
ref|XP_002869605.1|  hypothetical protein ARALYDRAFT_492157           62.8    8e-10   
ref|XP_007020393.1|  Aldolase superfamily protein                     62.8    8e-10   Theobroma cacao [chocolate]
ref|NP_194383.1|  fructose-bisphosphate aldolase 5                    62.8    8e-10   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003563638.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.8    8e-10   Brachypodium distachyon [annual false brome]
ref|XP_004294907.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.4    8e-10   Fragaria vesca subsp. vesca
ref|XP_002299056.1|  fructose-1 family protein                        62.4    9e-10   Populus trichocarpa [western balsam poplar]
ref|XP_011037763.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.4    1e-09   Populus euphratica
ref|XP_011000316.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.4    1e-09   Populus euphratica
ref|XP_006377966.1|  fructose-1 family protein                        62.4    1e-09   Populus trichocarpa [western balsam poplar]
ref|XP_010252855.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.4    1e-09   Nelumbo nucifera [Indian lotus]
ref|XP_010545295.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.4    1e-09   Tarenaya hassleriana [spider flower]
gb|KJB81553.1|  hypothetical protein B456_013G150000                  62.4    1e-09   Gossypium raimondii
ref|XP_002986752.1|  hypothetical protein SELMODRAFT_425653           62.4    1e-09   Selaginella moellendorffii
ref|XP_002969534.1|  hypothetical protein SELMODRAFT_231316           62.0    1e-09   Selaginella moellendorffii
gb|KDP32624.1|  hypothetical protein JCGZ_13174                       62.0    1e-09   Jatropha curcas
ref|XP_007205428.1|  hypothetical protein PRUPE_ppa007744mg           62.0    1e-09   Prunus persica
ref|XP_006474808.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.0    1e-09   Citrus sinensis [apfelsine]
gb|EYU27475.1|  hypothetical protein MIMGU_mgv1a008862mg              62.0    1e-09   Erythranthe guttata [common monkey flower]
ref|XP_010676114.1|  PREDICTED: fructose-bisphosphate aldolase, c...  62.0    1e-09   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_001765506.1|  predicted protein                                61.6    2e-09   
gb|AAR84667.1|  fructose 1,6, bisphosphate aldolase                   61.6    2e-09   Salicornia herbacea
ref|XP_004244020.1|  PREDICTED: fructose-bisphosphate aldolase, c...  61.6    2e-09   
ref|XP_006413170.1|  hypothetical protein EUTSA_v10025556mg           61.6    2e-09   Eutrema salsugineum [saltwater cress]
ref|XP_009799651.1|  PREDICTED: fructose-bisphosphate aldolase, c...  61.6    2e-09   Nicotiana sylvestris
ref|XP_010061415.1|  PREDICTED: fructose-bisphosphate aldolase, c...  61.6    2e-09   Eucalyptus grandis [rose gum]
ref|XP_009391905.1|  PREDICTED: fructose-bisphosphate aldolase, c...  61.6    2e-09   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS69505.1|  fructose-bisphosphate aldolase                        61.6    2e-09   Genlisea aurea
dbj|BAJ85287.1|  predicted protein                                    61.2    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK29173.1|  hypothetical protein AALP_AA7G098900                  61.2    2e-09   Arabis alpina [alpine rockcress]
ref|XP_010929015.1|  PREDICTED: fructose-bisphosphate aldolase, c...  61.2    3e-09   Elaeis guineensis
ref|XP_006346102.1|  PREDICTED: fructose-bisphosphate aldolase, c...  60.8    4e-09   Solanum tuberosum [potatoes]
ref|XP_008447787.1|  PREDICTED: fructose-bisphosphate aldolase, c...  60.5    5e-09   Cucumis melo [Oriental melon]
ref|XP_006452682.1|  hypothetical protein CICLE_v10008762mg           60.5    5e-09   Citrus clementina [clementine]
ref|XP_004139771.1|  PREDICTED: fructose-bisphosphate aldolase, c...  60.8    5e-09   Cucumis sativus [cucumbers]
ref|XP_002970423.1|  hypothetical protein SELMODRAFT_267384           60.5    5e-09   Selaginella moellendorffii
gb|ACN85267.1|  fructose-bisphosphate aldolase cytoplasmic isozyme    60.5    5e-09   Oryza alta
ref|XP_002519633.1|  fructose-bisphosphate aldolase, putative         60.5    5e-09   Ricinus communis
gb|ABK23585.1|  unknown                                               60.5    5e-09   Picea sitchensis
gb|ABK22375.1|  unknown                                               60.5    6e-09   Picea sitchensis
ref|XP_006452683.1|  hypothetical protein CICLE_v10008762mg           60.1    6e-09   
ref|NP_001058042.1|  Os06g0608700                                     60.1    6e-09   
ref|XP_006656232.1|  PREDICTED: fructose-bisphosphate aldolase, c...  60.1    6e-09   Oryza brachyantha
ref|XP_006285375.1|  hypothetical protein CARUB_v10006772mg           59.7    8e-09   Capsella rubella
ref|XP_010448259.1|  PREDICTED: fructose-bisphosphate aldolase, c...  59.7    9e-09   Camelina sativa [gold-of-pleasure]
ref|XP_010103967.1|  Fructose-bisphosphate aldolase, cytoplasmic ...  59.7    1e-08   Morus notabilis
ref|XP_001767043.1|  predicted protein                                58.9    2e-08   
ref|XP_001768658.1|  predicted protein                                58.5    2e-08   
ref|XP_010433490.1|  PREDICTED: fructose-bisphosphate aldolase, c...  58.9    2e-08   
ref|XP_002869606.1|  fructose-bisphosphate aldolase, cytoplasmic      58.5    2e-08   
ref|XP_010438740.1|  PREDICTED: fructose-bisphosphate aldolase, c...  58.5    2e-08   Camelina sativa [gold-of-pleasure]
gb|KHN48186.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   58.2    4e-08   Glycine soja [wild soybean]
ref|XP_004965915.1|  PREDICTED: fructose-bisphosphate aldolase, c...  58.2    4e-08   Setaria italica
ref|XP_001759800.1|  predicted protein                                57.8    4e-08   
ref|XP_008442803.1|  PREDICTED: fructose-bisphosphate aldolase cy...  57.8    5e-08   Cucumis melo [Oriental melon]
ref|XP_002504686.1|  fructose bisphosphate aldolase class i           57.4    6e-08   Micromonas commoda
gb|AES98478.2|  fructose-bisphosphate aldolase                        57.4    8e-08   Medicago truncatula
ref|XP_002437265.1|  hypothetical protein SORBIDRAFT_10g023850        56.6    1e-07   Sorghum bicolor [broomcorn]
ref|XP_004171756.1|  PREDICTED: LOW QUALITY PROTEIN: fructose-bis...  56.2    1e-07   
emb|CDP13668.1|  unnamed protein product                              56.2    1e-07   Coffea canephora [robusta coffee]
ref|NP_568127.1|  fructose-bisphosphate aldolase 4                    56.2    2e-07   Arabidopsis thaliana [mouse-ear cress]
gb|AAM62481.1|  fructose-bisphosphate aldolase-like protein           55.8    2e-07   Arabidopsis thaliana [mouse-ear cress]
dbj|BAL41455.1|  fructose-bisphosphate aldolase 1                     55.5    3e-07   Linum grandiflorum
ref|XP_006851631.1|  hypothetical protein AMTR_s00040p00201950        55.5    3e-07   
gb|KCW87412.1|  hypothetical protein EUGRSUZ_B03891                   55.1    3e-07   Eucalyptus grandis [rose gum]
ref|NP_194382.1|  fructose-bisphosphate aldolase 7                    55.1    5e-07   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006857683.1|  hypothetical protein AMTR_s00061p00163810        54.7    5e-07   Amborella trichopoda
emb|CAA37226.1|  fructose 1,6-diphosphate aldolase                    54.7    5e-07   
ref|XP_007027626.1|  Aldolase superfamily protein isoform 1           54.3    7e-07   
gb|KHG27282.1|  Fructose-bisphosphate aldolase cytoplasmic isozyme    54.3    7e-07   
gb|AFW87253.1|  hypothetical protein ZEAMMB73_254795                  54.3    8e-07   
gb|KJB62230.1|  hypothetical protein B456_009G407500                  54.3    8e-07   
ref|XP_010089412.1|  Fructose-bisphosphate aldolase cytoplasmic i...  53.9    9e-07   
ref|XP_010089409.1|  Fructose-bisphosphate aldolase cytoplasmic i...  53.9    9e-07   
gb|ACG27929.1|  fructose-bisphosphate aldolase, cytoplasmic isozy...  53.9    9e-07   
gb|EMS53099.1|  Fructose-bisphosphate aldolase, cytoplasmic isozyme   54.3    1e-06   
gb|KHN23819.1|  Uridine kinase-like protein 4                         54.3    1e-06   
gb|KHN43919.1|  Uridine kinase-like protein 4                         54.3    1e-06   
gb|EMS50182.1|  Fructose-bisphosphate aldolase, cytoplasmic isozy...  53.1    3e-06   
ref|XP_005843070.1|  hypothetical protein CHLNCDRAFT_59826            52.0    5e-06   
ref|XP_005649618.1|  cytosolic aldolase                               51.6    7e-06   
emb|CDP05655.1|  unnamed protein product                              51.2    1e-05   
ref|XP_005705058.1|  fructose-bisphosphate aldolase, class I          48.1    1e-05   
ref|XP_008360651.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  51.2    1e-05   
gb|KDD75884.1|  class-I fructose-bisphosphate aldolase                49.7    3e-05   
gb|AAO89069.1|  cytosolic class I fructose-1,6-bisphosphate aldolase  49.7    4e-05   
ref|XP_011396329.1|  Fructose-bisphosphate aldolase, cytoplasmic ...  49.3    4e-05   
gb|AAF27640.1|AF217804_1  fructose-1,6-biphosphate aldolase           48.5    9e-05   
ref|XP_005709261.1|  fructose-bisphosphate aldolase, class I          48.1    1e-04   
ref|XP_003290851.1|  hypothetical protein DICPUDRAFT_49487            48.1    1e-04   
ref|XP_005833999.1|  hypothetical protein GUITHDRAFT_86602            48.1    1e-04   
ref|XP_643874.1|  fructose-bisphosphate aldolase                      48.1    1e-04   
gb|EFA78442.1|  fructose-bisphosphate aldolase                        47.4    2e-04   
ref|XP_005535646.1|  fructose-1,6-biphosphate aldolase                47.4    2e-04   
ref|XP_005710775.1|  fructose-1,6-biphosphate aldolase                47.0    3e-04   
gb|EEE65995.1|  hypothetical protein OsJ_21934                        47.0    3e-04   
dbj|GAM21360.1|  hypothetical protein SAMD00019534_045350             46.2    4e-04   
emb|CDW83208.1|  fructose-bisphosphate aldolase cytoplasmic isozy...  46.2    6e-04   
ref|XP_005716242.1|  unnamed protein product                          43.5    7e-04   
ref|XP_001609245.1|  fructose-1,6-bisphosphate aldolase               45.8    8e-04   
dbj|BAN65518.1|  fructose-1,6-bisphosphate aldolase                   45.8    8e-04   
ref|XP_002771038.1|  fructose-1,6-bisphosphate aldolase, putative     45.4    8e-04   
ref|XP_002765540.1|  fructose-1,6-bisphosphate aldolase, putative     45.4    0.001   



