BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B14

Length=767
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_003619702.1|  Ubiquitin-like protein                             359   1e-121   
gb|AIS71924.1|  polyubiquitin                                           358   2e-121   Mangifera indica
gb|AFC36452.1|  ubiquitin                                               356   4e-121   Anoectochilus roxburghii
gb|AGV54749.1|  ubiquitin 11                                            358   4e-121   Phaseolus vulgaris [French bean]
gb|ACA58351.1|  ubiquitin-like protein                                  355   8e-121   Sandersonia aurantiaca [Chinese-lantern lily]
emb|CBI22349.3|  unnamed protein product                                358   1e-120   Vitis vinifera
gb|ABI84246.1|  polyubiquitin 10                                        354   2e-120   Arachis hypogaea [goober]
gb|AEZ49160.1|  polyubiquitin                                           357   3e-120   Wolffia australiana
gb|AEW46688.1|  polyubiquitin                                           355   3e-120   Ulva linza
gb|AFW66442.1|  putative ubiquitin family protein                       354   3e-120   
ref|XP_003626479.1|  Ubiquitin-like protein                             356   4e-120   
ref|XP_008358804.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    355   5e-120   
ref|XP_002872746.1|  hypothetical protein ARALYDRAFT_911794             354   5e-120   
ref|XP_010931017.1|  PREDICTED: polyubiquitin 11 isoform X1             354   5e-120   Elaeis guineensis
gb|AFP44113.1|  ubiquitin                                               352   5e-120   Lycoris longituba
gb|AAO43307.1|  putative polyubiquitin                                  355   5e-120   Arabidopsis thaliana [mouse-ear cress]
gb|AET06143.1|  ubiquitin                                               354   6e-120   Papaver somniferum
gb|EYU33610.1|  hypothetical protein MIMGU_mgv1a004315mg                354   6e-120   Erythranthe guttata [common monkey flower]
ref|XP_004968120.1|  PREDICTED: polyubiquitin-like                      354   6e-120   Setaria italica
ref|XP_010490793.1|  PREDICTED: polyubiquitin 11-like                   354   6e-120   Camelina sativa [gold-of-pleasure]
gb|ACJ85618.1|  unknown                                                 354   6e-120   Medicago truncatula
ref|XP_009412006.1|  PREDICTED: polyubiquitin 11-like                   354   6e-120   
ref|XP_007154494.1|  hypothetical protein PHAVU_003G1236001g            352   6e-120   Phaseolus vulgaris [French bean]
dbj|BAC57955.1|  polyubiquitin                                          354   7e-120   Tripolium pannonicum [sea starwort]
gb|AAP31578.1|  ubiquitin                                               354   7e-120   Hevea brasiliensis [jebe]
ref|XP_002317213.1|  polyubiquitin family protein                       353   7e-120   Populus trichocarpa [western balsam poplar]
ref|XP_006288299.1|  hypothetical protein CARUB_v10001544mg             354   7e-120   
ref|NP_567286.1|  ubiquitin 11                                          353   7e-120   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007154493.1|  hypothetical protein PHAVU_003G123500g             361   7e-120   Phaseolus vulgaris [French bean]
gb|KJB36627.1|  hypothetical protein B456_006G167800                    353   7e-120   Gossypium raimondii
ref|XP_002438839.1|  hypothetical protein SORBIDRAFT_10g027030          353   7e-120   Sorghum bicolor [broomcorn]
gb|KDO51109.1|  hypothetical protein CISIN_1g026973mg                   353   7e-120   Citrus sinensis [apfelsine]
ref|XP_007205619.1|  hypothetical protein PRUPE_ppa009116mg             354   7e-120   
ref|XP_006428822.1|  hypothetical protein CICLE_v10012652mg             353   8e-120   Citrus clementina [clementine]
ref|XP_006428779.1|  hypothetical protein CICLE_v10012654mg             353   8e-120   Citrus clementina [clementine]
gb|KDO51955.1|  hypothetical protein CISIN_1g026932mg                   353   1e-119   Citrus sinensis [apfelsine]
emb|CAD27944.1|  polyubiquitin-like                                     353   1e-119   Oryza sativa [red rice]
ref|XP_006370634.1|  hypothetical protein POPTR_0001s44440g             355   1e-119   
gb|AIZ74335.1|  polyubiquitin 3                                         354   1e-119   Pinus massoniana [Chinese red pine]
emb|CAH59739.1|  polyubiquitin                                          353   1e-119   Plantago major [cart-track plant]
emb|CCO30833.1|  Polyubiquitin                                          360   1e-119   Rhizoctonia solani AG-1 IB
ref|XP_010235843.1|  PREDICTED: polyubiquitin 11 isoform X1             354   1e-119   Brachypodium distachyon [annual false brome]
gb|ABY60454.1|  putative polyubiquitin                                  355   1e-119   Adonis aestivalis var. palaestina
gb|AFK41706.1|  unknown                                                 353   2e-119   Medicago truncatula
ref|XP_007512209.1|  polyubiquitin                                      357   2e-119   Bathycoccus prasinos
ref|XP_007154495.1|  hypothetical protein PHAVU_003G1236001g            354   2e-119   Phaseolus vulgaris [French bean]
emb|CAC94926.1|  putative ubiquitin                                     353   2e-119   Pleurotus sp. 'Florida' [Florida oyster mushroom]
gb|AIY27743.1|  polyubiquitin Ubi10                                     356   2e-119   Betula luminifera [liang ye hua]
gb|KJB62484.1|  hypothetical protein B456_009G418900                    352   2e-119   Gossypium raimondii
gb|EPS72031.1|  polyubiquitin                                           354   2e-119   Genlisea aurea
gb|ACJ85643.1|  unknown                                                 352   2e-119   Medicago truncatula
ref|XP_003627152.1|  Ubiquitin                                          354   2e-119   
ref|XP_009112898.1|  PREDICTED: polyubiquitin                           355   2e-119   Brassica rapa
ref|NP_001147027.1|  polyubiquitin containing 7 ubiquitin monomers      355   2e-119   
ref|XP_006377830.1|  hypothetical protein POPTR_0011s13770g             355   2e-119   
ref|XP_003607669.1|  Multidrug resistance protein ABC transporter...    360   2e-119   
gb|AAC35858.1|  polyubiquitin                                           353   3e-119   Capsicum chinense [bonnet pepper]
ref|XP_007014924.1|  Polyubiquitin 3                                    355   3e-119   Theobroma cacao [chocolate]
prf||1604470A  poly-ubiquitin                                           354   3e-119
gb|EYU33609.1|  hypothetical protein MIMGU_mgv1a004315mg                355   3e-119   Erythranthe guttata [common monkey flower]
ref|XP_007211606.1|  hypothetical protein PRUPE_ppa005503mg             355   3e-119   
ref|XP_009114489.1|  PREDICTED: polyubiquitin-like                      355   3e-119   Brassica rapa
gb|ABK94002.1|  unknown                                                 355   3e-119   Populus trichocarpa [western balsam poplar]
ref|XP_007205620.1|  hypothetical protein PRUPE_ppa009116mg             355   3e-119   
ref|XP_002456845.1|  hypothetical protein SORBIDRAFT_03g043940          355   3e-119   Sorghum bicolor [broomcorn]
emb|CAA48140.1|  ubiquitin                                              355   3e-119   Antirrhinum majus [garden snapdragon]
gb|ABD96088.1|  polyubiquitin                                           353   3e-119   Malus domestica [apple tree]
ref|XP_006654612.1|  PREDICTED: polyubiquitin-like                      355   3e-119   Oryza brachyantha
emb|CDP08569.1|  unnamed protein product                                355   3e-119   Coffea canephora [robusta coffee]
ref|NP_851029.1|  polyubiquitin 3                                       355   3e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AES89866.2|  polyubiquitin 3                                         355   3e-119   Medicago truncatula
dbj|BAJ85978.1|  predicted protein                                      355   3e-119   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003590494.1|  Ubiquitin                                          355   3e-119   
emb|CAA40323.1|  polyubiquitin protein                                  356   3e-119   Helianthus annuus
ref|NP_849292.1|  polyubiquitin 14                                      355   3e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011468094.1|  PREDICTED: polyubiquitin                           355   3e-119   Fragaria vesca subsp. vesca
sp|P69315.2|UBIQP_LINUS  RecName: Full=Polyubiquitin; Contains: R...    355   3e-119   Linum usitatissimum
ref|XP_006396611.1|  hypothetical protein EUTSA_v10028730mg             355   3e-119   
ref|XP_010258950.1|  PREDICTED: polyubiquitin                           355   3e-119   Nelumbo nucifera [Indian lotus]
ref|XP_006480631.1|  PREDICTED: polyubiquitin-like                      355   3e-119   Citrus sinensis [apfelsine]
ref|XP_003537278.1|  PREDICTED: polyubiquitin-like                      355   4e-119   Glycine max [soybeans]
ref|XP_002873083.1|  hypothetical protein ARALYDRAFT_487095             355   4e-119   
ref|XP_006302387.1|  hypothetical protein CARUB_v10020456mg             355   4e-119   
ref|XP_003574865.1|  PREDICTED: polyubiquitin-like                      356   4e-119   Brachypodium distachyon [annual false brome]
emb|CAH59740.1|  polyubiquitin                                          355   4e-119   Plantago major [cart-track plant]
gb|KJB81823.1|  hypothetical protein B456_013G163500                    355   4e-119   Gossypium raimondii
ref|XP_010227188.1|  PREDICTED: polyubiquitin isoform X1                356   4e-119   
ref|XP_006428925.1|  hypothetical protein CICLE_v10012291mg             355   4e-119   Citrus clementina [clementine]
ref|XP_006428821.1|  hypothetical protein CICLE_v10012292mg             355   4e-119   Citrus clementina [clementine]
ref|XP_002872805.1|  hypothetical protein ARALYDRAFT_490270             355   4e-119   
gb|KDP39203.1|  hypothetical protein JCGZ_00960                         355   4e-119   Jatropha curcas
ref|XP_008784557.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    352   5e-119   
emb|CAA54603.1|  pentameric polyubiquitin                               356   5e-119   Nicotiana tabacum [American tobacco]
ref|XP_006428820.1|  hypothetical protein CICLE_v10012290mg             355   5e-119   Citrus clementina [clementine]
gb|AAQ84316.1|  fiber polyubiquitin                                     352   5e-119   Gossypium barbadense [Egyptian cotton]
gb|AGV54228.1|  polyubiquitin-like protein                              357   5e-119   Phaseolus vulgaris [French bean]
gb|KDP38838.1|  hypothetical protein JCGZ_04995                         354   5e-119   Jatropha curcas
emb|CBY46745.1|  polyubiquitin 10 protein                               354   5e-119   Lepidium appelianum [hairy whitetop]
gb|KIM78989.1|  hypothetical protein PILCRDRAFT_573034                  352   5e-119   Piloderma croceum F 1598
ref|XP_003570150.1|  PREDICTED: polyubiquitin 11 isoform X2             352   5e-119   Brachypodium distachyon [annual false brome]
ref|XP_006288300.1|  hypothetical protein CARUB_v10001544mg             354   6e-119   Capsella rubella
gb|ACD31680.1|  ubiquitin                                               354   6e-119   Gossypium hirsutum [American cotton]
ref|XP_003082269.1|  polyubiquitin (ISS)                                353   6e-119   
gb|AFK43392.1|  unknown                                                 352   6e-119   Medicago truncatula
gb|KJA26171.1|  hypothetical protein HYPSUDRAFT_354705                  351   7e-119   Hypholoma sublateritium FD-334 SS-4
gb|AAB95250.1|  ubiquitin                                               354   7e-119   Arabidopsis thaliana [mouse-ear cress]
gb|AAM64530.1|  ubiquitin homolog                                       351   7e-119   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006287868.1|  hypothetical protein CARUB_v10001095mg             358   7e-119   
gb|EJU04700.1|  polyubiquitin UbiD/Ubi4                                 351   8e-119   Dacryopinax primogenitus
gb|KIK28767.1|  hypothetical protein PISMIDRAFT_672939                  352   8e-119   Pisolithus microcarpus 441
gb|KIM78981.1|  hypothetical protein PILCRDRAFT_10644                   351   8e-119   Piloderma croceum F 1598
ref|XP_010453358.1|  PREDICTED: polyubiquitin-like                      354   9e-119   Camelina sativa [gold-of-pleasure]
ref|XP_011110054.1|  hypothetical protein H072_4094                     351   1e-118   
ref|XP_007154496.1|  hypothetical protein PHAVU_003G1236001g            353   1e-118   Phaseolus vulgaris [French bean]
gb|KJB14874.1|  hypothetical protein B456_002G147600                    355   1e-118   Gossypium raimondii
ref|XP_011077812.1|  PREDICTED: polyubiquitin 3                         355   1e-118   
gb|KIL68862.1|  hypothetical protein M378DRAFT_157997                   353   1e-118   Amanita muscaria Koide BX008
ref|XP_006685644.1|  ubiquitin                                          351   1e-118   Yamadazyma tenuis ATCC 10573
ref|XP_010062974.1|  PREDICTED: polyubiquitin                           358   1e-118   Eucalyptus grandis [rose gum]
gb|AHC00631.1|  polyubiquitin                                           354   1e-118   Ganoderma lucidum
emb|CDR41572.1|  RHTO0S06e03070g1_1                                     351   1e-118   Rhodotorula toruloides
gb|AFW66439.1|  putative ubiquitin family protein                       353   1e-118   
emb|CDP08567.1|  unnamed protein product                                355   1e-118   Coffea canephora [robusta coffee]
gb|KJB62487.1|  hypothetical protein B456_009G418900                    353   1e-118   Gossypium raimondii
gb|KDB11907.1|  ubiquitin                                               353   1e-118   Ustilaginoidea virens
ref|XP_008796945.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    353   1e-118   Phoenix dactylifera
gb|AFW66438.1|  putative ubiquitin family protein                       355   1e-118   
ref|XP_010938693.1|  PREDICTED: polyubiquitin                           353   2e-118   Elaeis guineensis
dbj|BAF00213.1|  polyubiquitin 4 UBQ4                                   355   2e-118   Arabidopsis thaliana [mouse-ear cress]
gb|AES89865.2|  polyubiquitin 3                                         352   2e-118   Medicago truncatula
gb|AFY06654.1|  polyubiquitin                                           351   2e-118   Carica papaya [mamon]
emb|CEF99839.1|  Ubiquitin conserved site                               354   2e-118   Ostreococcus tauri
gb|AAO43308.1|  putative polyubiquitin                                  351   2e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003607668.1|  Multidrug resistance protein ABC transporter...    359   2e-118   
gb|AGZ15412.1|  fiber polyubiquitin                                     350   2e-118   Phaseolus vulgaris [French bean]
gb|EGO00904.1|  hypothetical protein SERLA73DRAFT_178893                353   2e-118   Serpula lacrymans var. lacrymans S7.3
dbj|GAK65396.1|  ubiquitin                                              354   2e-118   Moesziomyces antarcticus
gb|KIK92093.1|  hypothetical protein PAXRUDRAFT_830299                  350   2e-118   Paxillus rubicundulus Ve08.2h10
ref|XP_002872109.1|  predicted protein                                  355   2e-118   
gb|ACS68205.1|  ubiquitin 10.2                                          355   3e-118   Brassica napus [oilseed rape]
ref|XP_010240921.1|  PREDICTED: polyubiquitin-like                      355   3e-118   Nelumbo nucifera [Indian lotus]
ref|XP_006593989.1|  PREDICTED: polyubiquitin 10-like isoform X1        355   3e-118   
emb|CBY46746.1|  polyubiquitin 10 protein                               355   3e-118   Lepidium campestre [bastard cress]
ref|XP_010492041.1|  PREDICTED: polyubiquitin-like                      352   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_006381473.1|  polyubiquitin family protein                       352   3e-118   
gb|EYU33608.1|  hypothetical protein MIMGU_mgv1a004315mg                355   3e-118   Erythranthe guttata [common monkey flower]
ref|XP_010911599.1|  PREDICTED: polyubiquitin 4                         355   3e-118   Elaeis guineensis
ref|XP_010454368.1|  PREDICTED: polyubiquitin 4-like                    355   3e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002874006.1|  hypothetical protein ARALYDRAFT_488966             355   3e-118   
ref|XP_002508175.1|  ubiquitin                                          355   3e-118   Micromonas commoda
ref|XP_011048569.1|  PREDICTED: polyubiquitin 3-like                    352   3e-118   Populus euphratica
ref|NP_001148453.1|  LOC100282068                                       355   3e-118   Zea mays [maize]
gb|AAB68045.1|  polyubiquitin                                           355   3e-118   Fragaria x ananassa
ref|XP_010240636.1|  PREDICTED: polyubiquitin isoform X1                355   3e-118   
ref|NP_849300.4|  polyubiquitin 10                                      355   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006396612.1|  hypothetical protein EUTSA_v10028730mg             355   3e-118   Eutrema salsugineum [saltwater cress]
emb|CCL99875.1|  predicted protein                                      352   3e-118   Fibroporia radiculosa
gb|KJB13592.1|  hypothetical protein B456_002G083000                    355   3e-118   Gossypium raimondii
sp|P0CG84.1|UBI4P_NICSY  RecName: Full=Polyubiquitin; Contains: R...    355   3e-118   Nicotiana sylvestris
gb|KJB62485.1|  hypothetical protein B456_009G418900                    352   3e-118   Gossypium raimondii
ref|NP_568397.1|  ubiquitin 4                                           355   3e-118   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001174480.1|  Os05g0504766                                       355   4e-118   
ref|NP_001105376.1|  polyubiquitin                                      355   4e-118   
ref|XP_010558157.1|  PREDICTED: polyubiquitin-like                      355   4e-118   Tarenaya hassleriana [spider flower]
gb|AAY86773.1|  polyubiquitin                                           355   4e-118   Noccaea caerulescens
sp|Q58G87.2|UBQ3_ORYSJ  RecName: Full=Polyubiquitin 3; Contains: ...    355   4e-118   Oryza sativa Japonica Group [Japonica rice]
gb|AAX40652.1|  polyubiquitin                                           355   4e-118   Oryza sativa Japonica Group [Japonica rice]
gb|ABU40645.1|  polyubiquitin                                           355   4e-118   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009596689.1|  PREDICTED: polyubiquitin-like                      355   4e-118   Nicotiana tomentosiformis
ref|XP_006428816.1|  hypothetical protein CICLE_v10011684mg             355   4e-118   
emb|CDP05795.1|  unnamed protein product                                355   4e-118   Coffea canephora [robusta coffee]
gb|KIY45417.1|  ubiquitin                                               352   4e-118   Fistulina hepatica ATCC 64428
ref|XP_009591312.1|  PREDICTED: polyubiquitin 4                         355   4e-118   Nicotiana tomentosiformis
gb|KIR63773.1|  polyubiquitin                                           352   4e-118   Cryptococcus gattii CA1873
gb|ADD52202.1|  ubiquitin                                               355   4e-118   Catharanthus roseus [chatas]
ref|XP_002266370.1|  PREDICTED: polyubiquitin 4-like                    355   4e-118   Vitis vinifera
ref|XP_006302388.1|  hypothetical protein CARUB_v10020456mg             355   4e-118   Capsella rubella
gb|AAB36545.1|  ubiquitin-like protein                                  356   4e-118   Phaseolus vulgaris [French bean]
gb|AAL09741.1|  AT4g05320/C17L7_240                                     355   4e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_001828882.1|  ubiquitin C                                        352   4e-118   Coprinopsis cinerea okayama7#130
gb|KIY97324.1|  ubiquitin C                                             347   4e-118   Monoraphidium neglectum
gb|KIY53974.1|  polyubiquitin                                           352   4e-118   Fistulina hepatica ATCC 64428
gb|KIJ45725.1|  hypothetical protein M422DRAFT_106821                   352   4e-118   Sphaerobolus stellatus SS14
ref|XP_010421267.1|  PREDICTED: polyubiquitin 4-like                    355   4e-118   Camelina sativa [gold-of-pleasure]
ref|XP_002992988.1|  hypothetical protein SELMODRAFT_187148             349   4e-118   Selaginella moellendorffii
gb|EYU18102.1|  hypothetical protein MIMGU_mgv1a008166mg                355   4e-118   Erythranthe guttata [common monkey flower]
gb|KJB81825.1|  hypothetical protein B456_013G163500                    355   4e-118   Gossypium raimondii
ref|XP_009763135.1|  PREDICTED: polyubiquitin-like                      355   4e-118   Nicotiana sylvestris
ref|XP_010696408.1|  PREDICTED: polyubiquitin 4                         355   4e-118   Beta vulgaris subsp. vulgaris [field beet]
gb|KEH31155.1|  polyubiquitin 3                                         355   4e-118   Medicago truncatula
gb|EWZ40370.1|  ubiquitin C                                             349   5e-118   Fusarium oxysporum Fo47
ref|XP_001555417.1|  polyubiquitin                                      352   5e-118   Botrytis cinerea B05.10
ref|XP_009605659.1|  PREDICTED: polyubiquitin                           352   5e-118   Nicotiana tomentosiformis
ref|XP_009108753.1|  PREDICTED: polyubiquitin 11-like                   349   5e-118   Brassica rapa
dbj|BAL61087.1|  polyubiquitin                                          349   5e-118   Dianthus caryophyllus [carnation]
ref|XP_001783045.1|  predicted protein                                  349   5e-118   
ref|XP_001420612.1|  predicted protein                                  355   5e-118   Ostreococcus lucimarinus CCE9901
ref|XP_010452435.1|  PREDICTED: polyubiquitin-like                      352   5e-118   Camelina sativa [gold-of-pleasure]
ref|XP_003030030.1|  polyubiquitin                                      352   5e-118   Schizophyllum commune H4-8
gb|KIR29996.1|  polyubiquitin                                           352   5e-118   Cryptococcus gattii VGII LA55
ref|XP_001598085.1|  polyubiquitin                                      352   5e-118   Sclerotinia sclerotiorum 1980 UF-70
gb|KIM67150.1|  hypothetical protein SCLCIDRAFT_1210637                 352   5e-118   Scleroderma citrinum Foug A
ref|XP_001755431.1|  predicted protein                                  349   5e-118   
gb|ACH45557.1|  putative ubiquitin C variant 4                          347   6e-118   Taeniopygia guttata
ref|XP_010270791.1|  PREDICTED: polyubiquitin-like                      354   6e-118   Nelumbo nucifera [Indian lotus]
ref|XP_009358096.1|  PREDICTED: polyubiquitin isoform X1                355   6e-118   Pyrus x bretschneideri [bai li]
gb|AAO43309.1|  putative polyubiquitin                                  350   6e-118   Arabidopsis thaliana [mouse-ear cress]
gb|ADO60140.1|  ubiquitin                                               348   6e-118   Beauveria bassiana
gb|AAN31845.1|  putative polyubiquitin (UBQ10)                          357   6e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008020911.1|  hypothetical protein SETTUDRAFT_162442             352   7e-118   Exserohilum turcica Et28A
gb|KIM48035.1|  hypothetical protein M413DRAFT_16078                    354   7e-118   Hebeloma cylindrosporum h7
emb|CCT70325.1|  UBI4-Ubiquitin                                         350   7e-118   Fusarium fujikuroi IMI 58289
gb|KDQ20365.1|  hypothetical protein BOTBODRAFT_123907                  352   7e-118   Botryobasidium botryosum FD-172 SS1
gb|EMS65864.1|  Polyubiquitin                                           355   7e-118   Triticum urartu
ref|XP_007763327.1|  polyubiquitin                                      352   7e-118   Coniophora puteana RWD-64-598 SS2
ref|XP_007339454.1|  ubiquitin                                          352   7e-118   
ref|XP_007366816.1|  polyubiquitin                                      352   7e-118   Dichomitus squalens LYAD-421 SS1
ref|XP_009631616.1|  PREDICTED: polyubiquitin-like                      354   7e-118   Nicotiana tomentosiformis
ref|XP_010324327.1|  PREDICTED: polyubiquitin isoform X2                354   7e-118   
ref|XP_001764949.1|  predicted protein                                  352   8e-118   
ref|NP_001053957.1|  Os04g0628100                                       354   8e-118   
gb|AAB95252.1|  ubiquitin                                               354   9e-118   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010275241.1|  PREDICTED: polyubiquitin-like                      354   1e-117   Nelumbo nucifera [Indian lotus]
gb|AAQ07453.1|  ubiquitin                                               354   1e-117   Musa acuminata AAA Group [Cavendish banana]
gb|KJB81824.1|  hypothetical protein B456_013G163500                    354   1e-117   Gossypium raimondii
ref|XP_003670049.1|  hypothetical protein NDAI_0D04930                  348   1e-117   Naumovozyma dairenensis CBS 421
gb|AAK68824.1|  Unknown protein                                         348   1e-117   Arabidopsis thaliana [mouse-ear cress]