>gb|EYU38615.1| hypothetical protein MIMGU_mgv1a007931mg [Erythranthe guttata]
Length=390

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/53 (75%), Positives = 42/53 (79%), Gaps = 0/53 (0%)
 Frame = +1

Query  19   FQLAFDLSSILHKTAAMSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            F L   L S    +  MSCY+GKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  17   FSLFSPLLSSHQASVTMSCYKGKYADELIANAAYIGTPGKGILAADESTGTIG  69



>ref|XP_004143304.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 ref|XP_004166910.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN48236.1| hypothetical protein Csa_6G450410 [Cucumis sativus]
Length=358

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_011094409.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Sesamum indicum]
Length=358

 Score = 77.4 bits (189),  Expect = 3e-15, Method: Composition-based stats.
 Identities = 37/37 (100%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001274769.1| uncharacterized protein LOC102577667 [Solanum tuberosum]
 gb|ABB02618.1| unknown [Solanum tuberosum]
Length=363

 Score = 77.0 bits (188),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|KCW89239.1| hypothetical protein EUGRSUZ_A01538 [Eucalyptus grandis]
Length=301

 Score = 75.9 bits (185),  Expect = 6e-15, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYTDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010049816.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Eucalyptus grandis]
 gb|KCW89240.1| hypothetical protein EUGRSUZ_A01538 [Eucalyptus grandis]
Length=358

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYTDELIANAAYIGTPGKGILAADESTGTIG  37



>dbj|BAE48790.1| fructose-bisphosphate aldolase [Codonopsis lanceolata]
Length=358

 Score = 76.6 bits (187),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANATYIGTPGKGILAADESTGTIG  37



>ref|XP_009617881.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana tomentosiformis]
Length=358

 Score = 76.3 bits (186),  Expect = 9e-15, Method: Composition-based stats.
 Identities = 36/37 (97%), Positives = 37/37 (100%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009352992.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS YRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008391754.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
 ref|XP_008351441.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Malus domestica]
Length=358

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS YRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008386942.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS YRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009365338.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score = 75.9 bits (185),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/37 (97%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS YRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_011101492.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Sesamum indicum]
Length=358

 Score = 75.1 bits (183),  Expect = 2e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANATYIGTPGKGILAADESTGTIG  37



>ref|NP_001275379.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
 ref|XP_006341152.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Solanum tuberosum]
 gb|ABC01905.1| fructose-bisphosphate aldolase-like protein [Solanum tuberosum]
Length=358

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008241286.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score = 74.7 bits (182),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +RGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009778188.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana sylvestris]
Length=358

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANAAYIATPGKGILAADESTGTIG  37



>ref|XP_009789131.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nicotiana sylvestris]
Length=358

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANAKYIGTPGKGILAADESTGTIG  37



>ref|XP_007202254.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
 gb|EMJ03453.1| hypothetical protein PRUPE_ppa007696mg [Prunus persica]
Length=358

 Score = 74.7 bits (182),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +RGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>emb|CBI30253.3| unnamed protein product [Vitis vinifera]
Length=335

 Score = 74.3 bits (181),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+CY+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTCYKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004249455.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score = 74.3 bits (181),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NAAYI TPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIG  37



>ref|NP_001275267.1| uncharacterized LOC102577842 [Solanum tuberosum]
 gb|ABB29926.1| fructose-bisphosphate aldolase-like [Solanum tuberosum]
Length=358

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NAAYI TPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIG  37



>gb|ABB16974.1| unknown [Solanum tuberosum]
Length=358

 Score = 73.9 bits (180),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NAAYI TPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNAAYIATPGKGILAADESTGTIG  37



>ref|XP_010045253.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Eucalyptus grandis]
Length=358

 Score = 73.9 bits (180),  Expect = 6e-14, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KDO61040.1| hypothetical protein CISIN_1g018326mg [Citrus sinensis]
Length=358

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006430290.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
 gb|ESR43530.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
Length=358

 Score = 73.9 bits (180),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004246552.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Solanum lycopersicum]
Length=358

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELI NA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIKNATYIGTPGKGILAADESTGTIG  37



>ref|XP_006430289.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
 gb|ESR43529.1| hypothetical protein CICLE_v10012049mg [Citrus clementina]
Length=337

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009621833.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nicotiana tomentosiformis]
Length=358

 Score = 73.6 bits (179),  Expect = 7e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKYADELIANA+YI TPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYADELIANASYIATPGKGILAADESTGTIG  37



>ref|XP_006481883.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Citrus sinensis]
Length=358

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|KDP34381.1| hypothetical protein JCGZ_11264 [Jatropha curcas]
Length=358

 Score = 73.6 bits (179),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010932289.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Elaeis guineensis]
Length=425

 Score = 73.9 bits (180),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = +1

Query  16   LFQLAFDLSSILHKTAAMSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
             F L+  L S  ++ + MS Y GKY+DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  51   FFVLSLSLKSSRNRRSKMSAYCGKYSDELIKNAAYIGTPGKGILAADESTGTIG  104



>ref|XP_002283381.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Vitis vinifera]
 emb|CAN71905.1| hypothetical protein VITISV_035583 [Vitis vinifera]
Length=358

 Score = 73.6 bits (179),  Expect = 9e-14, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+CY+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTCYKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KCW48359.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=349

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009122681.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
Length=359

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADELIANAAYIG+PGKGILAADESTGTIG
Sbjct  1    MSCFKSKYADELIANAAYIGSPGKGILAADESTGTIG  37



>ref|XP_010278210.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Nelumbo nucifera]
Length=358

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010036726.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Eucalyptus grandis]
 gb|KCW48360.1| hypothetical protein EUGRSUZ_K02073 [Eucalyptus grandis]
Length=358

 Score = 73.2 bits (178),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006398826.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
 gb|ESQ40279.1| hypothetical protein EUTSA_v10013921mg [Eutrema salsugineum]
Length=359

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010456383.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2 [Camelina sativa]
Length=301

 Score = 72.0 bits (175),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002533605.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF28774.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>gb|AAB61592.1| fructose-biphosphate aldolase [Mesembryanthemum crystallinum]
Length=357

 Score = 72.8 bits (177),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ YRGKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYRGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|ABK96406.1| unknown [Populus trichocarpa x Populus deltoides]
Length=358

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010683863.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Beta vulgaris subsp. vulgaris]
Length=357

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ YRGKYADELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MTAYRGKYADELIANAAYIATPGKGILAADESTGTIG  37



>ref|XP_011043938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Populus euphratica]
Length=358

 Score = 72.4 bits (176),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009148751.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=95

 Score = 68.9 bits (167),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002528593.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF33801.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=358

 Score = 72.0 bits (175),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ Y+GKYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYKGKYADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|EPS71641.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=358

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 35/37 (95%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS YRGKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYRGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ABK21911.1| unknown [Picea sitchensis]
 gb|ACN40269.1| unknown [Picea sitchensis]
Length=358

 Score = 71.6 bits (174),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+ GKY DELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MSCFEGKYRDELIANAAYIATPGKGILAADESTGTIG  37



>gb|AAL32644.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM13358.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
Length=359

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010243792.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Nelumbo nucifera]
Length=358

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELITNAAYIGTPGKGILAADESTGTIG  37



>ref|NP_850759.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
 emb|CAB82934.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AED90643.1| fructose-bisphosphate aldolase 4 [Arabidopsis thaliana]
Length=359

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010490860.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=359

 Score = 71.2 bits (173),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFTDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004303022.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
isoform X1 [Fragaria vesca subsp. vesca]
Length=358

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ YRGKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYRGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008385438.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DEL+ANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYQDELVANATYIGTPGKGILAADESTGTIG  37