emb|CEP60563.1|  LALA0S01e13784g1_1                                     348   1e-117   Lachancea lanzarotensis
ref|XP_007924320.1|  hypothetical protein MYCFIDRAFT_60610              348   1e-117   Pseudocercospora fijiensis CIRAD86
gb|KII93501.1|  hypothetical protein PLICRDRAFT_694663                  352   1e-117   Plicaturopsis crispa FD-325 SS-3
ref|XP_010493589.1|  PREDICTED: polyubiquitin-like                      355   1e-117   Camelina sativa [gold-of-pleasure]
gb|KJB62483.1|  hypothetical protein B456_009G418900                    353   1e-117   Gossypium raimondii
ref|XP_001931824.1|  ubiquitin                                          348   2e-117   Pyrenophora tritici-repentis Pt-1C-BFP
ref|XP_719867.1|  hypothetical protein CaO19.6771                       348   2e-117   Candida albicans SC5314
gb|AEG78435.1|  ubiquitin C variant 3                                   349   2e-117   Epinephelus coioides [estuary cod]
ref|XP_001797032.1|  hypothetical protein SNOG_06667                    348   2e-117   Parastagonospora nodorum SN15
gb|EPX74297.1|  ubiquitin                                               348   2e-117   Schizosaccharomyces octosporus yFS286
ref|XP_001755307.1|  predicted protein                                  350   2e-117   
ref|XP_002980153.1|  hypothetical protein SELMODRAFT_271419             350   2e-117   
emb|CBY16339.1|  unnamed protein product                                346   2e-117   Oikopleura dioica
ref|XP_002953480.1|  polyubiquitin                                      350   2e-117   Volvox carteri f. nagariensis
ref|XP_003052575.1|  predicted protein                                  350   2e-117   [Nectria] haematococca mpVI 77-13-4
ref|XP_006372519.1|  polyubiquitin family protein                       350   2e-117   Populus trichocarpa [western balsam poplar]
gb|ACX46987.1|  ubiquitin                                               355   2e-117   Guzmania wittmackii x Guzmania lingulata
ref|XP_010436682.1|  PREDICTED: polyubiquitin 4-like                    355   3e-117   
gb|EGO00841.1|  hypothetical protein SERLA73DRAFT_121253                352   3e-117   Serpula lacrymans var. lacrymans S7.3
gb|AIS40894.1|  polyubiquitin                                           356   3e-117   Kalanchoe fedtschenkoi [lavender-scallops]
gb|KDP42860.1|  hypothetical protein JCGZ_23802                         355   3e-117   Jatropha curcas
ref|XP_010537590.1|  PREDICTED: polyubiquitin 11                        347   3e-117   Tarenaya hassleriana [spider flower]
ref|XP_010324326.1|  PREDICTED: polyubiquitin isoform X1                355   3e-117   
ref|XP_004956019.1|  PREDICTED: polyubiquitin 4-like                    353   3e-117   Setaria italica
gb|AAD03343.1|  ubiquitin                                               355   3e-117   Pisum sativum [garden pea]
gb|EYU33607.1|  hypothetical protein MIMGU_mgv1a004315mg                355   3e-117   Erythranthe guttata [common monkey flower]
dbj|BAK03691.1|  predicted protein                                      355   3e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAK02501.1|  predicted protein                                      355   3e-117   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010423744.1|  PREDICTED: polyubiquitin                           355   3e-117   Camelina sativa [gold-of-pleasure]
ref|XP_001830230.1|  ubiquitin                                          350   4e-117   Coprinopsis cinerea okayama7#130
ref|XP_009784908.1|  PREDICTED: polyubiquitin-like isoform X2           355   4e-117   Nicotiana sylvestris
gb|AAB95251.1|  ubiquitin                                               355   4e-117   Arabidopsis thaliana [mouse-ear cress]
gb|KJB13590.1|  hypothetical protein B456_002G083000                    355   4e-117   Gossypium raimondii
gb|AFK47245.1|  unknown                                                 347   4e-117   Medicago truncatula
ref|XP_010431529.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    355   4e-117   Camelina sativa [gold-of-pleasure]
ref|NP_001045980.1|  Os02g0161900                                       355   4e-117   
ref|XP_002452705.1|  hypothetical protein SORBIDRAFT_04g031060          355   4e-117   Sorghum bicolor [broomcorn]
ref|XP_002891806.1|  predicted protein                                  352   4e-117   
ref|XP_004953565.1|  PREDICTED: polyubiquitin-like                      355   4e-117   Setaria italica
emb|CAA40324.1|  hexaubiquitin protein                                  355   4e-117   Helianthus annuus
ref|XP_007211609.1|  hypothetical protein PRUPE_ppa005507mg             355   4e-117   Prunus persica
ref|XP_011094650.1|  PREDICTED: polyubiquitin                           355   4e-117   Sesamum indicum [beniseed]
ref|NP_849299.4|  polyubiquitin 10                                      355   4e-117   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006428817.1|  hypothetical protein CICLE_v10011684mg             355   4e-117   
ref|XP_007049060.1|  Polyubiquitin 10                                   355   4e-117   
ref|XP_003542730.1|  PREDICTED: polyubiquitin 10-like                   355   4e-117   
gb|KII92029.1|  hypothetical protein PLICRDRAFT_172184                  352   4e-117   Plicaturopsis crispa FD-325 SS-3
ref|XP_010262389.1|  PREDICTED: polyubiquitin                           355   4e-117   Nelumbo nucifera [Indian lotus]
gb|KDQ30621.1|  hypothetical protein PLEOSDRAFT_1088454                 352   4e-117   Pleurotus ostreatus PC15
gb|EJU00136.1|  ubiquitin                                               352   4e-117   Dacryopinax primogenitus
ref|XP_003196661.1|  ATP-dependent protein binding protein              352   4e-117   Cryptococcus gattii WM276
gb|EUC59758.1|  polyubiquitin                                           352   5e-117   Rhizoctonia solani AG-3 Rhs1AP
ref|XP_008350368.1|  PREDICTED: polyubiquitin                           355   5e-117   
ref|XP_002839703.1|  hypothetical protein                               349   5e-117   
gb|ACN40936.1|  unknown                                                 355   5e-117   
dbj|BAJ91912.1|  predicted protein                                      355   5e-117   
ref|XP_002842034.1|  hypothetical protein                               349   5e-117   
gb|KJB81827.1|  hypothetical protein B456_013G163500                    355   5e-117   
ref|XP_009784905.1|  PREDICTED: polyubiquitin-like isoform X1           355   5e-117   
dbj|BAP70433.1|  Ubiquitin                                              349   5e-117   
ref|XP_011094250.1|  PREDICTED: polyubiquitin-like                      355   5e-117   
gb|KDR85168.1|  hypothetical protein GALMADRAFT_131895                  352   5e-117   
ref|XP_007316637.1|  hypothetical protein SERLADRAFT_368035             352   5e-117   
ref|XP_008345409.1|  PREDICTED: polyubiquitin-like                      355   5e-117   
emb|CAB81074.1|  polyubiquitin (ubq10)                                  355   5e-117   
gb|AAC16012.1|  polyubiquitin                                           355   5e-117   
ref|XP_002551324.1|  ubiquitin                                          349   5e-117   
gb|AAC67552.1|  polyubiquitin                                           352   5e-117   
gb|ACJ85658.1|  unknown                                                 346   6e-117   
ref|XP_002888365.1|  polyubiquitin                                      355   6e-117   
gb|KIM40192.1|  hypothetical protein M413DRAFT_73842                    352   6e-117   
ref|XP_003010029.1|  polyubiquitin UbiD/Ubi4, putative                  346   6e-117   
gb|KIK17147.1|  hypothetical protein PISMIDRAFT_685607                  352   6e-117   
gb|AFR98116.1|  polyubiquitin                                           352   6e-117   
ref|XP_008796191.1|  PREDICTED: polyubiquitin-like                      349   6e-117   
ref|XP_007154492.1|  hypothetical protein PHAVU_003G123400g             351   6e-117   
ref|XP_001227036.1|  polyubiquitin                                      349   7e-117   
gb|KIM22018.1|  hypothetical protein M408DRAFT_333137                   346   7e-117   
ref|XP_008244357.1|  PREDICTED: polyubiquitin isoform X1                355   7e-117   
gb|EKV13151.1|  hypothetical protein PDIG_39650                         349   7e-117   
gb|KIJ68260.1|  hypothetical protein HYDPIDRAFT_173033                  352   7e-117   
gb|AGT38457.1|  polyubiquitin                                           355   7e-117   
ref|XP_007864655.1|  ubiquitin                                          352   8e-117   
ref|XP_002494205.1|  Ubiquitin                                          349   8e-117   
ref|XP_001880135.1|  ubiquitin                                          352   8e-117   
gb|AFW70219.1|  polyubiquitin-like protein                              356   8e-117   
gb|KIW56414.1|  polyubiquitin                                           348   9e-117   
ref|XP_002888394.1|  hexaubiquitin protein                              355   9e-117   
gb|AAV65292.1|  polyubiquitin                                           348   9e-117   
ref|XP_003350608.1|  hypothetical protein SMAC_07925                    346   9e-117   
ref|XP_001210780.1|  ubiquitin                                          348   9e-117   
gb|KEZ40313.1|  Polyubiquitin                                           348   9e-117   
gb|EGA57707.1|  Ubi4p                                                   347   1e-116   
gb|EEH07231.1|  ubiquitin                                               348   1e-116   
gb|EEH20847.2|  polyubiquitin                                           349   1e-116   
dbj|BAK61738.1|  ubiquitin                                              344   1e-116   
gb|EEQ88150.1|  ubiquitin                                               348   1e-116   
ref|XP_002419618.1|  ubiquitin, putative                                348   1e-116   
ref|XP_001266981.1|  polyubiquitin (UbiD), putative                     348   1e-116   
ref|XP_011038259.1|  PREDICTED: polyubiquitin-like                      348   1e-116   
ref|XP_010046742.1|  PREDICTED: polyubiquitin-like                      354   1e-116   
ref|XP_008441422.1|  PREDICTED: LOW QUALITY PROTEIN: polyubiquiti...    353   1e-116   
ref|XP_010756991.1|  polyubiquitin                                      348   1e-116   
sp|P0CG73.1|UBI1P_CANAX  RecName: Full=Polyubiquitin; Contains: R...    345   1e-116   
gb|AAA82978.1|  polyubiquitin                                           351   1e-116   
ref|XP_659604.1|  hypothetical protein AN2000.2                         349   2e-116   
gb|EPS29015.1|  hypothetical protein PDE_03961                          348   2e-116   
gb|KJB62486.1|  hypothetical protein B456_009G418900                    351   2e-116   
gb|AAO43306.1|  putative polyubiquitin                                  348   2e-116   
ref|XP_002791169.1|  ubiquitin                                          348   2e-116   
ref|XP_010451655.1|  PREDICTED: polyubiquitin 4-like                    356   2e-116   
ref|XP_002992907.1|  hypothetical protein SELMODRAFT_162680             350   2e-116   
gb|KJB62482.1|  hypothetical protein B456_009G418900                    350   2e-116   
gb|KIK81924.1|  hypothetical protein PAXRUDRAFT_736824                  345   2e-116   
tpd|FAA00317.1|  TPA: polyubiquitin                                     348   2e-116   
gb|AAO43310.1|  putative polyubiquitin                                  346   2e-116   
gb|AAY33920.2|  polyubiquitin                                           350   2e-116   
tpe|CBF85986.1|  TPA: Polyubiquitin Fragment [Source:UniProtKB/Tr...    348   2e-116   
ref|XP_002976481.1|  hypothetical protein SELMODRAFT_271198             350   2e-116   
gb|EZF98642.1|  polyubiquitin                                           345   2e-116   
emb|CCA16073.1|  polyubiquitin putative                                 356   2e-116   
gb|AGM32540.1|  polyubiquitin-B-like isoform                            346   2e-116   
gb|AEH41483.1|  ubiquitin                                               347   3e-116   
emb|CCG34086.1|  Polyubiquitin                                          347   3e-116   
dbj|GAA87419.1|  polyubiquitin                                          347   3e-116   
gb|AFW66445.1|  ubiquitin2                                              355   3e-116   
dbj|GAA27344.2|  polyubiquitin-A                                        347   3e-116   
ref|XP_006694532.1|  hypothetical protein CTHT_0041260                  347   3e-116   
ref|XP_001777816.1|  predicted protein                                  350   3e-116   
ref|XP_007808982.1|  ubiquitin                                          348   3e-116   
emb|CAA52290.1|  polyubiquitin                                          350   3e-116   
gb|EYU33611.1|  hypothetical protein MIMGU_mgv1a004315mg                355   3e-116   
emb|CDH08450.1|  ubiquitin and ubiquitin-like proteins                  347   3e-116   
gb|KIM30634.1|  hypothetical protein M408DRAFT_328170                   344   3e-116   
gb|AAC49013.1|  polyubiquitin containing 7 ubiquitin monomers           355   3e-116   
ref|XP_008645269.1|  PREDICTED: polyubiquitin                           355   3e-116   
gb|ABD32351.2|  Ubiquitin                                               355   3e-116   
ref|XP_004249885.1|  PREDICTED: polyubiquitin-like                      355   3e-116   
gb|ACB87916.1|  polyubiquitin 1                                         343   4e-116   
ref|XP_011037020.1|  PREDICTED: polyubiquitin-like                      350   4e-116   
emb|CAA51679.1|  ubiquitin                                              355   4e-116   
ref|XP_001538486.1|  polyubiquitin                                      347   4e-116   
ref|XP_003627151.1|  Ubiquitin                                          355   4e-116   
ref|XP_958803.1|  ubiquitin                                             347   4e-116   
ref|XP_009150698.1|  PREDICTED: polyubiquitin                           355   4e-116   
ref|XP_003607670.1|  Ubiquitin                                          355   4e-116   
ref|XP_006480550.1|  PREDICTED: polyubiquitin-A-like                    355   4e-116   
ref|XP_003542728.1|  PREDICTED: polyubiquitin-A-like isoform 1          355   4e-116   
gb|AAP80689.1|  polyubiquitin                                           345   4e-116   
gb|EYU18101.1|  hypothetical protein MIMGU_mgv1a004289mg                355   4e-116   
gb|KHJ83418.1|  ubiquitin family protein                                343   4e-116   
ref|XP_007410937.1|  hypothetical protein MELLADRAFT_87680              355   4e-116   
ref|XP_006350990.1|  PREDICTED: polyubiquitin-A-like                    355   4e-116   
dbj|BAL61084.1|  polyubiqutin                                           350   4e-116   
gb|EYU38681.1|  hypothetical protein MIMGU_mgv1a004304mg                355   4e-116   
ref|XP_003608276.1|  Ubiquitin                                          355   4e-116   
ref|XP_001246797.1|  polyubiquitin                                      347   4e-116   
ref|XP_010553005.1|  PREDICTED: polyubiquitin-like                      355   4e-116   
ref|XP_004505453.1|  PREDICTED: polyubiquitin-A-like                    355   4e-116   
ref|XP_003607667.1|  Multidrug resistance protein ABC transporter...    361   5e-116   
ref|XP_011388891.1|  putative ubiquitin                                 352   5e-116   
ref|XP_567862.1|  ATP-dependent protein binding protein                 352   5e-116   
ref|XP_005644220.1|  polyubiquitin                                      347   5e-116   
gb|AAF04147.1|  ubiquitin precursor                                     350   5e-116   
gb|AFD53810.1|  ubiquitin                                               345   5e-116   
ref|XP_007861169.1|  polyubiquitin                                      352   5e-116   
tpd|FAA00319.1|  TPA: polyubiquitin                                     352   5e-116   
ref|XP_004341200.1|  polyubiquitin, putative                            344   6e-116   
ref|NP_983342.1|  ACL062Cp                                              349   6e-116   
gb|EMS60894.1|  Polyubiquitin                                           352   6e-116   
ref|XP_011275993.1|  ubiquitin C                                        349   6e-116   
dbj|BAO38900.1|  ubiquitin                                              349   6e-116   
gb|KIY97628.1|  ubiquitin C                                             347   7e-116   
ref|XP_009618235.1|  PREDICTED: polyubiquitin-like isoform X1           355   7e-116   
gb|EMS24129.1|  ubiquitin C                                             344   7e-116   
gb|ETN78467.1|  ubiquitin family protein                                343   7e-116   
gb|ELR08709.1|  polyubiquitin                                           349   7e-116   
gb|KDR10312.1|  Ubiquitin                                               343   7e-116   
emb|CCA40372.1|  Ubiquitin cross-reactive protein                       349   8e-116   
gb|AAO43305.1|  putative polyubiquitin                                  347   8e-116   
dbj|GAA55031.1|  ubiquitin C                                            343   8e-116   
ref|XP_007307433.1|  polyubiquitin                                      352   8e-116   
tpd|FAA00316.1|  TPA: polyubiquitin                                     349   8e-116   
gb|AGM32487.1|  polyubiquitin-B-like isoform 1                          343   8e-116   
ref|NP_013061.1|  ubiquitin                                             349   8e-116   
ref|XP_002627625.1|  ubiquitin                                          349   8e-116   
ref|XP_003402310.1|  PREDICTED: polyubiquitin-B-like isoform 1          343   9e-116   
gb|EYC42800.1|  hypothetical protein Y032_0517g2809                     343   9e-116   
ref|XP_007545871.1|  PREDICTED: polyubiquitin-B isoform X2              344   9e-116   
ref|XP_453980.1|  hypothetical protein                                  349   9e-116   
ref|XP_008034069.1|  ubiquitin 10.1                                     352   9e-116   
ref|XP_002171731.1|  ubiquitin                                          349   9e-116   
ref|XP_002267017.1|  PREDICTED: polyubiquitin-like                      354   1e-115   
ref|XP_003675939.1|  hypothetical protein NCAS_0C05850                  349   1e-115   
gb|AEZ66647.1|  putative beta-1,6-glucanase                             348   1e-115   
gb|KDQ63803.1|  hypothetical protein JAAARDRAFT_29850                   352   1e-115   
emb|CAN71997.1|  hypothetical protein VITISV_004025                     354   1e-115   
gb|KFY77115.1|  hypothetical protein V499_03430                         348   1e-115   
ref|NP_595409.1|  ubiquitin                                             348   1e-115   
gb|EGE85556.1|  hypothetical protein BDDG_08501                         347   1e-115   
gb|AAL91103.1|  ubiquitin                                               344   1e-115   
ref|XP_008243902.1|  PREDICTED: polyubiquitin-like isoform X1           353   1e-115   
ref|XP_003843815.1|  hypothetical protein LEMA_P014660.1                349   1e-115   
gb|AAO43303.1|  putative polyubiquitin                                  346   1e-115   
ref|XP_010480024.1|  PREDICTED: polyubiquitin-like                      346   1e-115   
gb|AAO43304.1|  putative polyubiquitin                                  346   2e-115   
dbj|BAK61744.1|  ubiquitin                                              343   2e-115   
gb|ABV22331.1|  ubiquitin                                               345   2e-115   
emb|CDI53149.1|  probable Polyubiquitin protein                         345   2e-115   
dbj|BAH71115.1|  ACYPI006410                                            342   2e-115   
ref|XP_001766873.1|  predicted protein                                  347   2e-115   
ref|XP_006306291.1|  hypothetical protein CARUB_v10012156mg             351   2e-115   
gb|KFY10578.1|  hypothetical protein V492_04946                         350   2e-115   
ref|XP_002973843.1|  hypothetical protein SELMODRAFT_173723             350   2e-115   
ref|XP_003607659.1|  Ubiquitin                                          343   2e-115   
ref|XP_003331105.1|  polyubiquitin-A                                    355   2e-115   
ref|XP_001774326.1|  predicted protein                                  350   3e-115   
gb|KHN45015.1|  Polyubiquitin-A                                         355   3e-115   
gb|AES89856.2|  polyubiquitin 3                                         342   3e-115   
ref|XP_009620669.1|  PREDICTED: polyubiquitin-like                      355   3e-115   
gb|AAL91109.1|  ubiquitin                                               345   4e-115   
dbj|BAN21697.1|  ubiquitin                                              340   4e-115   
gb|EJD76734.1|  polyubiquitin, variant 2                                345   4e-115   
ref|XP_006352490.1|  PREDICTED: polyubiquitin-A-like isoform X1         355   4e-115   
gb|ADD24466.1|  Ubiquitin                                               342   4e-115   
ref|XP_005831810.1|  ubiquitin                                          342   4e-115   
emb|CAJ41447.1|  polyubiquitin                                          344   4e-115   
gb|ACB87918.1|  polyubiquitin 3                                         340   4e-115   
ref|XP_001983129.1|  GG19855                                            345   4e-115   
gb|KIJ26545.1|  hypothetical protein M422DRAFT_216245                   353   5e-115   
gb|EXX74853.1|  ubiquitin                                               340   5e-115   
ref|XP_011302492.1|  PREDICTED: polyubiquitin-B                         344   5e-115   
ref|NP_176714.4|  ubiquitin 13                                          345   5e-115   
ref|XP_002553736.1|  KLTH0E05852p                                       348   5e-115   
gb|AAC13691.1|  poly-ubiquitin                                          347   5e-115   
pir||T02358  ubiquitin homolog T8F5.13 - Arabidopsis thaliana           345   5e-115
ref|XP_004365491.1|  polyubiquitin 5                                    341   5e-115   
ref|XP_009609090.1|  PREDICTED: polyubiquitin 11                        339   6e-115   
gb|AGH70140.1|  ubiquitin family protein                                340   6e-115   
sp|P0CH27.1|RL402_TRYCR  RecName: Full=Ubiquitin-60S ribosomal pr...    346   6e-115   
gb|KIZ01427.1|  ubiquitin C                                             347   7e-115   
ref|XP_002498336.1|  ZYRO0G07854p                                       349   7e-115   
gb|KIH55346.1|  ubiquitin family protein                                347   7e-115   
emb|CAX71218.1|  polyubiquitin                                          340   7e-115   
ref|XP_011278194.1|  PREDICTED: polyubiquitin-B-like                    339   7e-115   
gb|ABI53721.1|  polyubiquitin                                           349   8e-115   
ref|XP_460488.1|  DEHA2F02816p                                          349   8e-115   
dbj|BAK61751.1|  ubiquitin                                              341   8e-115   
ref|XP_001486573.1|  ubiquitin                                          349   9e-115   
ref|XP_008816966.1|  polyubiquitin                                      343   9e-115   
ref|XP_002083532.1|  GD13313                                            339   9e-115   
ref|XP_626192.1|  polyubiquitin with 3 Ub domains                       341   9e-115   
ref|XP_011203306.1|  PREDICTED: polyubiquitin-B                         340   1e-114   
gb|EFN76024.1|  Ubiquitin                                               340   1e-114   
gb|KHN87823.1|  Polyubiquitin-A                                         340   1e-114   
gb|KHN74847.1|  Polyubiquitin-A                                         347   1e-114   
ref|XP_006285847.1|  hypothetical protein CARUB_v10007326mg             353   1e-114   
gb|EMS54972.1|  Polyubiquitin-A                                         355   1e-114   
ref|XP_011094688.1|  PREDICTED: polyubiquitin-like                      354   1e-114   
ref|XP_008632241.1|  PREDICTED: polyubiquitin-C isoform X10             339   1e-114   
ref|XP_008510526.1|  PREDICTED: polyubiquitin-B                         344   2e-114   
ref|XP_006593991.1|  PREDICTED: polyubiquitin 10-like isoform X3        355   2e-114   
tpg|DAA34473.1|  TPA: ubiquitin                                         340   2e-114   
emb|CAX76726.1|  polyubiquitin                                          340   2e-114   
ref|NP_568552.1|  polyubiquitin 9                                       343   2e-114   
ref|XP_002964737.1|  hypothetical protein SELMODRAFT_270468             350   2e-114   
emb|CAI83755.1|  Polyubiqutin 2                                         344   2e-114   
ref|XP_008426285.1|  PREDICTED: polyubiquitin-B isoform X1              341   2e-114   
emb|CDP08561.1|  unnamed protein product                                353   2e-114   
emb|CAA30815.1|  unnamed protein product                                339   2e-114   
ref|XP_003290908.1|  ubiquitin                                          340   2e-114   
ref|XP_004205544.1|  PREDICTED: polyubiquitin-B-like isoform 2          342   3e-114   
gb|ABO84843.1|  ubiquitin B                                             339   3e-114   