>gb|AAG21429.1|AF308587_1 cytosolic aldolase [Fragaria x ananassa]
Length=358

 Score = 71.2 bits (173),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ YRGKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYRGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|AIX10949.1| fructose-bisphosphate aldolase-like protein [Gardenia jasminoides]
Length=358

 Score = 70.9 bits (172),  Expect = 7e-13, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIA A YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYTDELIATANYIGTPGKGILAADESTGTIG  37



>ref|NP_001140837.1| uncharacterized protein LOC100272913 [Zea mays]
 gb|ACF84766.1| unknown [Zea mays]
Length=160

 Score = 68.9 bits (167),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008351459.1| PREDICTED: probable fructose-bisphosphate aldolase 2, chloroplastic 
[Malus domestica]
Length=221

 Score = 69.3 bits (168),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>emb|CDP15370.1| unnamed protein product [Coffea canephora]
Length=358

 Score = 70.9 bits (172),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIA A YIGTPGKGILAADESTGTIG
Sbjct  1    MSCYKGKYTDELIATANYIGTPGKGILAADESTGTIG  37



>ref|XP_009365337.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Pyrus x bretschneideri]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010543462.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKYTDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006288022.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
 gb|EOA20920.1| hypothetical protein CARUB_v10001255mg [Capsella rubella]
Length=359

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K++DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKFSDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002325037.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK95754.1| unknown [Populus trichocarpa]
 gb|EEF03602.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ABK93066.1| unknown [Populus trichocarpa]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKSKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ACU18090.1| unknown [Glycine max]
Length=268

 Score = 69.3 bits (168),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_011048929.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Populus euphratica]
Length=358

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADEL+ NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKNKYADELVKNAAYIGTPGKGILAADESTGTIG  37



>dbj|BAD82730.1| putative fructose-bisphosphate aldolase isoenzyme C-1 [Oryza 
sativa Japonica Group]
 gb|EEC71988.1| hypothetical protein OsI_04839 [Oryza sativa Indica Group]
 gb|EEE55845.1| hypothetical protein OsJ_04464 [Oryza sativa Japonica Group]
Length=203

 Score = 68.6 bits (166),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006381780.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK93144.1| unknown [Populus trichocarpa]
 gb|ERP59577.1| fructose-1 family protein [Populus trichocarpa]
Length=358

 Score = 70.1 bits (170),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KYADEL+ NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFKNKYADELVKNAAYIGTPGKGILAADESTGTIG  37



>gb|KFK24834.1| hypothetical protein AALP_AA8G030900 [Arabis alpina]
Length=359

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 36/37 (97%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIG+PGKGILAADESTGTIG
Sbjct  1    MSCFKSKFADELIANAAYIGSPGKGILAADESTGTIG  37



>ref|XP_010089415.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
 gb|EXB37768.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Morus notabilis]
Length=358

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y+GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYKGKYYDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010509469.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score = 70.1 bits (170),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KHN45679.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=101

 Score = 67.0 bits (162),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ K+ DELIANA+YIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKFQDELIANASYIGTPGKGILAADESTGTIG  37



>ref|XP_010552992.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
2-like [Tarenaya hassleriana]
Length=358

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSRFKSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|AGB05599.1| fructose-bisphosphate aldolase 2 [Camellia oleifera]
Length=358

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSCY+GKY DELIA A+YIGTPGKGILAADESTGT+G
Sbjct  1    MSCYKGKYHDELIATASYIGTPGKGILAADESTGTMG  37



>gb|KDP42683.1| hypothetical protein JCGZ_23623 [Jatropha curcas]
Length=358

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYTGKYADELIRNAAYIGTPGKGILAADESTGTIG  37



>gb|AAM81205.1|AF521254_1 fructose-1,6-diphosphate aldolase [Metasequoia glyptostroboides]
Length=287

 Score = 68.9 bits (167),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++GKY DELIANA YI TPGKGILAADESTGTIG
Sbjct  1    MSCFKGKYHDELIANANYIATPGKGILAADESTGTIG  37



>dbj|BAA76430.1| fructose-bisphosphate aldolase [Cicer arietinum]
Length=148

 Score = 67.4 bits (163),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001150049.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 ref|XP_008654550.1| PREDICTED: uncharacterized protein LOC100272913 isoform X1 [Zea 
mays]
 gb|ACF86533.1| unknown [Zea mays]
 gb|ACG37623.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Zea mays]
 gb|AFW84242.1| fructose-bisphosphate aldolase [Zea mays]
Length=355

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYADELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010516868.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010505193.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Camelina sativa]
Length=358

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010527812.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>emb|CDY69912.1| BnaAnng31970D, partial [Brassica napus]
Length=45

 Score = 65.1 bits (157),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/36 (86%), Positives = 33/36 (92%), Gaps = 0/36 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTI  174
            M+ +  KYADELIANAAYIGTPGKGILAADESTGTI
Sbjct  10   MASFTSKYADELIANAAYIGTPGKGILAADESTGTI  45



>ref|XP_006293487.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
 gb|EOA26385.1| hypothetical protein CARUB_v10023504mg [Capsella rubella]
Length=358

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002881445.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH57704.1| hypothetical protein ARALYDRAFT_482625 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFTTKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_007145245.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
 gb|ESW17239.1| hypothetical protein PHAVU_007G222900g [Phaseolus vulgaris]
Length=357

 Score = 69.3 bits (168),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ KY DELIANAA+IG+PGKGILAADESTGTIG
Sbjct  1    MSCFKSKYQDELIANAAHIGSPGKGILAADESTGTIG  37



>gb|ACU16628.1| unknown [Glycine max]
Length=273

 Score = 68.2 bits (165),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|EEC79199.1| hypothetical protein OsI_19907 [Oryza sativa Indica Group]
Length=333

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001055494.1| Os05g0402700 [Oryza sativa Japonica Group]
 dbj|BAF17408.1| Os05g0402700 [Oryza sativa Japonica Group]
 gb|EEE63668.1| hypothetical protein OsJ_18486 [Oryza sativa Japonica Group]
Length=333

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010912239.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score = 68.9 bits (167),  Expect = 4e-12, Method: Composition-based stats.
 Identities = 34/37 (92%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYRDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|AGZ15378.1| fructose-bisphosphate aldolase [Phaseolus vulgaris]
Length=358

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>emb|CDY66283.1| BnaCnng50220D [Brassica napus]
 emb|CDX76248.1| BnaA04g05120D [Brassica napus]
Length=358

 Score = 68.9 bits (167),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010558953.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Tarenaya hassleriana]
Length=358