>ref|XP_003619702.1| Ubiquitin-like protein [Medicago truncatula]
Length=245

 Score =   359 bits (921),  Expect = 1e-121, Method: Compositional matrix adjust.
 Identities = 181/189 (96%), Positives = 183/189 (97%), Gaps = 0/189 (0%)
 Frame = +1

Query  46   RHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  225
            +H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  44   QHRSFQFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  103

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  104  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  163

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  164  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  223

Query  586  DTIDNVKGQ  612
            DTIDNVK +
Sbjct  224  DTIDNVKAK  232


 Score =   225 bits (573),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 117/129 (91%), Positives = 119/129 (92%), Gaps = 5/129 (4%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  117  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  171

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  172  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  231

Query  382  KIQDKEGIP  408
            KIQDKEGIP
Sbjct  232  KIQDKEGIP  240



>gb|AIS71924.1| polyubiquitin [Mangifera indica]
Length=229

 Score =   358 bits (918),  Expect = 2e-121, Method: Compositional matrix adjust.
 Identities = 191/230 (83%), Positives = 196/230 (85%), Gaps = 10/230 (4%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLH VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHRVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  QDPGQGXESPQISRXLSSPENSWEDG-------PHSCGLXHPERSRLFXW  738
            +   +    P   R + + +   EDG         SC L  PER R   W
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQ-LEDGRTGEVKETKSCRL--PERCRFLRW  227



>gb|AFC36452.1| ubiquitin, partial [Anoectochilus roxburghii]
Length=214

 Score =   356 bits (914),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  20   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  74

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  75   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  134

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  135  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  194

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  195  TITLEVESSDTIDNVKAK  212


 Score =   267 bits (683),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 134/136 (99%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +1

Query  205  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  384
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK
Sbjct  1    AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  60

Query  385  IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  564
            IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI
Sbjct  61   IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTI  120

Query  565  TLEVESSDTIDNVKGQ  612
            TLEVESSDTIDNVK +
Sbjct  121  TLEVESSDTIDNVKAK  136


 Score =   211 bits (537),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 110/124 (89%), Positives = 113/124 (91%), Gaps = 5/124 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  150

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  151  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  210

Query  379  AKIQ  390
            AKI+
Sbjct  211  AKIR  214



>gb|AGV54749.1| ubiquitin 11 [Phaseolus vulgaris]
Length=269

 Score =   358 bits (919),  Expect = 4e-121, Method: Compositional matrix adjust.
 Identities = 185/202 (92%), Positives = 188/202 (93%), Gaps = 4/202 (2%)
 Frame = +1

Query  19   CSLNL----FYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  186
            C+ NL    +    HS    KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD
Sbjct  20   CNYNLGRREYGSHFHSFKPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPD  79

Query  187  QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  366
            QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI
Sbjct  80   QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI  139

Query  367  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  140  DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  199

Query  547  LTGKTITLEVESSDTIDNVKGQ  612
            LTGKTITLEVESSDTIDNVK +
Sbjct  200  LTGKTITLEVESSDTIDNVKAK  221


 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 152/153 (99%), Positives = 152/153 (99%), Gaps = 0/153 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  117  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  176

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  177  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  236

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  237  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  269



>gb|ACA58351.1| ubiquitin-like protein [Sandersonia aurantiaca]
Length=189

 Score =   355 bits (910),  Expect = 8e-121, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   225 bits (573),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 117/130 (90%), Positives = 119/130 (92%), Gaps = 5/130 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIP  408
            AKIQDKEGIP
Sbjct  180  AKIQDKEGIP  189



>emb|CBI22349.3| unnamed protein product [Vitis vinifera]
Length=298

 Score =   358 bits (919),  Expect = 1e-120, Method: Compositional matrix adjust.
 Identities = 185/197 (94%), Positives = 186/197 (94%), Gaps = 1/197 (1%)
 Frame = +1

Query  25   LNLFYH-LRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            L LF   L H     KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  12   LALFVSVLVHQPFPFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  71

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  72   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  131

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  132  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  191

Query  562  ITLEVESSDTIDNVKGQ  612
            ITLEVESSDTIDNVK +
Sbjct  192  ITLEVESSDTIDNVKAK  208


 Score =   355 bits (910),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  92   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  146

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  147  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  206

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  207  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  266

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  267  TITLEVESSDTIDNVKAK  284


 Score =   220 bits (561),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 118/129 (91%), Gaps = 5/129 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  168  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  222

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  223  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  282

Query  379  AKIQDKEGI  405
            AKIQDKEG+
Sbjct  283  AKIQDKEGM  291



>gb|ABI84246.1| polyubiquitin 10 [Arachis hypogaea]
Length=192

 Score =   354 bits (908),  Expect = 2e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   232 bits (591),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/133 (90%), Positives = 122/133 (92%), Gaps = 5/133 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQ  417
            AKIQDKEGIPPDQ
Sbjct  180  AKIQDKEGIPPDQ  192



>gb|AEZ49160.1| polyubiquitin, partial [Wolffia australiana]
Length=281

 Score =   357 bits (915),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 182/188 (97%), Positives = 183/188 (97%), Gaps = 2/188 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            C  L  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  14   CGRLQSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  73

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  74   RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  133

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  588
            PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  134  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  193

Query  589  TIDNVKGQ  612
            TIDNVK +
Sbjct  194  TIDNVKAK  201


 Score =   353 bits (906),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEV SSDTIDNVK +
Sbjct  260  TITLEVASSDTIDNVKAK  277


 Score =   214 bits (544),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 112/126 (89%), Positives = 114/126 (90%), Gaps = 5/126 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV SSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVASSDTIDNVK  275

Query  379  AKIQDK  396
            AKIQDK
Sbjct  276  AKIQDK  281



>gb|AEW46688.1| polyubiquitin, partial [Ulva linza]
Length=226

 Score =   355 bits (910),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/167 (92%), Positives = 156/167 (93%), Gaps = 5/167 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  519
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLR  226



>gb|AFW66442.1| putative ubiquitin family protein, partial [Zea mays]
Length=216

 Score =   354 bits (908),  Expect = 3e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   280 bits (717),  Expect = 3e-91, Method: Compositional matrix adjust.
 Identities = 144/157 (92%), Positives = 146/157 (93%), Gaps = 5/157 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  489
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  216



>ref|XP_003626479.1| Ubiquitin-like protein [Medicago truncatula]
 gb|AES82697.1| polyubiquitin 3 [Medicago truncatula]
Length=277

 Score =   356 bits (914),  Expect = 4e-120, Method: Compositional matrix adjust.
 Identities = 180/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            +KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  47   IKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  106

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  107  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  166

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  167  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  226

Query  604  KGQ  612
            K +
Sbjct  227  KAK  229


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  114  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  168

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  169  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  228

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  229  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  277



>ref|XP_008358804.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like, partial 
[Malus domestica]
Length=260

 Score =   355 bits (911),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   352 bits (903),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 184/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT TGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTXTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLE ESSDTIDNVK +
Sbjct  240  TITLEXESSDTIDNVKAK  257



>ref|XP_002872746.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_002872769.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH49005.1| hypothetical protein ARALYDRAFT_911794 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49028.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=229

 Score =   354 bits (908),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (769),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_010931017.1| PREDICTED: polyubiquitin 11 isoform X1 [Elaeis guineensis]
 ref|XP_010931026.1| PREDICTED: polyubiquitin 11 isoform X2 [Elaeis guineensis]
 ref|XP_010923942.1| PREDICTED: polyubiquitin 11 [Elaeis guineensis]
Length=229

 Score =   354 bits (908),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   306 bits (785),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 157/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|AFP44113.1| ubiquitin, partial [Lycoris longituba]
Length=187

 Score =   352 bits (904),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVK 
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVKA  183

Query  610  Q  612
            +
Sbjct  184  K  184


 Score =   213 bits (541),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 111/125 (89%), Positives = 113/125 (90%), Gaps = 5/125 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEGSDTIDNVK  182

Query  379  AKIQD  393
            AKIQD
Sbjct  183  AKIQD  187


 Score =   211 bits (537),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 106/108 (98%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  108



>gb|AAO43307.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   355 bits (910),  Expect = 5e-120, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  184  TITLEVESSDTIDNVKAK  201


 Score =   304 bits (779),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  248


 Score =   245 bits (626),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQ  612
            NVK +
Sbjct  121  NVKAK  125



>gb|AET06143.1| ubiquitin [Papaver somniferum]
Length=229

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|EYU33610.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=229

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  229



>ref|XP_004968120.1| PREDICTED: polyubiquitin-like [Setaria italica]
 ref|XP_009404996.1| PREDICTED: polyubiquitin 11 [Musa acuminata subsp. malaccensis]
 gb|ABS18744.1| ubiqutin ligase-like protein [Oryza sativa Japonica Group]
 dbj|BAJ88219.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=229

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010490793.1| PREDICTED: polyubiquitin 11-like [Camelina sativa]
Length=230

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|ACJ85618.1| unknown [Medicago truncatula]
Length=229

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_009412006.1| PREDICTED: polyubiquitin 11-like [Musa acuminata subsp. malaccensis]
Length=231

 Score =   354 bits (908),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 180/180 (100%), Gaps = 0/180 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180


 Score =   272 bits (696),  Expect = 8e-88, Method: Compositional matrix adjust.
 Identities = 143/169 (85%), Positives = 145/169 (86%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV 
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVX  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
                        QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  182  XXXXXXXXXXXXQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  230


 Score =   205 bits (521),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 103/105 (98%), Positives = 104/105 (99%), Gaps = 0/105 (0%)
 Frame = +1

Query  298  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  477
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  3    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  62

Query  478  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  63   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  107



>ref|XP_007154494.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26488.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=193

 Score =   352 bits (904),  Expect = 6e-120, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   232 bits (592),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 123/134 (92%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  180  AKIQDKEGIPPDQQ  193



>dbj|BAC57955.1| polyubiquitin [Aster tripolium]
Length=229

 Score =   354 bits (908),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  229



>gb|AAP31578.1| ubiquitin [Hevea brasiliensis]
Length=230

 Score =   354 bits (908),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002317213.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ABK95814.1| unknown [Populus trichocarpa]
 gb|EEE97825.1| polyubiquitin family protein [Populus trichocarpa]
Length=229

 Score =   353 bits (907),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  229



>ref|XP_006288299.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21197.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=230

 Score =   354 bits (908),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|NP_567286.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_849291.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001031585.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|NP_567247.2| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118936.1| ubiquitin 11 [Arabidopsis thaliana]
 ref|XP_002305607.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006370636.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_007157173.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 ref|XP_007211604.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211605.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_007211608.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008349294.1| PREDICTED: polyubiquitin 11 [Malus domestica]
 ref|XP_010437606.1| PREDICTED: polyubiquitin 11 isoform X1 [Camelina sativa]
 ref|XP_010437607.1| PREDICTED: polyubiquitin 11 isoform X2 [Camelina sativa]
 ref|XP_010491428.1| PREDICTED: polyubiquitin 11 [Camelina sativa]
 sp|P0CH33.1|UBQ11_ARATH RecName: Full=Polyubiquitin 11; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 gb|AAD48980.1|AF162444_12 contains similarity to Pfam family PF00240 - Ubiquitin family; 
score=526.5, E=1.9e-154, N=3 [Arabidopsis thaliana]
 emb|CAA10056.1| polyubiquitin [Vicia faba]
 emb|CAB81047.1| AT4g05050 [Arabidopsis thaliana]
 emb|CAC27335.1| putative polyubiquitin [Picea abies]
 gb|AAK96565.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL06940.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAL09770.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAM19968.1| AT4g05050/T32N4_13 [Arabidopsis thaliana]
 gb|AAN65052.1| Unknown protein [Arabidopsis thaliana]
 gb|AAV92464.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92465.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92466.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92467.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92468.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92469.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92470.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92471.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92472.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92473.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92474.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92475.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92476.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92477.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92478.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92479.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92480.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92481.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92482.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92483.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92484.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92485.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92486.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92487.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92488.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92489.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 gb|AAV92490.1| polyubiquitin [Pseudotsuga menziesii var. menziesii]
 dbj|BAE98552.1| hypothetical protein [Arabidopsis thaliana]
 gb|EEE86118.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|AEE82244.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82245.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82468.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82469.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AEE82470.1| ubiquitin 11 [Arabidopsis thaliana]
 gb|AFP43343.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12803.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12804.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12807.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|AGV54265.1| ubiquitin 11 [Phaseolus vulgaris]
 gb|ERP67205.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESW29167.1| hypothetical protein PHAVU_002G048800g [Phaseolus vulgaris]
 gb|AES82698.2| polyubiquitin 3 [Medicago truncatula]
 gb|AJA29686.1| polyubiquitin Ubi4 [Betula luminifera]
 gb|KJB67136.1| hypothetical protein B456_010G177000 [Gossypium raimondii]
 gb|KJB69250.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69251.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 gb|KJB69252.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
Length=229

 Score =   353 bits (907),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_007154493.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
 gb|ESW26487.1| hypothetical protein PHAVU_003G123500g [Phaseolus vulgaris]
Length=429

 Score =   361 bits (926),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 185/200 (93%), Positives = 188/200 (94%), Gaps = 1/200 (1%)
 Frame = +1

Query  16   ICSLNLFYHLRHS-CSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  192
              +L    H+ H   S LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ
Sbjct  30   FIALFFISHIFHRFISPLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  89

Query  193  RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  372
            RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN
Sbjct  90   RLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN  149

Query  373  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  552
            VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT
Sbjct  150  VKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLT  209

Query  553  GKTITLEVESSDTIDNVKGQ  612
            GKTITLEVESSDTIDNVK +
Sbjct  210  GKTITLEVESSDTIDNVKAK  229


 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  113  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  167

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  168  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  227

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  228  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  287

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  288  TITLEVESSDTIDNVKAK  305


 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  189  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  243

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  244  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  303

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  304  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  363

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  364  TITLEVESSDTIDNVKAK  381


 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  265  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  319

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  320  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  379

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  380  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  429



>gb|KJB36627.1| hypothetical protein B456_006G167800 [Gossypium raimondii]
Length=229

 Score =   353 bits (907),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_002438839.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
 gb|EER90206.1| hypothetical protein SORBIDRAFT_10g027030 [Sorghum bicolor]
Length=229

 Score =   353 bits (907),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK+STLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGG  228



>gb|KDO51109.1| hypothetical protein CISIN_1g026973mg [Citrus sinensis]
Length=230

 Score =   353 bits (907),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007205619.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06818.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=232

 Score =   354 bits (908),  Expect = 7e-120, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   296 bits (758),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/166 (92%), Positives = 154/166 (93%), Gaps = 5/166 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRL  516
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLR 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRF  225



>ref|XP_006428822.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
 ref|XP_006480632.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 ref|XP_006480634.1| PREDICTED: polyubiquitin 4-like [Citrus sinensis]
 gb|ESR42062.1| hypothetical protein CICLE_v10012652mg [Citrus clementina]
Length=230

 Score =   353 bits (907),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGR LADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRNLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006428779.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 ref|XP_006594132.1| PREDICTED: polyubiquitin-like [Glycine max]
 gb|ESR42019.1| hypothetical protein CICLE_v10012654mg [Citrus clementina]
 gb|KDO45140.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KDO45141.1| hypothetical protein CISIN_1g0269401mg [Citrus sinensis]
 gb|KHN48309.1| Polyubiquitin [Glycine soja]
Length=230

 Score =   353 bits (907),  Expect = 8e-120, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KDO51955.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
 gb|KDO51956.1| hypothetical protein CISIN_1g026932mg [Citrus sinensis]
Length=230

 Score =   353 bits (907),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAD27944.1| polyubiquitin-like [Oryza sativa]
Length=219

 Score =   353 bits (905),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 178/180 (99%), Positives = 179/180 (99%), Gaps = 0/180 (0%)
 Frame = +1

Query  73   QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  252
            QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  2    QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  61

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  62   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  121

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  122  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  181


 Score =   272 bits (696),  Expect = 4e-88, Method: Compositional matrix adjust.
 Identities = 142/160 (89%), Positives = 145/160 (91%), Gaps = 5/160 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            AKIQDKEGI    +RLIFAGKQLEDGRTLADYNIQKESTL
Sbjct  180  AKIQDKEGIHQTSKRLIFAGKQLEDGRTLADYNIQKESTL  219



>ref|XP_006370634.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67203.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
Length=261

 Score =   355 bits (910),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/194 (93%), Positives = 183/194 (94%), Gaps = 5/194 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDN  600
            TITLEVESSDTIDN
Sbjct  240  TITLEVESSDTIDN  253



>gb|AIZ74335.1| polyubiquitin 3, partial [Pinus massoniana]
Length=244

 Score =   354 bits (908),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 185/196 (94%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  54   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  108

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  109  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  168

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  169  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  228

Query  559  TITLEVESSDTIDNVK  606
            TITLEVE+SDTIDNVK
Sbjct  229  TITLEVENSDTIDNVK  244


 Score =   332 bits (852),  Expect = 3e-111, Method: Compositional matrix adjust.
 Identities = 167/170 (98%), Positives = 169/170 (99%), Gaps = 0/170 (0%)
 Frame = +1

Query  103  TITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  282
            TITLE+ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL
Sbjct  1    TITLELESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  60

Query  283  RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  462
            RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT
Sbjct  61   RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRT  120

Query  463  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  LADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  170



>emb|CAH59739.1| polyubiquitin [Plantago major]
Length=232

 Score =   353 bits (906),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-100, Method: Compositional matrix adjust.
 Identities = 157/173 (91%), Positives = 160/173 (92%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+  F
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGLTGF  232



>emb|CCO30833.1| Polyubiquitin [Rhizoctonia solani AG-1 IB]
Length=413

 Score =   360 bits (923),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 184/203 (91%), Positives = 190/203 (94%), Gaps = 5/203 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  193  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  247

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  248  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  307

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  308  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  367

Query  559  TITLEVESSDTIDNVKGQDPGQG  627
            TITLEVESSDTIDN +G+DP QG
Sbjct  368  TITLEVESSDTIDNCQGEDPRQG  390


 Score =   352 bits (903),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  117  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  171

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  172  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  231

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  232  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  291

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  292  TITLEVESSDTIDNVKAK  309


 Score =   327 bits (838),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 177/233 (76%), Positives = 180/233 (77%), Gaps = 52/233 (22%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ-----------  216
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ           
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  217  -----------------------------------------LEDGRTLADYNIQKESTLH  273
                                                     LEDGRTL+DYNIQKESTLH
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNLEDGRTLSDYNIQKESTLH  120

Query  274  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  453
            LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED
Sbjct  121  LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLED  180

Query  454  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  181  GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  233


 Score =   201 bits (512),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 112/130 (86%), Gaps = 5/130 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  269  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  323

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN +
Sbjct  324  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNCQ  383

Query  379  AKIQDKEGIP  408
             +   + G P
Sbjct  384  GEDPRQGGYP  393



>ref|XP_010235843.1| PREDICTED: polyubiquitin 11 isoform X1 [Brachypodium distachyon]
Length=265

 Score =   354 bits (909),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/199 (92%), Positives = 185/199 (93%), Gaps = 5/199 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +C L  F   R       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  12   MCDLEDFLECRKM-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  66

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  67   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  126

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  127  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  186

Query  556  KTITLEVESSDTIDNVKGQ  612
            KTITLEVESSDTIDNVK +
Sbjct  187  KTITLEVESSDTIDNVKAK  205


 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/168 (93%), Positives = 158/168 (94%), Gaps = 5/168 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  90   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  144

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  145  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  204

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  205  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  252



>gb|ABY60454.1| putative polyubiquitin [Adonis aestivalis var. palaestina]
Length=281

 Score =   355 bits (910),  Expect = 1e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  251  TITLEVESSDTIDNVKAK  268


 Score =   355 bits (910),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 186/197 (94%), Gaps = 5/197 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  1    TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  55

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  56   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  115

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  116  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  175

Query  562  ITLEVESSDTIDNVKGQ  612
            ITLEVESSDTIDNVK +
Sbjct  176  ITLEVESSDTIDNVKAK  192


 Score =   236 bits (602),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 124/135 (92%), Gaps = 5/135 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQR  423
            AKIQDKEGIPPDQQR
Sbjct  267  AKIQDKEGIPPDQQR  281



>gb|AFK41706.1| unknown [Medicago truncatula]
 gb|AES60745.2| pentameric polyubiquitin [Medicago truncatula]
Length=233

 Score =   353 bits (905),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_007512209.1| polyubiquitin [Bathycoccus prasinos]
 emb|CCO66297.1| polyubiquitin [Bathycoccus prasinos]
Length=359

 Score =   357 bits (917),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  116  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  170

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  171  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  230

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  231  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  290

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  291  TITLEVESSDTIDNVKAK  308


 Score =   333 bits (854),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 179/232 (77%), Positives = 180/232 (78%), Gaps = 51/232 (22%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG-------------------------  174
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG                         
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGTFRVKSRRLKFCLLALLDSATTIES  60

Query  175  --------------------------IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
                                      IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  61   SLALRSKKSSERREREKESALSRARGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  120

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  121  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  180

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  181  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  232


 Score =   306 bits (784),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  192  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  246

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  247  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  306

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  307  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  355



>ref|XP_007154495.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
 gb|ESW26489.1| hypothetical protein PHAVU_003G1236001g, partial [Phaseolus vulgaris]
Length=269

 Score =   354 bits (909),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (906),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   233 bits (593),  Expect = 7e-72, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 123/134 (92%), Gaps = 5/134 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQ  420
            AKIQDKEGIPPDQQ
Sbjct  256  AKIQDKEGIPPDQQ  269



>emb|CAC94926.1| putative ubiquitin [Pleurotus sp. 'Florida']
Length=243

 Score =   353 bits (906),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  46   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  100

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  101  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  160

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  161  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  220

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  221  TITLEVESSDTIDNVKAR  238


 Score =   317 bits (813),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 158/162 (98%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +1

Query  127  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  306
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQI
Sbjct  1    SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQI  60

Query  307  FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  486
            FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  61   FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  120

Query  487  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  162



>gb|AIY27743.1| polyubiquitin Ubi10, partial [Betula luminifera]
Length=330

 Score =   356 bits (914),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 187/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  63   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  117

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK
Sbjct  118  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVK  177

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  178  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  237

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  238  TITLEVESSDTIDNVKAK  255


 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 181/197 (92%), Positives = 185/197 (94%), Gaps = 5/197 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFV+TLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  139  STLHLVLRLRGG-----MQIFVRTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  193

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  194  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  253

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  254  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  313

Query  559  TITLEVESSDTIDNVKG  609
            TITLEVESSDTIDNVK 
Sbjct  314  TITLEVESSDTIDNVKA  330


 Score =   326 bits (835),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 168/181 (93%), Positives = 172/181 (95%), Gaps = 2/181 (1%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVK L  KTITLEV+    IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVK-LYSKTITLEVKLRH-IDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  58

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  59   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  118

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFV+TLTGKTITLEVESSDT+DNVK 
Sbjct  119  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVRTLTGKTITLEVESSDTVDNVKA  178

Query  610  Q  612
            +
Sbjct  179  K  179



>gb|KJB62484.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=229

 Score =   352 bits (904),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|EPS72031.1| polyubiquitin, partial [Genlisea aurea]
Length=274

 Score =   354 bits (908),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  34   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  88

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  89   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  148

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  149  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  208

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  209  TITLEVESSDTIDNVKAK  226


 Score =   303 bits (777),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  110  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  164

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  165  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  224

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  225  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  274


 Score =   296 bits (757),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 148/150 (99%), Positives = 149/150 (99%), Gaps = 0/150 (0%)
 Frame = +1

Query  163  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  342
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  1    DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  60

Query  343  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  61   EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  120

Query  523  GMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            GMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  GMQIFVKTLTGKTITLEVESSDTIDNVKAK  150