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010424793.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=526

 Score = 69.3 bits (168),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC++ K+ADELIANAAYIGTPGKGILAADES GTIG
Sbjct  1    MSCFKSKFADELIANAAYIGTPGKGILAADESIGTIG  37



>ref|XP_008386943.1| PREDICTED: LOW QUALITY PROTEIN: fructose-bisphosphate aldolase, 
cytoplasmic isozyme-like [Malus domestica]
Length=358

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_003521445.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Glycine max]
Length=358

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KHN18736.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 2 [Glycine 
soja]
Length=358

 Score = 68.6 bits (166),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|EMT05696.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_003564871.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Brachypodium distachyon]
Length=358

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|EMT15181.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
 emb|CDM85265.1| unnamed protein product [Triticum aestivum]
Length=358

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|EMS58841.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>dbj|BAJ87658.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ96363.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=358

 Score = 68.2 bits (165),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_007141361.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
 gb|ESW13355.1| hypothetical protein PHAVU_008G189200g [Phaseolus vulgaris]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|ACO44684.1| fructose-bisphosphate aldolase [Triticum aestivum]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|EAY94426.1| hypothetical protein OsI_16195 [Oryza sativa Indica Group]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ABG65931.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme, putative, 
expressed [Oryza sativa Japonica Group]
 gb|EAZ15405.1| hypothetical protein OsJ_30817 [Oryza sativa Japonica Group]
 dbj|BAG92549.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ACO44685.1| fructose-bisphosphate aldolase [Hordeum vulgare]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>dbj|BAA02729.1| cytoplasmic aldolase [Oryza sativa Japonica Group]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ACO44683.1| fructose-bisphosphate aldolase [Secale cereale]
Length=358

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|KJB62232.1| hypothetical protein B456_009G407500 [Gossypium raimondii]
Length=393

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYADEL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIG  37



>gb|AFK45996.1| unknown [Lotus japonicus]
Length=314

 Score = 67.4 bits (163),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIG PGKGILAADESTGTIG
Sbjct  1    MSNFKGKYHDELIANAAYIGIPGKGILAADESTGTIG  37



>ref|XP_008797227.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Phoenix dactylifera]
Length=358

 Score = 68.2 bits (165),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY+DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYSDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ACF79162.1| unknown [Zea mays]
 gb|ACF85907.1| unknown [Zea mays]
 tpg|DAA56269.1| TPA: aldolase1 [Zea mays]
Length=355

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>emb|CAB77243.2| fructose-bisphosphate aldolase [Persea americana]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFCGKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006645191.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|EMS60368.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Triticum 
urartu]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008391753.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Malus domestica]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>ref|XP_011466791.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Fragaria vesca subsp. vesca]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ Y+GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYKGKYHDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010553342.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Tarenaya hassleriana]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KHN46204.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004303023.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Fragaria vesca subsp. vesca]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ Y+GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MTAYKGKYHDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001105336.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Zea mays]
 sp|P08440.1|ALF_MAIZE RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Zea mays]
 gb|AAA33435.1| aldolase [Zea mays]
 emb|CAA31366.1| fructose bisphosphate aldolase [Zea mays]
 prf||1307278A cytoplasmic aldolase
Length=355

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002458944.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
 gb|EES04064.1| hypothetical protein SORBIDRAFT_03g043140 [Sorghum bicolor]
Length=355

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|KHN40026.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Glycine 
soja]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 35/37 (95%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008241287.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Prunus mume]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>ref|XP_006654377.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004970966.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001045130.2| Os01g0905800 [Oryza sativa Japonica Group]
 dbj|BAA08845.1| aldolase C-1 [Oryza sativa]
 dbj|BAA08830.1| aldolase C-1 [Oryza sativa]
 dbj|BAD82731.1| fructose-bisphosphate aldolase isoenzyme C-1 [Oryza sativa Japonica 
Group]
 gb|ABL74560.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 dbj|BAG96902.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAF07044.2| Os01g0905800 [Oryza sativa Japonica Group]
 gb|ADM86841.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AEV58398.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>emb|CDM85268.1| unnamed protein product [Triticum aestivum]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|EMT31985.1| Fructose-bisphosphate aldolase cytoplasmic isozyme [Aegilops 
tauschii]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>sp|P17784.2|ALF_ORYSJ RecName: Full=Fructose-bisphosphate aldolase cytoplasmic isozyme; 
AltName: Full=Gravity-specific protein GSC 233 [Oryza sativa 
Japonica Group]
 gb|AAS05825.1| fructose 1,6-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|AAT85154.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|AAT85207.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 gb|ACA50482.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
 gb|ADM86851.1| fructose-bisphosphate aldolase [Oryza sativa Japonica Group]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_007202259.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
 gb|EMJ03458.1| hypothetical protein PRUPE_ppa007714mg [Prunus persica]
Length=358

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>sp|P46257.1|ALF2_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
2 [Pisum sativum]
 emb|CAA61947.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=359

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009352993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Pyrus x bretschneideri]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKGKYHDELIANATYIGTPGKGILAADESTGTIG  37



>ref|XP_004952502.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Setaria italica]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002453822.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
 gb|EES06798.1| hypothetical protein SORBIDRAFT_04g019020 [Sorghum bicolor]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006410823.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
 gb|ESQ52276.1| hypothetical protein EUTSA_v10016856mg [Eutrema salsugineum]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009115993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>emb|CAA37290.1| unnamed protein product [Oryza sativa Japonica Group]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009125243.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008799938.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY+DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYSDELIRNAAYIGTPGKGILAADESTGTIG  37



>gb|AHY18973.1| fructose-bisphosphate aldolase [Brassica rapa subsp. chinensis]
 emb|CDY13330.1| BnaC06g14270D [Brassica napus]
 emb|CDX67550.1| BnaA07g15900D [Brassica napus]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006291269.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
 gb|EOA24167.1| hypothetical protein CARUB_v10017399mg, partial [Capsella rubella]
Length=396

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/39 (82%), Positives = 35/39 (90%), Gaps = 0/39 (0%)
 Frame = +1

Query  61   AAMSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            + MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  37   STMSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  75



>ref|XP_006403749.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
 gb|ESQ45202.1| hypothetical protein EUTSA_v10010492mg [Eutrema salsugineum]
Length=358