>gb|ACJ85643.1| unknown [Medicago truncatula]
Length=229

 Score =   352 bits (904),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQNKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_003627152.1| Ubiquitin [Medicago truncatula]
 gb|KEH18411.1| polyubiquitin 3 [Medicago truncatula]
Length=270

 Score =   354 bits (908),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   333 bits (855),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 172/185 (93%), Positives = 174/185 (94%), Gaps = 5/185 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLE  573
            TITLE
Sbjct  240  TITLE  244


 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 80/135 (59%), Positives = 82/135 (61%), Gaps = 46/135 (34%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQK----------------------------------------  258
            IFAGKQLEDGRTLADYNIQK                                        
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEDGRTLADYNIQ  255

Query  259  -ESTLHLVLRLRGGM  300
             ESTLHLVLRLRGG 
Sbjct  256  KESTLHLVLRLRGGF  270



>ref|XP_009112898.1| PREDICTED: polyubiquitin [Brassica rapa]
Length=305

 Score =   355 bits (911),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|NP_001147027.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|ACG25128.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
Length=311

 Score =   355 bits (912),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 180/182 (99%), Positives = 181/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  82   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  141

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  607  GQ  612
             +
Sbjct  262  AK  263


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  147  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  201

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  202  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  261

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  262  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  310


 Score =   299 bits (765),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 160/189 (85%), Positives = 163/189 (86%), Gaps = 10/189 (5%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L    
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRNLIFSP  60

Query  250  IQKESTLHLVLR--------LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
              + +  H             R  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  61   FARNA--HTARSPISDPRSPRRSKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  118

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  119  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  178

Query  586  DTIDNVKGQ  612
            DTIDNVK +
Sbjct  179  DTIDNVKAK  187



>ref|XP_006377830.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55627.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
Length=297

 Score =   355 bits (910),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   281 bits (718),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 144/158 (91%), Positives = 147/158 (93%), Gaps = 5/158 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKES  492
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKEN  293



>ref|XP_003607669.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=448

 Score =   360 bits (925),  Expect = 2e-119, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EVESSDTIDNVKGQ  612
            EVESSDTIDNVK +
Sbjct  387  EVESSDTIDNVKAK  400


 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  447



>gb|AAC35858.1| polyubiquitin [Capsicum chinense]
Length=265

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 185/196 (94%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  25   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  79

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  80   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  139

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  140  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  199

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  200  TITLEVESSDTIDNVK  215


 Score =   302 bits (773),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  216  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  265


 Score =   276 bits (706),  Expect = 8e-89, Method: Compositional matrix adjust.
 Identities = 139/141 (99%), Positives = 140/141 (99%), Gaps = 0/141 (0%)
 Frame = +1

Query  190  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  369
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  1    QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  60

Query  370  NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  549
            NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL
Sbjct  61   NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTL  120

Query  550  TGKTITLEVESSDTIDNVKGQ  612
            TGKTITLEVESSDTIDNVK +
Sbjct  121  TGKTITLEVESSDTIDNVKAK  141



>ref|XP_007014924.1| Polyubiquitin 3 [Theobroma cacao]
 gb|EOY32543.1| Polyubiquitin 3 [Theobroma cacao]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>prf||1604470A poly-ubiquitin
Length=272

 Score =   354 bits (908),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  32   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  86

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  87   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  146

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  147  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  206

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  207  TITLEVESSDTIDNVKAK  224


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  271


 Score =   290 bits (742),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 145/147 (99%), Positives = 146/147 (99%), Gaps = 0/147 (0%)
 Frame = +1

Query  172  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  351
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  2    GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  61

Query  352  SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  531
            SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ
Sbjct  62   SSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQ  121

Query  532  IFVKTLTGKTITLEVESSDTIDNVKGQ  612
            IFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  122  IFVKTLTGKTITLEVESSDTIDNVKAK  148



>gb|EYU33609.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
 gb|EYU33612.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  305



>ref|XP_007211606.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EMJ12805.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
Length=309

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  303



>ref|XP_009114489.1| PREDICTED: polyubiquitin-like [Brassica rapa]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPQDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|ABK94002.1| unknown [Populus trichocarpa]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD N
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADNN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_007205620.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 ref|XP_007205621.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06819.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
 gb|EMJ06820.1| hypothetical protein PRUPE_ppa009116mg [Prunus persica]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002456845.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 ref|XP_002453347.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 ref|XP_003574869.1| PREDICTED: polyubiquitin [Brachypodium distachyon]
 ref|XP_007695807.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_009412665.1| PREDICTED: polyubiquitin isoform X1 [Musa acuminata subsp. malaccensis]
 ref|XP_009412666.1| PREDICTED: polyubiquitin isoform X2 [Musa acuminata subsp. malaccensis]
 ref|XP_010227192.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 sp|P69309.2|UBIQP_AVEFA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Avena fatua]
 pir||S28426 polyubiquitin 4 - wild oat
 emb|CAA49200.1| tetraubiquitin [Avena fatua]
 gb|AAC37466.1| polyubiquitin [Saccharum hybrid cultivar H65-7052]
 gb|AAM28291.1| tetrameric ubiquitin [Ananas comosus]
 gb|EES01965.1| hypothetical protein SORBIDRAFT_03g043940 [Sorghum bicolor]
 gb|EES06323.1| hypothetical protein SORBIDRAFT_04g004280 [Sorghum bicolor]
 gb|AEE65379.1| ubiquitin 1 [Panicum virgatum]
 gb|EMD68114.1| hypothetical protein COCSADRAFT_108224 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93446.1| hypothetical protein COCHEDRAFT_1202381 [Bipolaris maydis C5]
 gb|EMS58836.1| Polyubiquitin [Triticum urartu]
 gb|ENI07106.1| hypothetical protein COCC4DRAFT_70576 [Bipolaris maydis ATCC 
48331]
 gb|AGT16802.1| polyubiquitin-like protein [Saccharum hybrid cultivar R570]
 gb|EUN28034.1| hypothetical protein COCVIDRAFT_96666 [Bipolaris victoriae FI3]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CAA48140.1| ubiquitin [Antirrhinum majus]
Length=296

 Score =   355 bits (910),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  56   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  110

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  111  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  170

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  171  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  230

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  231  TITLEVESSDTIDNVKAK  248


 Score =   337 bits (863),  Expect = 4e-112, Method: Compositional matrix adjust.
 Identities = 170/172 (99%), Positives = 171/172 (99%), Gaps = 0/172 (0%)
 Frame = +1

Query  97   GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  276
            GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL
Sbjct  1    GKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHL  60

Query  277  VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  456
            VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  61   VLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  120

Query  457  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  172


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  132  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  186

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  187  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  246

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  247  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  296



>gb|ABD96088.1| polyubiquitin [Malus domestica]
Length=270

 Score =   353 bits (907),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  205  TITLEVESSDTIDNVKAK  222


 Score =   303 bits (776),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  270


 Score =   288 bits (736),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 144/146 (99%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEVESSDTIDNVKGQ  612
            FVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAK  146



>ref|XP_006654612.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   303 bits (776),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQL+DGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLDDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CDP08569.1| unnamed protein product [Coffea canephora]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|NP_851029.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_568112.2| polyubiquitin 3 [Arabidopsis thaliana]
 ref|NP_001031824.1| polyubiquitin 3 [Arabidopsis thaliana]
 ref|XP_006288303.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
 ref|XP_009122723.1| PREDICTED: polyubiquitin 3 [Brassica rapa]
 sp|Q1EC66.1|UBQ3_ARATH RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAB86091.1| polyubiquitin (ubq3) [Arabidopsis thaliana]
 dbj|BAB08384.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAO00780.1| polyubiquitin (UBQ3) [Arabidopsis thaliana]
 gb|ABF85770.1| At5g03240 [Arabidopsis thaliana]
 dbj|BAH19791.1| AT5G03240 [Arabidopsis thaliana]
 gb|AED90574.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90575.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|AED90576.1| polyubiquitin 3 [Arabidopsis thaliana]
 gb|EOA21201.1| hypothetical protein CARUB_v10001548mg [Capsella rubella]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AES89866.2| polyubiquitin 3 [Medicago truncatula]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|BAJ85978.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ91581.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (905),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003590494.1| Ubiquitin [Medicago truncatula]
Length=312

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 152/152 (100%), Positives = 152/152 (100%), Gaps = 0/152 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  77   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  136

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  137  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAA40323.1| polyubiquitin protein [Helianthus annuus]
Length=334

 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   356 bits (913),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   355 bits (911),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   211 bits (536),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 110/123 (89%), Positives = 112/123 (91%), Gaps = 5/123 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKI  387
            AKI
Sbjct  332  AKI  334



>ref|NP_849292.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_001118922.1| polyubiquitin 14 [Arabidopsis thaliana]
 ref|NP_974516.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_002316978.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_002874829.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_004146845.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004165599.1| PREDICTED: polyubiquitin-like [Cucumis sativus]
 ref|XP_004293260.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_006383941.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 ref|XP_006377831.1| polyubiquitin family protein [Populus trichocarpa]
 ref|XP_006377832.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377833.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372945.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 ref|XP_006396614.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396615.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006589609.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_006593990.1| PREDICTED: polyubiquitin 10-like isoform X2 [Glycine max]
 ref|XP_006606032.1| PREDICTED: polyubiquitin [Glycine max]
 ref|XP_007211603.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008454542.1| PREDICTED: polyubiquitin [Cucumis melo]
 ref|XP_009134330.1| PREDICTED: polyubiquitin [Brassica rapa]
 ref|XP_010422419.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_011007895.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011010177.1| PREDICTED: polyubiquitin [Populus euphratica]
 sp|P69325.2|UBIQP_SOYBN RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Glycine max]
 sp|Q3E7T8.2|UBQ14_ARATH RecName: Full=Polyubiquitin 14; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 pir||S49332 polyubiquitin 4 - common sunflower
 pir||G85036 polyubiquitin [imported] - Arabidopsis thaliana
 dbj|BAA03764.1| ubiquitin [Glycine max]
 dbj|BAA05670.1| ubiquitin [Glycine max]
 emb|CAA84440.1| seed tetraubiquitin [Helianthus annuus]
 dbj|BAA05085.1| Ubiquitin [Glycine max]
 gb|AAD15340.1| putative polyubiquitin [Arabidopsis thaliana]
 emb|CAB77774.1| polyubiquitin [Arabidopsis thaliana]
 gb|AAM65295.1| polyubiquitin (UBQ14) [Arabidopsis thaliana]
 emb|CAH59738.1| polyubiquitin [Plantago major]
 dbj|BAH19554.1| AT4G02890 [Arabidopsis thaliana]
 gb|EEE97590.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|EFH51088.1| hypothetical protein ARALYDRAFT_490155 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AEE82246.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82247.1| polyubiquitin 14 [Arabidopsis thaliana]
 gb|AEE82503.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AFP43341.1| polyubiquitin [Arabidopsis thaliana]
 gb|EMJ12802.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|ERP50742.1| hypothetical protein POPTR_0017s06450g [Populus trichocarpa]
 gb|ERP55628.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP55629.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55630.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP61738.1| hypothetical protein POPTR_0004s02080g [Populus trichocarpa]
 gb|ESQ38067.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38068.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 dbj|BAO57270.1| ubiquitin 10 [Ipomoea nil]
 gb|KHN02680.1| Polyubiquitin [Glycine soja]
 gb|KHN15806.1| Polyubiquitin [Glycine soja]
 gb|KJB13594.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB69249.1| hypothetical protein B456_011G016600 [Gossypium raimondii]
 prf||2111434A tetraubiquitin
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_011468094.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>sp|P69315.2|UBIQP_LINUS RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Contains: RecName: Full=Ubiquitin-related; Flags: Precursor, 
partial [Linum usitatissimum]
 gb|AAA33401.1| ubiquitin, partial [Linum usitatissimum]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  281  TITLEVESSDTIDNVKAK  298


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFLKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  205  TITLEVESSDTIDNVKAK  222


 Score =   287 bits (735),  Expect = 9e-93, Method: Compositional matrix adjust.
 Identities = 143/146 (98%), Positives = 145/146 (99%), Gaps = 0/146 (0%)
 Frame = +1

Query  175  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  354
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVES
Sbjct  1    IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFLKTLTGKTITLEVES  60

Query  355  SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI
Sbjct  61   SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  120

Query  535  FVKTLTGKTITLEVESSDTIDNVKGQ  612
            FVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  FVKTLTGKTITLEVESSDTIDNVKAK  146


 Score =   221 bits (564),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 116/129 (90%), Positives = 118/129 (91%), Gaps = 5/129 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGI  405
            AKIQDKEGI
Sbjct  297  AKIQDKEGI  305



>ref|XP_006396611.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 gb|AAL27563.1|AF429429_1 polyubiquitin OUB1 [Olea europaea]
 gb|ESQ38064.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=305

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_010258950.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  305



>ref|XP_006480631.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
Length=306

 Score =   355 bits (911),  Expect = 3e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003537278.1| PREDICTED: polyubiquitin-like [Glycine max]
 ref|XP_010454744.1| PREDICTED: polyubiquitin 3 [Camelina sativa]
 gb|KHN39094.1| Polyubiquitin [Glycine soja]
Length=306

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002873083.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49342.1| hypothetical protein ARALYDRAFT_487095 [Arabidopsis lyrata subsp. 
lyrata]
Length=306

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLTDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006302387.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35285.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=307

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_003574865.1| PREDICTED: polyubiquitin-like [Brachypodium distachyon]
Length=341

 Score =   356 bits (914),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 180/182 (99%), Positives = 181/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  36   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  95

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  96   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  607  GQ  612
             +
Sbjct  216  AK  217


 Score =   355 bits (912),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  101  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  155

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  156  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  215

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  216  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  275

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  276  TITLEVESSDTIDNVKAK  293


 Score =   305 bits (780),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  177  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  231

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  232  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  291

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  292  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  340



>emb|CAH59740.1| polyubiquitin [Plantago major]
Length=305

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KJB81823.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=305

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_010227188.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=339

 Score =   356 bits (913),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 4/199 (2%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +  + LF+H +       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  21   VGRVELFFHGQRGG----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  76

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  77   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  136

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  137  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  196

Query  556  KTITLEVESSDTIDNVKGQ  612
            KTITLEVESSDTIDNVK +
Sbjct  197  KTITLEVESSDTIDNVKAK  215


 Score =   354 bits (909),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  274  TITLEVESSDTIDNVKAK  291


 Score =   304 bits (778),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>ref|XP_006428925.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
 gb|ESR42165.1| hypothetical protein CICLE_v10012291mg [Citrus clementina]
Length=306

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_006428821.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
 ref|XP_006480633.1| PREDICTED: polyubiquitin-like [Citrus sinensis]
 gb|ESR42061.1| hypothetical protein CICLE_v10012292mg [Citrus clementina]
Length=306

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002872805.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49064.1| hypothetical protein ARALYDRAFT_490270 [Arabidopsis lyrata subsp. 
lyrata]
Length=309

 Score =   355 bits (910),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181



>gb|KDP39203.1| hypothetical protein JCGZ_00960 [Jatropha curcas]
Length=317

 Score =   355 bits (911),  Expect = 4e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   311 bits (796),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 159/173 (92%), Positives = 161/173 (93%), Gaps = 5/173 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIF  537
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIL  308



>ref|XP_008784557.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 11-like [Phoenix 
dactylifera]
Length=229

 Score =   352 bits (902),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVXRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVXRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>emb|CAA54603.1| pentameric polyubiquitin [Nicotiana tabacum]
Length=346

 Score =   356 bits (913),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 189/212 (89%), Positives = 193/212 (91%), Gaps = 8/212 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQDPGQGXES-PQISR  651
            TITLEVESSDTIDNVK +   Q  E  P+ISR
Sbjct  316  TITLEVESSDTIDNVKAKI--QDKEGIPRISR  345


 Score =   355 bits (912),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181



>ref|XP_006428820.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
 gb|ESR42060.1| hypothetical protein CICLE_v10012290mg [Citrus clementina]
Length=306

 Score =   355 bits (910),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQHKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAQ84316.1| fiber polyubiquitin [Gossypium barbadense]
Length=229

 Score =   352 bits (902),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (768),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL LVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLPLVLRLRGGF  229



>gb|AGV54228.1| polyubiquitin-like protein [Phaseolus vulgaris]
Length=381

 Score =   357 bits (917),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 182/190 (96%), Positives = 185/190 (97%), Gaps = 2/190 (1%)
 Frame = +1

Query  49   HSCSYLK--MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  222
            H  S+L+  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE
Sbjct  144  HLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLE  203

Query  223  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  402
            DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG
Sbjct  204  DGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEG  263

Query  403  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  582
            IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES
Sbjct  264  IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES  323

Query  583  SDTIDNVKGQ  612
            SDTIDNVK +
Sbjct  324  SDTIDNVKAK  333


 Score =   349 bits (895),  Expect = 9e-116, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 184/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   348 bits (892),  Expect = 2e-115, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLV  LRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVSWLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|KDP38838.1| hypothetical protein JCGZ_04995 [Jatropha curcas]
Length=308

 Score =   354 bits (909),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CBY46745.1| polyubiquitin 10 protein, partial [Lepidium appelianum]
Length=308

 Score =   354 bits (909),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  68   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  122

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  123  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  182

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  183  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  242

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  243  TITLEVESSDTIDNVKAK  260


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  4    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  63

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  64   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  123

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  124  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  183

Query  610  Q  612
            +
Sbjct  184  K  184


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  144  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  258

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  259  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  308


 Score =   211 bits (536),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 106/108 (98%), Positives = 107/108 (99%), Gaps = 0/108 (0%)
 Frame = +1

Query  289  RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  468
            RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA
Sbjct  1    RGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLA  60

Query  469  DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  61   DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  108



>gb|KIM78989.1| hypothetical protein PILCRDRAFT_573034 [Piloderma croceum F 1598]
Length=229

 Score =   352 bits (902),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_003570150.1| PREDICTED: polyubiquitin 11 isoform X2 [Brachypodium distachyon]
Length=241

 Score =   352 bits (903),  Expect = 5e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_006288300.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
 gb|EOA21198.1| hypothetical protein CARUB_v10001544mg [Capsella rubella]
Length=306

 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQ+KEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQEKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|ACD31680.1| ubiquitin [Gossypium hirsutum]
Length=305

 Score =   354 bits (909),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLPDYNIQKESTLHLVLRLRGGF  305



>ref|XP_003082269.1| polyubiquitin (ISS) [Ostreococcus tauri]
Length=288

 Score =   353 bits (907),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 189/225 (84%), Positives = 197/225 (88%), Gaps = 6/225 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  42   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  96

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  156

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  157  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  216

Query  562  ITLEVESSDTIDNVKGQDPGQGXESPQISRXLSSPENSWEDGPHS  696
            ITLEVESSDTIDNVK +   +    P   R + + +   EDG H+
Sbjct  217  ITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQ-LEDGVHA  260


 Score =   289 bits (740),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 145/148 (98%), Positives = 147/148 (99%), Gaps = 0/148 (0%)
 Frame = +1

Query  169  EGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  348
            +GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV
Sbjct  10   DGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV  69

Query  349  ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  70   ESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  129

Query  529  QIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            QIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  130  QIFVKTLTGKTITLEVESSDTIDNVKAK  157



>gb|AFK43392.1| unknown [Medicago truncatula]
Length=233

 Score =   352 bits (902),  Expect = 6e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNAKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   303 bits (777),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>gb|KJA26171.1| hypothetical protein HYPSUDRAFT_354705 [Hypholoma sublateritium 
FD-334 SS-4]
Length=229

 Score =   351 bits (901),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|AAB95250.1| ubiquitin [Arabidopsis thaliana]
Length=304

 Score =   354 bits (908),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQ+ESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQRESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AAM64530.1| ubiquitin homolog [Arabidopsis thaliana]
Length=229

 Score =   351 bits (901),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLXLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLXLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>ref|XP_006287868.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
 gb|EOA20766.1| hypothetical protein CARUB_v10001095mg, partial [Capsella rubella]
Length=407

 Score =   358 bits (918),  Expect = 7e-119, Method: Compositional matrix adjust.
 Identities = 186/197 (94%), Positives = 188/197 (95%), Gaps = 4/197 (2%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            S NLF   R   S+ KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  14   SSNLF---RTILSF-KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  69

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  70   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  129

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  130  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  189

Query  562  ITLEVESSDTIDNVKGQ  612
            ITLEVESSDTIDNVK +
Sbjct  190  ITLEVESSDTIDNVKAK  206


 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  90   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  144

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  145  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  204

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  205  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  264

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  265  TITLEVESSDTIDNVKAK  282


 Score =   355 bits (911),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  166  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  220

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  221  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  280

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  281  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  340

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  341  TITLEVESSDTIDNVKAK  358


 Score =   304 bits (779),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  242  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  296

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  297  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  356

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  357  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  405



>gb|EJU04700.1| polyubiquitin UbiD/Ubi4 [Dacryopinax sp. DJM-731 SS1]
Length=229

 Score =   351 bits (900),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KIK28767.1| hypothetical protein PISMIDRAFT_672939, partial [Pisolithus microcarpus 
441]
Length=247

 Score =   352 bits (902),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  7    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  61

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  62   IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  121

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  122  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  181

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  182  TITLEVESSDTIDNVKAK  199


 Score =   302 bits (773),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  83   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  137

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  138  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  197

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  198  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  247


 Score =   239 bits (611),  Expect = 8e-75, Method: Compositional matrix adjust.
 Identities = 120/123 (98%), Positives = 122/123 (99%), Gaps = 0/123 (0%)
 Frame = +1

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  1    YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  60

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  61   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  120

Query  604  KGQ  612
            K +
Sbjct  121  KAK  123



>gb|KIM78981.1| hypothetical protein PILCRDRAFT_10644 [Piloderma croceum F 1598]
Length=229

 Score =   351 bits (900),  Expect = 8e-119, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGV  229



>ref|XP_010453358.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   354 bits (908),  Expect = 9e-119, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_011110054.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
 gb|EPS41950.1| hypothetical protein H072_4094 [Dactylellina haptotyla CBS 200.50]
Length=229

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_007154496.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
 gb|ESW26490.1| hypothetical protein PHAVU_003G1236001g [Phaseolus vulgaris]
Length=305

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>gb|KJB14874.1| hypothetical protein B456_002G147600, partial [Gossypium raimondii]
Length=344

 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  30   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  84

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  85   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  144

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  145  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  204

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  205  TITLEVESSDTIDNVKAK  222


 Score =   355 bits (911),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  106  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  160

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  161  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  220

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  221  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  280

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  281  TITLEVESSDTIDNVKAK  298


 Score =   302 bits (774),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 155/168 (92%), Positives = 157/168 (93%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  182  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  236

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  237  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  296

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  297  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  344


 Score =   267 bits (683),  Expect = 3e-84, Method: Compositional matrix adjust.
 Identities = 144/181 (80%), Positives = 145/181 (80%), Gaps = 35/181 (19%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLE                                   DGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLE-----------------------------------DGRTLADYN  25

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  26   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  85

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  86   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  145

Query  610  Q  612
            +
Sbjct  146  K  146



>ref|XP_011077812.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
 ref|XP_011077813.1| PREDICTED: polyubiquitin 3 [Sesamum indicum]
Length=334

 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  17   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  71

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  72   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  131

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  132  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  191

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  192  TITLEVESSDTIDNVKAK  209


 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  93   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  147

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  148  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  207

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  208  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  267

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  268  TITLEVESSDTIDNVKAK  285


 Score =   304 bits (778),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  169  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  223

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  224  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  283

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  284  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  332


 Score =   233 bits (595),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 118/120 (98%), Positives = 119/120 (99%), Gaps = 0/120 (0%)
 Frame = +1

Query  253  QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  432
            QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF
Sbjct  14   QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIF  73

Query  433  AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  74   AGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  133



>gb|KIL68862.1| hypothetical protein M378DRAFT_157997 [Amanita muscaria Koide 
BX008]
Length=305

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_006685644.1| ubiquitin [Candida tenuis ATCC 10573]
 gb|EGV64838.1| ubiquitin [Candida tenuis ATCC 10573]
Length=229

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_010062974.1| PREDICTED: polyubiquitin [Eucalyptus grandis]
Length=425

 Score =   358 bits (918),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 189/199 (95%), Gaps = 0/199 (0%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            + +L+ F   + S   +KMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQR
Sbjct  27   LGALSPFDLSKFSSLRVKMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQR  86

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  87   LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  146

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  147  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  206

Query  556  KTITLEVESSDTIDNVKGQ  612
            KTITLEVESSDTIDNVK +
Sbjct  207  KTITLEVESSDTIDNVKAK  225


 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  109  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  163

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  164  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  223

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  224  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  283

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDT+DNVK +
Sbjct  284  TITLEVESSDTVDNVKAK  301


 Score =   355 bits (910),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  185  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  239

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVK
Sbjct  240  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVK  299

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  300  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  359

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  360  TITLEVESSDTIDNVKAK  377


 Score =   304 bits (778),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  261  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  315

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  316  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  375

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  376  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  425



>gb|AHC00631.1| polyubiquitin [Ganoderma lucidum]
Length=319

 Score =   354 bits (908),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 180/188 (96%), Positives = 183/188 (97%), Gaps = 2/188 (1%)
 Frame = +1

Query  55   CSYL--KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  228
            CS L   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  8    CSLLAYSMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDG  67

Query  229  RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  408
            RTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP
Sbjct  68   RTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP  127

Query  409  PDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  588
            PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD
Sbjct  128  PDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD  187

Query  589  TIDNVKGQ  612
            TIDNVK +
Sbjct  188  TIDNVKAK  195


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  79   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  133

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  134  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  193

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  194  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  253

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  254  TITLEVESSDTIDNVKAK  271


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  155  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  209

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  210  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  269

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  270  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  319



>emb|CDR41572.1| RHTO0S06e03070g1_1 [Rhodosporidium toruloides]
Length=230

 Score =   351 bits (900),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (768),  Expect = 9e-99, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYN+QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNVQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLQDYNIQKESTLHLVLRLRGG  228



>gb|AFW66439.1| putative ubiquitin family protein [Zea mays]
Length=297

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   343 bits (879),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 181/202 (90%), Positives = 185/202 (92%), Gaps = 6/202 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQDPGQ  624
            TITLEVESSD I + +G  P Q
Sbjct  240  TITLEVESSD-IQDKEGIPPDQ  260


 Score =   281 bits (719),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 150/169 (89%), Gaps = 13/169 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD      
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSD------  249

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
              IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  250  --IQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  296



>emb|CDP08567.1| unnamed protein product [Coffea canephora]
Length=364

 Score =   355 bits (912),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 184/191 (96%), Gaps = 0/191 (0%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  219
            +L    S  KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  44   YLVFCFSSHKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  103

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  399
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  104  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  163

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  579
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  164  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  223

Query  580  SSDTIDNVKGQ  612
            SSDTIDNVK +
Sbjct  224  SSDTIDNVKAK  234


 Score =   353 bits (905),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  118  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  172

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  173  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  232

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  233  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  292

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  293  TITLEVESSDTIDNVKAK  310


 Score =   273 bits (698),  Expect = 2e-86, Method: Compositional matrix adjust.
 Identities = 141/154 (92%), Positives = 143/154 (93%), Gaps = 5/154 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  194  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  248

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  249  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  308

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  480
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI
Sbjct  309  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNI  342



>gb|KJB62487.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KDB11907.1| ubiquitin [Ustilaginoidea virens]
Length=305

 Score =   353 bits (906),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKSK  257


 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_008796945.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin-like [Phoenix dactylifera]
Length=309

 Score =   353 bits (907),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESXDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|AFW66438.1| putative ubiquitin family protein, partial [Zea mays]
 gb|AFW66447.1| ubiquitin2, partial [Zea mays]
Length=349

 Score =   355 bits (910),  Expect = 1e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 186/243 (77%), Gaps = 50/243 (21%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQ---------------------------------------------DKEGIPPDQQR  423
            AKIQ                                             DKEGIPPDQQR
Sbjct  180  AKIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  239

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  240  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  299

Query  604  KGQ  612
            K +
Sbjct  300  KAK  302


 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>ref|XP_010938693.1| PREDICTED: polyubiquitin [Elaeis guineensis]
Length=307

 Score =   353 bits (906),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/196 (93%), Positives = 185/196 (94%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  240  TITLEVESSDTIDNVK  255


 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIF+KTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFIKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>dbj|BAF00213.1| polyubiquitin 4 UBQ4 [Arabidopsis thaliana]
Length=351

 Score =   355 bits (910),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   334 bits (857),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 183/243 (75%), Positives = 186/243 (77%), Gaps = 50/243 (21%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQ---------------------------------------------DKEGIPPDQQR  423
            AKIQ                                             DKEGIPPDQQR
Sbjct  180  AKIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  239

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  240  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  299

Query  604  KGQ  612
            K +
Sbjct  300  KAK  302


 Score =   305 bits (781),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  186  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  240

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  241  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  300

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  301  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  349



>gb|AES89865.2| polyubiquitin 3 [Medicago truncatula]
Length=278

 Score =   352 bits (903),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   332 bits (850),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 172/184 (93%), Positives = 174/184 (95%), Gaps = 5/184 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLE  573
            ITLE
Sbjct  241  ITLE  244



>gb|AFY06654.1| polyubiquitin, partial [Carica papaya]
Length=264

 Score =   351 bits (901),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  36   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  95

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  96   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  155

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  156  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  215

Query  610  Q  612
            +
Sbjct  216  K  216


 Score =   302 bits (774),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  100  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  154

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  155  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  214

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  215  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  264


 Score =   244 bits (623),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 125/127 (98%), Positives = 125/127 (98%), Gaps = 0/127 (0%)
 Frame = +1

Query  226  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  405
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGI  71

Query  406  PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  585
            PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS
Sbjct  72   PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESS  131

Query  586  DTIDNVK  606
            DTIDNVK
Sbjct  132  DTIDNVK  138


 Score = 74.7 bits (182),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 49/53 (92%), Positives = 50/53 (94%), Gaps = 0/53 (0%)
 Frame = +1

Query  454  GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            G TLADYNIQKESTL LVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  12   GGTLADYNIQKESTLLLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  64


 Score = 36.2 bits (82),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 1/35 (3%)
 Frame = +3

Query  624  RXGIPPDQQXLIFAGKQLGGWAALLRITTSRKEST  728
            + GIPPDQQ LIFAGKQL     L      +KEST
Sbjct  68   KEGIPPDQQRLIFAGKQLEDGRTLADYNI-QKEST  101



>emb|CEF99839.1| Ubiquitin conserved site [Ostreococcus tauri]
Length=339

 Score =   354 bits (909),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  99   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  153

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  154  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  213

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  214  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  273

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  274  TITLEVESSDTIDNVKAK  291


 Score =   353 bits (906),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  35   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  94

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  95   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  154

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  155  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  214

Query  610  Q  612
            +
Sbjct  215  K  215


 Score =   303 bits (777),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  175  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  229

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  230  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  289

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  290  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  338



>gb|AAO43308.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   351 bits (900),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  184  TITLEVESSDTIDNVKAK  201


 Score =   296 bits (759),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGG  248


 Score =   244 bits (624),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 123/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQ  612
            NVK +
Sbjct  121  NVKAK  125



>ref|XP_003607668.1| Multidrug resistance protein ABC transporter family [Medicago 
truncatula]
Length=497

 Score =   359 bits (922),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 184/194 (95%), Positives = 186/194 (96%), Gaps = 0/194 (0%)
 Frame = +1

Query  31   LFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  210
            LF+ LR      KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG
Sbjct  207  LFFLLRQFYDSFKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAG  266

Query  211  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  390
            KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ
Sbjct  267  KQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ  326

Query  391  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  570
            DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL
Sbjct  327  DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL  386

Query  571  EVESSDTIDNVKGQ  612
            EVESSDTIDNVK +
Sbjct  387  EVESSDTIDNVKAK  400


 Score =   330 bits (846),  Expect = 7e-107, Method: Compositional matrix adjust.
 Identities = 168/168 (100%), Positives = 168/168 (100%), Gaps = 0/168 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  296  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  355

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  356  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  415

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  573
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE
Sbjct  416  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLE  463



>gb|AGZ15412.1| fiber polyubiquitin [Phaseolus vulgaris]
Length=229

 Score =   350 bits (897),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   286 bits (733),  Expect = 2e-93, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 152/169 (90%), Gaps = 5/169 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES DTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESFDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            KIQDKEGIPPDQQRLIFAGKQLEDG TLADYNIQKE TL LVL  RGG 
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGCTLADYNIQKEFTLPLVLCFRGGF  229



>gb|EGO00904.1| hypothetical protein SERLA73DRAFT_178893 [Serpula lacrymans var. 
lacrymans S7.3]
Length=312

 Score =   353 bits (905),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (904),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   290 bits (743),  Expect = 9e-94, Method: Compositional matrix adjust.
 Identities = 148/164 (90%), Positives = 152/164 (93%), Gaps = 5/164 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVL  510
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLV 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVF  299



>dbj|GAK65396.1| ubiquitin [Pseudozyma antarctica]
Length=334

 Score =   354 bits (908),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 182/199 (91%), Positives = 187/199 (94%), Gaps = 6/199 (3%)
 Frame = +1

Query  16   ICSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  195
            +CS  LF  L+       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  18   LCSSALFPLLQ------AMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  71

Query  196  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  375
            LIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  72   LIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  131

Query  376  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG  555
            KAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTG
Sbjct  132  KAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTG  191

Query  556  KTITLEVESSDTIDNVKGQ  612
            KTITLEVESSDTIDNVK +
Sbjct  192  KTITLEVESSDTIDNVKAK  210


 Score =   352 bits (903),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  94   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  148

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  149  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  208

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  209  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  268

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  269  TITLEVESSDTIDNVKAK  286


 Score =   301 bits (771),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  170  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  224

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  225  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  284

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  285  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  333



>gb|KIK92093.1| hypothetical protein PAXRUDRAFT_830299, partial [Paxillus rubicundulus 
Ve08.2h10]
Length=229

 Score =   350 bits (897),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (770),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_002872109.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48368.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=383

 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  120

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  180

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  181  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  240

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  241  TITLEVESSDTIDNVKAK  258


 Score =   355 bits (912),  Expect = 2e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  142  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  196

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  197  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  256

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  257  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  316

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  317  TITLEVESSDTIDNVKAK  334


 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRLIFAGKQLEDGRTLADYN
Sbjct  2    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPLDQQRLIFAGKQLEDGRTLADYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  121

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  122  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  181

Query  610  Q  612
            +
Sbjct  182  K  182


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  218  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  272

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  273  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  332

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEG+PPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  333  AKIQDKEGVPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  381



>gb|ACS68205.1| ubiquitin 10.2 [Brassica napus]
Length=381

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_010240921.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=381

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            +QKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   VQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006593989.1| PREDICTED: polyubiquitin 10-like isoform X1 [Glycine max]
Length=381

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (910),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            T+TLEVESSDTIDNVK +
Sbjct  316  TVTLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>emb|CBY46746.1| polyubiquitin 10 protein, partial [Lepidium campestre]
Length=381

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010492041.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAG QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGTQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_006381473.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP59270.1| polyubiquitin family protein [Populus trichocarpa]
Length=306

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   348 bits (894),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVENSDTIDNVKVKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTG TITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGNTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTG TITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGNTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|EYU33608.1| hypothetical protein MIMGU_mgv1a004315mg [Erythranthe guttata]
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (781),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGV  381



>ref|XP_010911599.1| PREDICTED: polyubiquitin 4 [Elaeis guineensis]
Length=384

 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (912),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010454368.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   355 bits (910),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT+DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTVDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002874006.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH50265.1| hypothetical protein ARALYDRAFT_488966 [Arabidopsis lyrata subsp. 
lyrata]
Length=382

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQ+FVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQVFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002508175.1| ubiquitin [Micromonas sp. RCC299]
 ref|XP_003061956.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|EEH53668.1| ubiquitin [Micromonas pusilla CCMP1545]
 gb|ACO69433.1| ubiquitin [Micromonas sp. RCC299]
 gb|KEH20642.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_011048569.1| PREDICTED: polyubiquitin 3-like [Populus euphratica]
Length=306