 Score = 67.4 bits (163),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KFK34541.1| hypothetical protein AALP_AA5G159400 [Arabis alpina]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>emb|CDX78134.1| BnaA09g33290D [Brassica napus]
 emb|CDX73593.1| BnaC08g24100D [Brassica napus]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|NP_190861.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
 emb|CAB86897.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAK96613.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL15287.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAL36068.1| AT3g52930/F8J2_100 [Arabidopsis thaliana]
 gb|AAM64896.1| fructose bisphosphate aldolase-like protein [Arabidopsis thaliana]
 dbj|BAH20051.1| AT3G52930 [Arabidopsis thaliana]
 gb|AEE79012.1| fructose-bisphosphate aldolase [Arabidopsis thaliana]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|KJB16669.1| hypothetical protein B456_002G242100 [Gossypium raimondii]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYADEL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009411974.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
 ref|XP_009411977.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score = 67.4 bits (163),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYHDELIKNAAYIGTPGKGILAADESTGTIG  37



>gb|ACG68894.1| fructose-biphosphate aldolase [Sesuvium portulacastrum]
Length=357

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+  RGK+ADELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MTAVRGKFADELIANAAYIATPGKGILAADESTGTIG  37



>ref|XP_008775192.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Phoenix dactylifera]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYRDELIANAAYIATPGKGILAADESTGTIG  37



>gb|KJB62229.1| hypothetical protein B456_009G407400 [Gossypium raimondii]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYADEL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIG  37



>gb|KHG11048.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Gossypium 
arboreum]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYADEL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIG  37



>gb|KJB62233.1| hypothetical protein B456_009G407500 [Gossypium raimondii]
 gb|KJB62234.1| hypothetical protein B456_009G407500 [Gossypium raimondii]
 gb|KJB62235.1| hypothetical protein B456_009G407500 [Gossypium raimondii]
 gb|KJB62236.1| hypothetical protein B456_009G407500 [Gossypium raimondii]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYADEL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYADELAKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010927580.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYHDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_006661653.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=361

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_003542562.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Glycine max]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANATYIGTPGKGILAADESTGTIG  37



>gb|KFK32724.1| hypothetical protein AALP_AA6G280600 [Arabis alpina]
Length=358

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009141597.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ +  KYADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MASFTSKYADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010940458.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Elaeis guineensis]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELIANAAYI TPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYRDELIANAAYIATPGKGILAADESTGTIG  37



>ref|XP_010089414.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
 gb|EXB37767.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme [Morus notabilis]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFKSKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_008442804.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
isoform X2 [Cucumis melo]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_002877893.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010504045.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 ref|XP_010515772.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
 gb|EFH54152.1| hypothetical protein ARALYDRAFT_906673 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>gb|AAR88661.1| fructose-bisphosphate aldolase [Pandanus amaryllifolius]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+ GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSCFIGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>dbj|BAI59775.1| aldolase C-2 [Phyllostachys edulis]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GK+ DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKFKDELIKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009402715.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y G++ DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGQFHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_010426925.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score = 66.2 bits (160),  Expect = 3e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>sp|P29356.1|ALF_SPIOL RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Spinacia oleracea]
 emb|CAA46649.1| fructose-bisphosphate aldolase [Spinacia oleracea]
Length=357

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ YRGKYADELIANA+YI TPGK ILAADESTGTIG
Sbjct  1    MTAYRGKYADELIANASYIATPGKVILAADESTGTIG  37



>ref|NP_001242367.1| uncharacterized protein LOC100778363 [Glycine max]
 gb|ACU24103.1| unknown [Glycine max]
Length=358

 Score = 66.2 bits (160),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSHFKGKYHDELIVNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009411827.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Musa acuminata subsp. malaccensis]
Length=358

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y G+Y DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGQYHDELIANATYIGTPGKGILAADESTGTIG  37



>ref|NP_001060880.1| Os08g0120600 [Oryza sativa Japonica Group]
 dbj|BAD10819.1| putative fructose-bisphosphate aldolase [Oryza sativa Japonica 
Group]
 dbj|BAF22794.1| Os08g0120600 [Oryza sativa Japonica Group]
 gb|EAZ05423.1| hypothetical protein OsI_27635 [Oryza sativa Indica Group]
 gb|EAZ41341.1| hypothetical protein OsJ_25856 [Oryza sativa Japonica Group]
 dbj|BAG91658.1| unnamed protein product [Oryza sativa Japonica Group]
Length=362

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 33/37 (89%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIG  37



>gb|KEH42090.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIG+PGKGILAADESTGTIG
Sbjct  1    MSSFKSKYEDELIANAAYIGSPGKGILAADESTGTIG  37



>dbj|BAI59774.1| aldolase C-1 [Phyllostachys edulis]
Length=358

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKY DELI NAA+IGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGKYKDELIKNAAHIGTPGKGILAADESTGTIG  37



>gb|AFK34312.1| unknown [Medicago truncatula]
Length=241

 Score = 64.7 bits (156),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|NP_181187.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
 gb|AAD24630.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAK59404.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAL34218.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AAM61668.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 dbj|BAE98935.1| putative fructose bisphosphate aldolase [Arabidopsis thaliana]
 gb|AEC09256.1| fructose-bisphosphate aldolase 6 [Arabidopsis thaliana]
Length=358

 Score = 65.9 bits (159),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS +  K+ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSSFTSKFADELIANAAYIGTPGKGILAADESTGTIG  37



>ref|NP_001265896.1| fructose-bisphosphate aldolase, cytoplasmic isozyme [Cicer arietinum]
 sp|O65735.1|ALF_CICAR RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Cicer arietinum]
 emb|CAA06308.1| cytosolic fructose-1,6-bisphosphate aldolase [Cicer arietinum]
Length=359

 Score = 65.9 bits (159),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_009412699.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme 
[Musa acuminata subsp. malaccensis]
Length=358

 Score = 65.9 bits (159),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y G+Y DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSAYCGQYHDELIANATYIGTPGKGILAADESTGTIG  37



>ref|XP_010246553.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nelumbo nucifera]
Length=357

 Score = 65.5 bits (158),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>gb|AFK43805.1| unknown [Medicago truncatula]
 gb|KEH28149.1| fructose-bisphosphate aldolase [Medicago truncatula]
Length=358

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>gb|AGV08373.1| fructose-bisphosphate aldolase [Arachis hypogaea]
Length=358

 Score = 65.5 bits (158),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37



>ref|XP_011095600.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Sesamum indicum]
Length=396

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 36/47 (77%), Gaps = 0/47 (0%)
 Frame = +1

Query  37   LSSILHKTAAMSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            LS +L     MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  30   LSLLLILRTTMSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  76