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   352 bits (902),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQK+STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKDSTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLE+GRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEEGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_001148453.1| LOC100282068 [Zea mays]
 ref|XP_002299930.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_003607671.1| Ubiquitin [Medicago truncatula]
 gb|AAC49014.1| ubiquitin [Zea mays]
 gb|ACG31521.1| polyubiquitin containing 7 ubiquitin monomers [Zea mays]
 gb|EEE84735.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ACR37911.1| unknown [Zea mays]
 gb|AES89868.1| polyubiquitin 3 [Medicago truncatula]
 gb|AFW66440.1| putative ubiquitin family protein isoform 1 [Zea mays]
 gb|AFW66441.1| putative ubiquitin family protein isoform 2 [Zea mays]
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB68045.1| polyubiquitin [Fragaria x ananassa]
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (905),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIXDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010240636.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
 ref|XP_010240784.1| PREDICTED: polyubiquitin isoform X1 [Brachypodium distachyon]
Length=383

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 182/183 (99%), Gaps = 0/183 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
            ++MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  1    MQMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  60

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  61   YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  120

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  121  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  180

Query  604  KGQ  612
            K +
Sbjct  181  KAK  183


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  67   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  121

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  122  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  181

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  182  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  241

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  242  TITLEVESSDTIDNVKAK  259


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  143  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  197

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  198  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  257

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  258  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  317

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  318  TITLEVESSDTIDNVKAK  335


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  219  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  273

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  274  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  333

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  334  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  382



>ref|NP_849300.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_567291.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|NP_001078353.4| polyubiquitin 10 [Arabidopsis thaliana]
 ref|XP_004134747.1| PREDICTED: polyubiquitin-like isoform 1 [Cucumis sativus]
 ref|XP_004134748.1| PREDICTED: polyubiquitin-like isoform 2 [Cucumis sativus]
 ref|XP_004496773.1| PREDICTED: polyubiquitin-like [Cicer arietinum]
 ref|XP_006360087.1| PREDICTED: polyubiquitin-like isoform X2 [Solanum tuberosum]
 ref|XP_006287939.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 ref|XP_006370633.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370635.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006370637.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 ref|XP_006380307.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 ref|XP_006377834.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006377835.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 ref|XP_006372946.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 ref|XP_006396616.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006396617.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 ref|XP_006452184.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 ref|XP_007021032.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021033.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 ref|XP_007021035.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007025987.1| Polyubiquitin 10 [Theobroma cacao]
 ref|XP_007143204.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 ref|XP_007211430.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 ref|XP_007211607.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 ref|XP_008244360.1| PREDICTED: polyubiquitin isoform X2 [Prunus mume]
 ref|XP_009365167.1| PREDICTED: polyubiquitin [Pyrus x bretschneideri]
 ref|XP_009358097.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009358098.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343085.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009343086.1| PREDICTED: polyubiquitin isoform X2 [Pyrus x bretschneideri]
 ref|XP_009611794.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
 ref|XP_009792849.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_009793738.1| PREDICTED: polyubiquitin [Nicotiana sylvestris]
 ref|XP_010267760.1| PREDICTED: polyubiquitin [Nelumbo nucifera]
 ref|XP_010423137.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010447068.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010455857.1| PREDICTED: polyubiquitin [Camelina sativa]
 ref|XP_010644407.1| PREDICTED: polyubiquitin [Vitis vinifera]
 ref|XP_011026350.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011030849.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011048300.1| PREDICTED: polyubiquitin [Populus euphratica]
 ref|XP_011460984.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 ref|XP_011460993.1| PREDICTED: polyubiquitin [Fragaria vesca subsp. vesca]
 sp|P69322.2|UBIQP_PEA RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Pisum sativum]
 emb|CAA34886.1| unnamed protein product [Pisum sativum]
 gb|AAD03344.1| ubiquitin [Pisum sativum]
 gb|AAK96602.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
 dbj|BAD26592.1| polyubiquitin [Populus nigra]
 gb|ABB73307.1| ubiquitin [Lotus japonicus]
 gb|ABK92512.1| unknown [Populus trichocarpa]
 gb|ABK93264.1| unknown [Populus trichocarpa]
 gb|ABK95903.1| unknown [Populus trichocarpa]
 gb|ABK96012.1| unknown [Populus trichocarpa]
 gb|ABK96127.1| unknown [Populus trichocarpa]
 gb|ACK56276.1| ubiquitin [Populus trichocarpa]
 gb|AEE82501.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82504.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|AEE82505.1| polyubiquitin 10 [Arabidopsis thaliana]
 gb|EMJ12629.1| hypothetical protein PRUPE_ppa007117mg [Prunus persica]
 gb|EMJ12806.1| hypothetical protein PRUPE_ppa005503mg [Prunus persica]
 gb|EOA20837.1| hypothetical protein CARUB_v10001174mg [Capsella rubella]
 gb|EOY12557.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12558.1| Polyubiquitin 10 isoform 1 [Theobroma cacao]
 gb|EOY12560.1| Polyubiquitin 10 [Theobroma cacao]
 gb|EOY28609.1| Polyubiquitin 10 [Theobroma cacao]
 gb|ERP50743.1| UBIQUITIN 11 family protein [Populus trichocarpa]
 gb|ERP55631.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP55632.1| hypothetical protein POPTR_0011s13770g [Populus trichocarpa]
 gb|ERP58104.1| hypothetical protein POPTR_0007s02460g [Populus trichocarpa]
 gb|ERP67202.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67204.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ERP67206.1| hypothetical protein POPTR_0001s44440g [Populus trichocarpa]
 gb|ESQ38069.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESQ38070.1| hypothetical protein EUTSA_v10028728mg [Eutrema salsugineum]
 gb|ESR65424.1| hypothetical protein CICLE_v10008642mg [Citrus clementina]
 gb|ESW15198.1| hypothetical protein PHAVU_007G052600g [Phaseolus vulgaris]
 gb|KDO52961.1| hypothetical protein CISIN_1g009518mg [Citrus sinensis]
 gb|KDP20793.1| hypothetical protein JCGZ_21264 [Jatropha curcas]
 gb|AET01628.2| polyubiquitin 3 [Medicago truncatula]
 gb|KEH30745.1| polyubiquitin 3 [Medicago truncatula]
 gb|KJB13593.1| hypothetical protein B456_002G083100 [Gossypium raimondii]
 gb|KJB62633.1| hypothetical protein B456_009G427000 [Gossypium raimondii]
 prf||1603402A poly-ubiquitin
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_006396612.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
 ref|XP_010537979.1| PREDICTED: polyubiquitin [Tarenaya hassleriana]
 emb|CAJ86369.1| OSIGBa0117N13.13 [Oryza sativa Indica Group]
 emb|CAJ86419.1| H0303G06.8 [Oryza sativa Indica Group]
 gb|EAY95663.1| hypothetical protein OsI_17529 [Oryza sativa Indica Group]
 gb|ESQ38065.1| hypothetical protein EUTSA_v10028730mg [Eutrema salsugineum]
Length=381

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>emb|CCL99875.1| predicted protein [Fibroporia radiculosa]
Length=312

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  72   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  126

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  127  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  186

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  187  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  246

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  247  TITLEVESSDTIDNVKAK  264


 Score =   352 bits (904),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 178/187 (95%), Positives = 182/187 (97%), Gaps = 0/187 (0%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            + S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  2    TISSSNMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  61

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  62   TLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  121

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  591
            DQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  122  DQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  181

Query  592  IDNVKGQ  612
            IDNVK +
Sbjct  182  IDNVKAK  188


 Score =   303 bits (775),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  148  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  202

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  203  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  262

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  263  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  312



>gb|KJB13592.1| hypothetical protein B456_002G083000 [Gossypium raimondii]
Length=385

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/172 (91%), Positives = 160/172 (93%), Gaps = 5/172 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQI  534
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG ++
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGFRM  383



>sp|P0CG84.1|UBI4P_NICSY RecName: Full=Polyubiquitin; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor, partial [Nicotiana sylvestris]
 gb|AAA34124.1| pentameric polyubiquitin, partial [Nicotiana sylvestris]
Length=377

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  61   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  115

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  116  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  175

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  176  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  235

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  236  TITLEVESSDTIDNVKAK  253


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  137  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  191

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  192  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  251

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  252  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  311

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  312  TITLEVESSDTIDNVKAK  329


 Score =   345 bits (885),  Expect = 2e-114, Method: Compositional matrix adjust.
 Identities = 175/177 (99%), Positives = 176/177 (99%), Gaps = 0/177 (0%)
 Frame = +1

Query  82   VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  261
            VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE
Sbjct  1    VKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE  60

Query  262  STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  441
            STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK
Sbjct  61   STLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGK  120

Query  442  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  121  QLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  177


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  213  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  267

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  268  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  327

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  328  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  377



>gb|KJB62485.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=305

 Score =   352 bits (904),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   303 bits (776),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|NP_568397.1| ubiquitin 4 [Arabidopsis thaliana]
 ref|XP_002881273.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 ref|XP_010420904.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 ref|XP_010493166.1| PREDICTED: polyubiquitin 4 [Camelina sativa]
 sp|P0CH32.1|UBQ4_ARATH RecName: Full=Polyubiquitin 4; Contains: RecName: Full=Ubiquitin; 
Flags: Precursor [Arabidopsis thaliana]
 emb|CAA31331.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAB53929.1| polyubiquitin [Arabidopsis thaliana]
 gb|EFH57532.1| hypothetical protein ARALYDRAFT_482268 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED92867.1| ubiquitin 4 [Arabidopsis thaliana]
 prf||1515347A poly-ubiquitin
Length=382

 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 3e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001174480.1| Os05g0504766 [Oryza sativa Japonica Group]
 ref|XP_002438904.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 ref|XP_006656385.1| PREDICTED: polyubiquitin-like [Oryza brachyantha]
 ref|XP_007027294.1| Ubiquitin 4 [Theobroma cacao]
 ref|XP_010240640.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 ref|XP_010240789.1| PREDICTED: polyubiquitin isoform X2 [Brachypodium distachyon]
 gb|AAD30173.1|AF148448_1 polyubiquitin [Sporobolus stapfianus]
 gb|AAW56906.1| polyubiquitin [Oryza sativa Japonica Group]
 gb|EAY98614.1| hypothetical protein OsI_20535 [Oryza sativa Indica Group]
 gb|EEE64284.1| hypothetical protein OsJ_19121 [Oryza sativa Japonica Group]
 gb|EER90271.1| hypothetical protein SORBIDRAFT_10g028020 [Sorghum bicolor]
 dbj|BAH93208.1| Os05g0504766 [Oryza sativa Japonica Group]
 dbj|BAJ91806.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK04112.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|AFH53939.1| polyubiquitin 4 [Brachypodium distachyon]
 gb|AFH53940.1| polyubiquitin 10 [Brachypodium distachyon]
 gb|EOY07796.1| Ubiquitin 4 [Theobroma cacao]
 gb|AGT16803.1| polyubiquitin [Saccharum hybrid cultivar R570]
Length=381

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|NP_001105376.1| polyubiquitin [Zea mays]
 gb|AAC49025.1| polyubiquitin [Zea mays]
Length=381

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLV+RLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVVRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010558157.1| PREDICTED: polyubiquitin-like [Tarenaya hassleriana]
Length=382

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAY86773.1| polyubiquitin [Noccaea caerulescens]
Length=382

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>sp|Q58G87.2|UBQ3_ORYSJ RecName: Full=Polyubiquitin 3; Contains: RecName: Full=Ubiquitin-related; 
Contains: RecName: Full=Ubiquitin; Flags: Precursor 
[Oryza sativa Japonica Group]
 emb|CAE04243.3| OSJNBa0089N06.4 [Oryza sativa Japonica Group]
 gb|EAZ32071.1| hypothetical protein OsJ_16259 [Oryza sativa Japonica Group]
Length=381

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (902),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (782),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|AAX40652.1| polyubiquitin [Oryza sativa Japonica Group]
Length=381

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRL+FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLVFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (902),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            +FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  VFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  381



>gb|ABU40645.1| polyubiquitin [Triticum aestivum]
Length=380

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_009596689.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=382

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006428816.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
 gb|ESR42056.1| hypothetical protein CICLE_v10011684mg [Citrus clementina]
Length=382

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>emb|CDP05795.1| unnamed protein product [Coffea canephora]
Length=381

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQ+KEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQEKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|KIY45417.1| ubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_009591312.1| PREDICTED: polyubiquitin 4 [Nicotiana tomentosiformis]
 ref|XP_011468093.1| PREDICTED: LOW QUALITY PROTEIN: polyubiquitin 4-like [Fragaria 
vesca subsp. vesca]
Length=382

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KIR63773.1| polyubiquitin [Cryptococcus gattii CA1873]
 gb|KIR98208.1| polyubiquitin [Cryptococcus gattii 2001/935-1]
Length=305

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (897),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|ADD52202.1| ubiquitin [Catharanthus roseus]
 gb|AEK98798.1| ubiquitin [Carthamus tinctorius]
Length=381

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   349 bits (895),  Expect = 7e-116, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 184/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   346 bits (887),  Expect = 1e-114, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAK QDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKTQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT DNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTTDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLAD NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADCNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLI AGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLILAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_002266370.1| PREDICTED: polyubiquitin 4-like [Vitis vinifera]
Length=383

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_006302388.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
 gb|EOA35286.1| hypothetical protein CARUB_v10020456mg [Capsella rubella]
Length=383

 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAB36545.1| ubiquitin-like protein [Phaseolus vulgaris]
Length=407

 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  91   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  145

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  146  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  205

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  206  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  265

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  266  TITLEVESSDTIDNVKAK  283


 Score =   356 bits (913),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  167  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  221

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  222  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  281

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  282  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  341

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  342  TITLEVESSDTIDNVKAK  359


 Score =   305 bits (781),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  243  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  297

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  298  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  357

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  358  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  407


 Score =   263 bits (672),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 140/166 (84%), Positives = 147/166 (89%), Gaps = 3/166 (2%)
 Frame = +1

Query  115  EVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  294
            +V  S  ++ V A++ D +      Q   FA KQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  45   QVFVSHMVEGVDARLLDVQKGHKGAQ--CFA-KQLEDGRTLADYNIQKESTLHLVLRLRG  101

Query  295  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  474
            GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  102  GMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  161

Query  475  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  162  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAK  207



>gb|AAL09741.1| AT4g05320/C17L7_240 [Arabidopsis thaliana]
Length=381

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLSLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (904),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (902),  Expect = 9e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVL LRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLSLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_001828882.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 ref|XP_001873268.1| ubiquitin [Laccaria bicolor S238N-H82]
 ref|XP_003037536.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 ref|XP_006454479.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 ref|XP_007316692.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 ref|XP_007325267.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 ref|XP_007378433.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 ref|XP_007842308.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 ref|XP_007879465.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|EAU92889.1| ubiquitin C [Coprinopsis cinerea okayama7#130]
 gb|EDR15060.1| ubiquitin [Laccaria bicolor S238N-H82]
 gb|EFJ02634.1| hypothetical protein SCHCODRAFT_64979 [Schizophyllum commune 
H4-8]
 gb|EGO26519.1| hypothetical protein SERLADRAFT_385284 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EIN13516.1| ubiquitin [Punctularia strigosozonata HHB-11173 SS5]
 gb|EKM83733.1| hypothetical protein AGABI1DRAFT_81473 [Agaricus bisporus var. 
burnettii JB137-S8]
 gb|EKV51498.1| ubiquitin [Agaricus bisporus var. bisporus H97]
 dbj|GAC72194.1| ubiquitin and ubiquitin-like proteins [Pseudozyma antarctica 
T-34]
 dbj|GAC93128.1| ubiquitin [Pseudozyma hubeiensis SY62]
 gb|EPQ28867.1| hypothetical protein PFL1_06871 [Pseudozyma flocculosa PF-1]
 gb|ESK98373.1| polyubiquitin [Moniliophthora roreri MCA 2997]
 gb|AHA61591.1| ubiquitin [Volvariella volvacea]
 gb|KIK04252.1| hypothetical protein K443DRAFT_4723 [Laccaria amethystina LaAM-08-1]
 gb|KIO31281.1| hypothetical protein M407DRAFT_241831 [Tulasnella calospora MUT 
4182]
Length=305

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|KIY97324.1| ubiquitin C, partial [Monoraphidium neglectum]
Length=186

 Score =   347 bits (891),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 174/181 (96%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   212 bits (540),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 116/127 (91%), Gaps = 5/127 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKE  399
            +KIQDKE
Sbjct  180  SKIQDKE  186



>gb|KIY53974.1| polyubiquitin [Fistulina hepatica ATCC 64428]
Length=305

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (768),  Expect = 9e-98, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DY+IQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYSIQKESTLHLVLRLRGGL  305



>gb|KIJ45725.1| hypothetical protein M422DRAFT_106821, partial [Sphaerobolus 
stellatus SS14]
Length=305

 Score =   352 bits (903),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  305



>ref|XP_010421267.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=382

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   303 bits (776),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKE+TLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKETTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_002992988.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
 ref|XP_002994514.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ04422.1| hypothetical protein SELMODRAFT_138728 [Selaginella moellendorffii]
 gb|EFJ05934.1| hypothetical protein SELMODRAFT_187148 [Selaginella moellendorffii]
Length=229

 Score =   349 bits (896),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   303 bits (775),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  229



>gb|EYU18102.1| hypothetical protein MIMGU_mgv1a008166mg [Erythranthe guttata]
Length=383

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDT+DNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTVDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81825.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
 gb|KJB81826.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=381

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_009763135.1| PREDICTED: polyubiquitin-like [Nicotiana sylvestris]
Length=381

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (901),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVES+DTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESTDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010696408.1| PREDICTED: polyubiquitin 4 [Beta vulgaris subsp. vulgaris]
Length=382

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/196 (93%), Positives = 185/196 (94%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  316  TITLEVESSDTIDNVK  331


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KEH31155.1| polyubiquitin 3 [Medicago truncatula]
Length=381

 Score =   355 bits (910),  Expect = 4e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   353 bits (907),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   303 bits (776),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>gb|EWZ40370.1| ubiquitin C [Fusarium oxysporum Fo47]
Length=229