>ref|XP_007027627.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
 gb|EOY08129.1| Aldolase superfamily protein isoform 2 [Theobroma cacao]
Length=358

 Score = 65.5 bits (158),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MSC+  KYA+EL  NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSCFISKYAEELAKNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004137873.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Cucumis sativus]
 gb|KGN59066.1| Fructose-bisphosphate aldolase [Cucumis sativus]
Length=358

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANA YIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKYQDELIANATYIGTPGKGILAADESTGTIG  37



>emb|CDX94320.1| BnaC01g18640D [Brassica napus]
Length=870

 Score = 66.2 bits (160),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/41 (76%), Positives = 33/41 (80%), Gaps = 0/41 (0%)
 Frame = +1

Query  55   KTAAMSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            + A MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  509  QKATMSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  549



>ref|NP_001242086.1| uncharacterized protein LOC100795446 [Glycine max]
 gb|ACU23111.1| unknown [Glycine max]
Length=358

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ K+ DELIANA+YIGTPGKGILAADESTGTIG
Sbjct  1    MSSFKSKFQDELIANASYIGTPGKGILAADESTGTIG  37



>sp|P46256.1|ALF1_PEA RecName: Full=Fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Pisum sativum]
 emb|CAA61946.1| fructose-1,6-bisphosphate aldolase [Pisum sativum]
Length=357

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_003617895.1| Fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AET00854.1| fructose-bisphosphate aldolase [Medicago truncatula]
 gb|AFK40688.1| unknown [Medicago truncatula]
Length=357

 Score = 64.7 bits (156),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_002263794.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Vitis vinifera]
 emb|CBI39851.3| unnamed protein product [Vitis vinifera]
Length=357

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>emb|CAN83666.1| hypothetical protein VITISV_008795 [Vitis vinifera]
Length=357

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_003615520.1| Fructose-bisphosphate aldolase [Medicago truncatula]
Length=737

 Score = 65.5 bits (158),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 34/37 (92%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++ KY DELIANAAYIGTPGKGILAADESTGTIG
Sbjct  1    MSNFKSKYHDELIANAAYIGTPGKGILAADESTGTIG  37


 Score = 60.1 bits (144),  Expect = 1e-08, Method: Composition-based stats.
 Identities = 29/31 (94%), Positives = 31/31 (100%), Gaps = 0/31 (0%)
 Frame = +1

Query  85   KYADELIANAAYIGTPGKGILAADESTGTIG  177
            ++ADELIANAAYIGTPGKGILAADESTGTIG
Sbjct  401  EFADELIANAAYIGTPGKGILAADESTGTIG  431



>ref|XP_006659075.1| PREDICTED: fructose-bisphosphate aldolase cytoplasmic isozyme-like 
[Oryza brachyantha]
Length=360

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 32/37 (86%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ Y GKY DELI NAAYIGTPGKGILAADESTGTIG
Sbjct  1    MAAYCGKYKDELIRNAAYIGTPGKGILAADESTGTIG  37



>ref|XP_004491539.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cicer arietinum]
Length=357

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_007142455.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
 gb|ESW14449.1| hypothetical protein PHAVU_008G282000g [Phaseolus vulgaris]
Length=357

 Score = 63.9 bits (154),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_003544567.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Glycine max]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|NP_001237315.1| fructose-bisphosphate aldolase [Glycine max]
 gb|AAR86689.1| fructose-bisphosphate aldolase [Glycine max]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_009141596.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Brassica rapa]
Length=343

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ +  KYADELIANAAYIGTPGKGILAADEST TIG
Sbjct  1    MASFTTKYADELIANAAYIGTPGKGILAADESTDTIG  37



>ref|XP_008353167.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_009620969.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana tomentosiformis]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_008363363.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_008355755.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Malus domestica]
Length=357

 Score = 63.9 bits (154),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>emb|CDY43716.1| BnaAnng07310D [Brassica napus]
Length=343

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 31/37 (84%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+ +  KYADELIANAAYIGTPGKGILAADEST TIG
Sbjct  1    MASFTTKYADELIANAAYIGTPGKGILAADESTDTIG  37



>ref|XP_010942543.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Elaeis guineensis]
Length=357

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_002978503.1| hypothetical protein SELMODRAFT_176914 [Selaginella moellendorffii]
 gb|EFJ20489.1| hypothetical protein SELMODRAFT_176914 [Selaginella moellendorffii]
Length=358

 Score = 63.2 bits (152),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+   GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MAAVAGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_008782993.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Phoenix dactylifera]
Length=357

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTARYIATPGKGILAADESTGTIG  37



>ref|XP_009142435.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
[Brassica rapa]
 emb|CDX89329.1| BnaA01g15640D [Brassica napus]
Length=358

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>gb|EMT11738.1| Fructose-bisphosphate aldolase, cytoplasmic isozyme 1 [Aegilops 
tauschii]
Length=351

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>gb|KDO37191.1| hypothetical protein CISIN_1g016748mg [Citrus sinensis]
Length=383

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI  PGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIAAPGKGILAADESTGTIG  37



>ref|XP_010448258.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score = 62.8 bits (151),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>gb|ACN85313.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Oryza brachyantha]
Length=349

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_004497605.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Cicer arietinum]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 33/37 (89%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS ++  + DELIANAAYIG+PGKGILAADESTGTIG
Sbjct  1    MSSFKSNFEDELIANAAYIGSPGKGILAADESTGTIG  37



>ref|XP_008218850.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Prunus mume]
Length=357

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_006284000.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
 gb|EOA16898.1| hypothetical protein CARUB_v10005122mg [Capsella rubella]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_010438739.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
[Camelina sativa]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_010433486.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X1 [Camelina sativa]
 ref|XP_010433487.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433488.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
 ref|XP_010433489.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme-like 
isoform X2 [Camelina sativa]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_011039825.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Populus euphratica]
Length=357

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_002869605.1| hypothetical protein ARALYDRAFT_492157 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45864.1| hypothetical protein ARALYDRAFT_492157 [Arabidopsis lyrata subsp. 
lyrata]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_007020393.1| Aldolase superfamily protein [Theobroma cacao]
 gb|EOY11918.1| Aldolase superfamily protein [Theobroma cacao]
Length=357

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|NP_194383.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 ref|NP_001031721.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 emb|CAA18217.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 emb|CAB79508.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAM64926.1| fructose-bisphosphate aldolase-like protein [Arabidopsis thaliana]
 gb|AAN72017.1| fructose-bisphosphate aldolase - like protein [Arabidopsis thaliana]
 gb|AAP68283.1| At4g26530 [Arabidopsis thaliana]
 gb|AEE85214.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
 gb|AEE85215.1| fructose-bisphosphate aldolase 5 [Arabidopsis thaliana]
Length=358

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_003563638.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Brachypodium distachyon]
Length=360

 Score = 62.8 bits (151),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_004294907.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Fragaria vesca subsp. vesca]
Length=357

 Score = 62.4 bits (150),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_002299056.1| fructose-1 family protein [Populus trichocarpa]
 gb|ABK94744.1| unknown [Populus trichocarpa]
 gb|EEE83861.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score = 62.4 bits (150),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_011037763.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_011000316.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Populus euphratica]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_006377966.1| fructose-1 family protein [Populus trichocarpa]
 gb|ERP55763.1| fructose-1 family protein [Populus trichocarpa]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_010252855.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Nelumbo nucifera]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_010545295.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Tarenaya hassleriana]
Length=359

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>gb|KJB81553.1| hypothetical protein B456_013G150000 [Gossypium raimondii]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_002986752.1| hypothetical protein SELMODRAFT_425653 [Selaginella moellendorffii]
 gb|EFJ12082.1| hypothetical protein SELMODRAFT_425653 [Selaginella moellendorffii]
Length=357

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI NA YI +PGKGILAADEST TIG
Sbjct  1    MSAYMGKYADELIINARYIASPGKGILAADESTSTIG  37



>ref|XP_002969534.1| hypothetical protein SELMODRAFT_231316 [Selaginella moellendorffii]
 gb|EFJ29622.1| hypothetical protein SELMODRAFT_231316 [Selaginella moellendorffii]
Length=357

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI NA YI +PGKGILAADEST TIG
Sbjct  1    MSAYMGKYADELIINARYIASPGKGILAADESTSTIG  37



>gb|KDP32624.1| hypothetical protein JCGZ_13174 [Jatropha curcas]
Length=357

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_007205428.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
 gb|EMJ06627.1| hypothetical protein PRUPE_ppa007744mg [Prunus persica]
Length=357

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_006474808.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Citrus sinensis]
Length=357

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>gb|EYU27475.1| hypothetical protein MIMGU_mgv1a008862mg [Erythranthe guttata]
Length=360

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_010676114.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Beta vulgaris subsp. vulgaris]
Length=357

 Score = 62.0 bits (149),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_001765506.1| predicted protein [Physcomitrella patens]
 gb|EDQ69767.1| predicted protein [Physcomitrella patens]
Length=355

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS Y GKYADELI  A +IGTPGKGILAADEST TIG
Sbjct  1    MSAYWGKYADELIRTAKFIGTPGKGILAADESTSTIG  37



>gb|AAR84667.1| fructose 1,6, bisphosphate aldolase [Salicornia herbacea]
Length=359

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_004244020.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum lycopersicum]
Length=357

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_006413170.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
 gb|ESQ54623.1| hypothetical protein EUTSA_v10025556mg [Eutrema salsugineum]
Length=358

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_009799651.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Nicotiana sylvestris]
Length=357

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_010061415.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Eucalyptus grandis]
 gb|KCW68357.1| hypothetical protein EUGRSUZ_F02017 [Eucalyptus grandis]
Length=357

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_009391905.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Musa acuminata subsp. malaccensis]
Length=357

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIRTAKYIATPGKGILAADESTGTIG  37



>gb|EPS69505.1| fructose-bisphosphate aldolase [Genlisea aurea]
Length=359

 Score = 61.6 bits (148),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKY+DELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFIGKYSDELIKTAKYIATPGKGILAADESTGTIG  37



>dbj|BAJ85287.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88466.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=360

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADEL+  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELMKTAKYIATPGKGILAADESTGTIG  37



>gb|KFK29173.1| hypothetical protein AALP_AA7G098900 [Arabis alpina]
Length=358

 Score = 61.2 bits (147),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/37 (78%), Positives = 30/37 (81%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKY DELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYKDELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_010929015.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X1 [Elaeis guineensis]
 ref|XP_010929016.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 isoform X2 [Elaeis guineensis]
Length=357

 Score = 61.2 bits (147),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_006346102.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Solanum tuberosum]
Length=357

 Score = 60.8 bits (146),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+EL+ NA YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELMKNAKYIATPGKGILAADESTGTIG  37



>ref|XP_008447787.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1 [Cucumis melo]
Length=357

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA +I TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKFIATPGKGILAADESTGTIG  37



>ref|XP_006452682.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
 gb|ESR65922.1| hypothetical protein CICLE_v10008762mg [Citrus clementina]
Length=357

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA YI  PGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKNAKYIAAPGKGILAADESTGTIG  37



>ref|XP_004139771.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cucumis sativus]
 ref|XP_004156348.1| PREDICTED: fructose-bisphosphate aldolase, cytoplasmic isozyme 
1-like [Cucumis sativus]
 gb|KGN44117.1| hypothetical protein Csa_7G195260 [Cucumis sativus]
Length=403

 Score = 60.8 bits (146),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 32/37 (86%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI NA +I TPGKGILAADESTGTIG
Sbjct  47   MSAFVGKYAEELIKNAKFIATPGKGILAADESTGTIG  83



>ref|XP_002970423.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
 gb|EFJ28553.1| hypothetical protein SELMODRAFT_267384 [Selaginella moellendorffii]
Length=358

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            M+   GKYADELI NA YI TPGKGILAADESTGTIG
Sbjct  1    MAAVVGKYADELIKNAKYIATPGKGILAADESTGTIG  37



>gb|ACN85267.1| fructose-bisphosphate aldolase cytoplasmic isozyme [Oryza alta]
Length=358

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 30/37 (81%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYADELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYADELIKTAKYIATPGKGILAADESTGTIG  37



>ref|XP_002519633.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
 gb|EEF42778.1| fructose-bisphosphate aldolase, putative [Ricinus communis]
Length=357

 Score = 60.5 bits (145),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 29/37 (78%), Positives = 31/37 (84%), Gaps = 0/37 (0%)
 Frame = +1

Query  67   MSCYRGKYADELIANAAYIGTPGKGILAADESTGTIG  177
            MS + GKYA+ELI  A YI TPGKGILAADESTGTIG
Sbjct  1    MSAFVGKYAEELIKTAKYIATPGKGILAADESTGTIG  37



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 555109064460