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (767),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 153/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_001555417.1| polyubiquitin [Botrytis cinerea B05.10]
 ref|XP_001906054.1| hypothetical protein [Podospora anserina S mat+]
 ref|XP_007336907.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 ref|XP_007390409.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 ref|XP_011121602.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 gb|AAC15225.1| polyubiquitin [Botrytis cinerea]
 emb|CAP66720.1| unnamed protein product [Podospora anserina S mat+]
 gb|EGX49548.1| hypothetical protein AOL_s00078g37 [Arthrobotrys oligospora ATCC 
24927]
 emb|CCD51422.1| similar to polyubiquitin protein [Botrytis cinerea T4]
 gb|EJD55630.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EKM60970.1| hypothetical protein PHACADRAFT_247222 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EMR84820.1| putative polyubiquitin protein [Botrytis cinerea BcDW1]
 emb|CDP28455.1| Putative Ubiquitin [Podospora anserina S mat+]
 gb|KIP12035.1| hypothetical protein PHLGIDRAFT_17814 [Phlebiopsis gigantea 11061_1 
CR5-6]
Length=305

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_009605659.1| PREDICTED: polyubiquitin [Nicotiana tomentosiformis]
Length=305

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLED RTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDERTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>ref|XP_009108753.1| PREDICTED: polyubiquitin 11-like [Brassica rapa]
Length=229

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKE+ LHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKETNLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   TNLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK LTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKNLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEDIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>dbj|BAL61087.1| polyubiquitin [Dianthus caryophyllus]
Length=229

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (768),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_001783045.1| predicted protein [Physcomitrella patens]
 gb|EDQ52114.1| predicted protein [Physcomitrella patens]
Length=229

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (768),  Expect = 8e-99, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  228



>ref|XP_001420612.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98905.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|KHN17791.1| Polyubiquitin 4 [Glycine soja]
Length=381

 Score =   355 bits (910),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (910),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_010452435.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=305

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR 
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRF  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQD+EGIPPDQQR I
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305


 Score =   204 bits (520),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 113/130 (87%), Gaps = 1/130 (1%)
 Frame = +1

Query  298  MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  477
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  478  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKGQDPGQGXESPQISRXL  657
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK +   Q    P   R +
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDQEGIPPDQQRFI  120

Query  658  SSPENSWEDG  687
             + +   EDG
Sbjct  121  FAGKQ-LEDG  129



>ref|XP_003030030.1| polyubiquitin [Schizophyllum commune H4-8]
 ref|XP_006678580.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 ref|XP_007396817.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|AAB94630.1| polyubiquitin [Schizophyllum commune]
 gb|EFI95127.1| polyubiquitin [Schizophyllum commune H4-8]
 gb|EGF80702.1| polyubiquitin [Batrachochytrium dendrobatidis JAM81]
 gb|EKM54116.1| hypothetical protein PHACADRAFT_257732 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EPT04446.1| hypothetical protein FOMPIDRAFT_1021745 [Fomitopsis pinicola 
FP-58527 SS1]
 gb|KDQ24213.1| hypothetical protein PLEOSDRAFT_1058300 [Pleurotus ostreatus 
PC15]
 gb|KDQ28506.1| hypothetical protein PLEOSDRAFT_1089714 [Pleurotus ostreatus 
PC15]
 gb|KDQ53556.1| hypothetical protein JAAARDRAFT_72512 [Jaapia argillacea MUCL 
33604]
 gb|KIK09182.1| hypothetical protein K443DRAFT_671672 [Laccaria amethystina LaAM-08-1]
 gb|KIK44225.1| hypothetical protein CY34DRAFT_648259 [Suillus luteus UH-Slu-Lm8-n1]
 gb|KIM51102.1| hypothetical protein SCLCIDRAFT_144015 [Scleroderma citrinum 
Foug A]
 gb|KIN98337.1| hypothetical protein M404DRAFT_856969 [Pisolithus tinctorius 
Marx 270]
 gb|KIN98894.1| hypothetical protein M404DRAFT_966612 [Pisolithus tinctorius 
Marx 270]
Length=305

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>gb|KIR29996.1| polyubiquitin [Cryptococcus gattii LA55]
 gb|KIR37417.1| polyubiquitin [Cryptococcus gattii MMRL2647]
 gb|KIR43885.1| polyubiquitin [Cryptococcus gattii Ram5]
 gb|KIR92886.1| polyubiquitin [Cryptococcus gattii CBS 10090]
 gb|KIY60273.1| polyubiquitin [Cryptococcus gattii 99/473]
Length=315

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (898),  Expect = 4e-117, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   315 bits (808),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 161/176 (91%), Positives = 165/176 (94%), Gaps = 5/176 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKT  546
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKT
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKT  311



>ref|XP_001598085.1| polyubiquitin [Sclerotinia sclerotiorum 1980]
 gb|EDN90771.1| polyubiquitin [Sclerotinia sclerotiorum 1980 UF-70]
Length=305

 Score =   352 bits (903),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 157/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLLDYNIQKESTLHLVLRLRGG  304



>gb|KIM67150.1| hypothetical protein SCLCIDRAFT_1210637 [Scleroderma citrinum 
Foug A]
Length=305

 Score =   352 bits (902),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   347 bits (891),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQ KEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQVKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_001755431.1| predicted protein [Physcomitrella patens]
 gb|EDQ79911.1| predicted protein [Physcomitrella patens]
Length=231

 Score =   349 bits (895),  Expect = 5e-118, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   298 bits (762),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 153/168 (91%), Positives = 155/168 (92%), Gaps = 5/168 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  522
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRG  227



>gb|ACH45557.1| putative ubiquitin C variant 4 [Taeniopygia guttata]
Length=190

 Score =   347 bits (891),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/186 (94%), Positives = 181/186 (97%), Gaps = 0/186 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+  +G
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIEXCQG  180

Query  610  QDPGQG  627
            QDPGQG
Sbjct  181  QDPGQG  186



>ref|XP_010270791.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=382

 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            T+TLEVESSDTIDNVK +
Sbjct  240  TVTLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT+TLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTVTLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKT+TLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTVTLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGI  381



>ref|XP_009358096.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
 ref|XP_009343084.1| PREDICTED: polyubiquitin isoform X1 [Pyrus x bretschneideri]
Length=401

 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  200  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  259

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  260  TITLEVESSDTIDNVKAK  277


 Score =   355 bits (911),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  161  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  215

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  216  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  275

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  276  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  335

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  336  TITLEVESSDTIDNVKAK  353


 Score =   355 bits (910),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 182/191 (95%), Positives = 184/191 (96%), Gaps = 3/191 (2%)
 Frame = +1

Query  40   HLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  219
            +L  S S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL
Sbjct  14   YLESSTS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQL  70

Query  220  EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  399
            EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE
Sbjct  71   EDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE  130

Query  400  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  579
            GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE
Sbjct  131  GIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE  190

Query  580  SSDTIDNVKGQ  612
            SSDTIDNVK +
Sbjct  191  SSDTIDNVKAK  201


 Score =   305 bits (780),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  237  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  291

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  292  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  351

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  352  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  401



>gb|AAO43309.1| putative polyubiquitin [Arabidopsis thaliana]
Length=250

 Score =   350 bits (897),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  9    STLHLVLRLRGG-----MQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQQRL  63

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  64   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  123

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKE IPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  124  AKIQDKEWIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  183

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  184  TITLEVESSDTIDNVKAK  201


 Score =   296 bits (757),  Expect = 8e-97, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKE IPPDQQRL
Sbjct  85   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEWIPPDQQRL  139

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  140  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  199

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQ+RLIFAGKQLEDGRTLA YNIQKESTLHLVLRLRGG+
Sbjct  200  AKIQDKEGIPPDQKRLIFAGKQLEDGRTLAVYNIQKESTLHLVLRLRGGI  249


 Score =   243 bits (621),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 122/125 (98%), Positives = 124/125 (99%), Gaps = 0/125 (0%)
 Frame = +1

Query  238  ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQ  417
            ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEV+SSDTIDNVKAKIQDKEGIPPDQ
Sbjct  1    ADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVQSSDTIDNVKAKIQDKEGIPPDQ  60

Query  418  QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  597
            QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID
Sbjct  61   QRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTID  120

Query  598  NVKGQ  612
            NVK +
Sbjct  121  NVKAK  125



>gb|ADO60140.1| ubiquitin [Beauveria bassiana]
Length=215

 Score =   348 bits (893),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   273 bits (698),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 145/156 (93%), Gaps = 5/156 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQK  486
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQK  215



>gb|AAN31845.1| putative polyubiquitin (UBQ10) [Arabidopsis thaliana]
Length=464

 Score =   357 bits (917),  Expect = 6e-118, Method: Compositional matrix adjust.
 Identities = 195/246 (79%), Positives = 199/246 (81%), Gaps = 11/246 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKG--QDPGQGXESPQISRXLSSPENSWEDGPHSCGLXHPERSRLF  732
            TITLEVESSDTIDNVK   QD         +S  L S        P +       RS LF
Sbjct  392  TITLEVESSDTIDNVKAKIQDKEGIPPDQSVSSSLESSLRMDVLWPTTTS----RRSLLF  447

Query  733  XWGSGF  750
             W   F
Sbjct  448  TWSCVF  453


 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (910),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (908),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181



>ref|XP_008020911.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
 gb|EOA91885.1| hypothetical protein SETTUDRAFT_162442 [Setosphaeria turcica 
Et28A]
Length=305

 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKSK  257


 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>gb|KIM48035.1| hypothetical protein M413DRAFT_16078 [Hebeloma cylindrosporum 
h7]
Length=381

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 187/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L + LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVFRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (904),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   350 bits (898),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLV RLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVFRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  380



>emb|CCT70325.1| UBI4-Ubiquitin [Fusarium fujikuroi IMI 58289]
Length=281

 Score =   350 bits (899),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  41   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  95

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  96   IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  155

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  156  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  215

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  216  TITLEVESSDTIDNVKSK  233


 Score =   299 bits (766),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  117  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  171

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  172  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  231

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  232  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  280


 Score =   289 bits (739),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 153/181 (85%), Positives = 156/181 (86%), Gaps = 24/181 (13%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDN                        LEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDN------------------------LEDGRTLSDYN  36

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  37   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  96

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  97   FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  156

Query  610  Q  612
            +
Sbjct  157  K  157



>gb|KDQ20365.1| hypothetical protein BOTBODRAFT_123907 [Botryobasidium botryosum 
FD-172 SS1]
Length=305

 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (899),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>gb|EMS65864.1| Polyubiquitin [Triticum urartu]
Length=405

 Score =   355 bits (911),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (911),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   305 bits (780),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 158/180 (88%), Positives = 163/180 (91%), Gaps = 7/180 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG--MQIFVKTLT  552
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  M  +V+  +
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGHVMHRYVRLFS  391



>ref|XP_007763327.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EIW86558.1| polyubiquitin [Coniophora puteana RWD-64-598 SS2]
 gb|EUC62408.1| polyubiquitin [Rhizoctonia solani AG-3 Rhs1AP]
 gb|KDQ12738.1| hypothetical protein BOTBODRAFT_34195 [Botryobasidium botryosum 
FD-172 SS1]
 gb|KEP53373.1| polyubiquitin [Rhizoctonia solani 123E]
 gb|KIJ12827.1| hypothetical protein PAXINDRAFT_82237 [Paxillus involutus ATCC 
200175]
 gb|KIK47355.1| hypothetical protein CY34DRAFT_799527 [Suillus luteus UH-Slu-Lm8-n1]
Length=305

 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   351 bits (900),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (770),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_007339454.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|EJD52725.1| ubiquitin [Auricularia delicata TFB-10046 SS5]
 gb|KIM81538.1| hypothetical protein PILCRDRAFT_821319 [Piloderma croceum F 1598]
Length=305

 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  305



>ref|XP_007366816.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
 gb|EJF60398.1| polyubiquitin [Dichomitus squalens LYAD-421 SS1]
Length=305

 Score =   352 bits (902),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   348 bits (893),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR L+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRPLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (773),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGL  305



>ref|XP_009631616.1| PREDICTED: polyubiquitin-like [Nicotiana tomentosiformis]
Length=381

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDN+KAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNIKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   350 bits (897),  Expect = 4e-116, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K
Sbjct  120  IFAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   349 bits (895),  Expect = 1e-115, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVENSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDN+K 
Sbjct  121  FAGKQLEDGCTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNIKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_010324327.1| PREDICTED: polyubiquitin isoform X2 [Solanum lycopersicum]
Length=381

 Score =   354 bits (909),  Expect = 7e-118, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  381



>ref|XP_001764949.1| predicted protein [Physcomitrella patens]
 gb|EDQ70165.1| predicted protein [Physcomitrella patens]
Length=318

 Score =   352 bits (903),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 178/179 (99%), Positives = 178/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   351 bits (900),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 183/196 (93%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  240  TITLEVESSDTIDNVK  255


 Score =   312 bits (799),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 161/183 (88%), Positives = 164/183 (90%), Gaps = 5/183 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM+I   TL  K
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMEIIEDTLASK  315

Query  559  TIT  567
             IT
Sbjct  316  IIT  318


 Score = 55.1 bits (131),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/29 (93%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  526  MQIFVKTLTGKTITLEVESSDTIDNVKGQ  612
            MQIFVKTLTGKTITLEVESSDTIDNVK +
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAK  29


 Score = 36.6 bits (83),  Expect(2) = 5e-10, Method: Compositional matrix adjust.
 Identities = 20/35 (57%), Positives = 22/35 (63%), Gaps = 1/35 (3%)
 Frame = +3

Query  624  RXGIPPDQQXLIFAGKQLGGWAALLRITTSRKEST  728
            + GIPPDQQ LIFAGKQL     L      +KEST
Sbjct  33   KEGIPPDQQRLIFAGKQLEDGRTLADYNI-QKEST  66



>ref|NP_001053957.1| Os04g0628100 [Oryza sativa Japonica Group]
 dbj|BAF15871.1| Os04g0628100 [Oryza sativa Japonica Group]
Length=392

 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  76   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  130

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  131  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  190

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  191  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  250

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  251  TITLEVESSDTIDNVKAK  268


 Score =   354 bits (909),  Expect = 8e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  152  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  206

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  207  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  266

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  267  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  326

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  327  TITLEVESSDTIDNVKAK  344


 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 180/187 (96%), Positives = 183/187 (98%), Gaps = 1/187 (1%)
 Frame = +1

Query  52   SCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  231
            SC + +MQIFVKTLTGKTITLEVE SDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR
Sbjct  7    SCLF-QMQIFVKTLTGKTITLEVEFSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGR  65

Query  232  TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  411
            TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP
Sbjct  66   TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP  125

Query  412  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  591
            DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT
Sbjct  126  DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDT  185

Query  592  IDNVKGQ  612
            IDNVK +
Sbjct  186  IDNVKAK  192


 Score =   305 bits (780),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  228  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  282

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  283  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  342

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  343  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  392



>gb|AAB95252.1| ubiquitin [Arabidopsis thaliana]
Length=380

 Score =   354 bits (908),  Expect = 9e-118, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ L
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   349 bits (896),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ LI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQWLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (772),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY+IQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYDIQKESTLHLVLRLRGG  380



>ref|XP_010275241.1| PREDICTED: polyubiquitin-like [Nelumbo nucifera]
Length=383

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   352 bits (903),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKI DKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKILDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   352 bits (903),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKI DKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKILDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   304 bits (778),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|AAQ07453.1| ubiquitin [Musa acuminata AAA Group]
Length=381

 Score =   354 bits (908),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITL+VESSDTIDNVK +
Sbjct  240  TITLKVESSDTIDNVKAK  257


 Score =   353 bits (906),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITL+VESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLKVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   302 bits (774),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 155/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITL+VESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLKVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>gb|KJB81824.1| hypothetical protein B456_013G163500 [Gossypium raimondii]
Length=393

 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 186/197 (94%), Gaps = 5/197 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  66   TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  181  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  240

Query  562  ITLEVESSDTIDNVKGQ  612
            ITLEVESSDTIDNVK +
Sbjct  241  ITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/197 (93%), Positives = 186/197 (94%), Gaps = 5/197 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  142  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  196

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  197  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  256

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  561
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT
Sbjct  257  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKT  316

Query  562  ITLEVESSDTIDNVKGQ  612
            ITLEVESSDTIDNVK +
Sbjct  317  ITLEVESSDTIDNVKAK  333


 Score =   352 bits (902),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 179/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   281 bits (718),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 145/159 (91%), Positives = 148/159 (93%), Gaps = 5/159 (3%)
 Frame = +1

Query  22   SLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  201
            +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  218  TLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  272

Query  202  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  381
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA
Sbjct  273  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  332

Query  382  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTL  498
            KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKE+ L
Sbjct  333  KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKENPL  371



>ref|XP_003670049.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 ref|XP_003959063.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 ref|XP_004181533.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
 emb|CCD24806.1| hypothetical protein NDAI_0D04930 [Naumovozyma dairenensis CBS 
421]
 emb|CCF59928.1| hypothetical protein KAFR_0I01470 [Kazachstania africana CBS 
2517]
 emb|CCH62014.1| hypothetical protein TBLA_0G00670 [Tetrapisispora blattae CBS 
6284]
Length=229

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 3e-99, Method: Compositional matrix adjust.
 Identities = 153/170 (90%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGM
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGM  229



>gb|AAK68824.1| Unknown protein [Arabidopsis thaliana]
Length=229

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 178/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVK L GKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKPLPGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  229



>emb|CEP60563.1| LALA0S01e13784g1_1 [Lachancea lanzarotensis]
Length=229

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   299 bits (766),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG+
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGI  229



>ref|XP_007924320.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EHN05782.1| Ubi4p [Saccharomyces cerevisiae x Saccharomyces kudriavzevii 
VIN7]
 gb|EME83800.1| hypothetical protein MYCFIDRAFT_60610 [Pseudocercospora fijiensis 
CIRAD86]
 gb|EWH17145.1| Ubi4p [Saccharomyces cerevisiae P283]
Length=229

 Score =   348 bits (893),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|KII93501.1| hypothetical protein PLICRDRAFT_694663 [Plicaturopsis crispa 
FD-325 SS-3]
Length=348

 Score =   352 bits (904),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 181/195 (93%), Positives = 185/195 (95%), Gaps = 3/195 (2%)
 Frame = +1

Query  28   NLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  207
            N F    H+ S   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA
Sbjct  33   NPFKPTLHTPS---MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFA  89

Query  208  GKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  387
            GKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI
Sbjct  90   GKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKI  149

Query  388  QDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  567
            QDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT
Sbjct  150  QDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTIT  209

Query  568  LEVESSDTIDNVKGQ  612
            LEVESSDTIDNVK +
Sbjct  210  LEVESSDTIDNVKAK  224


 Score =   352 bits (903),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  108  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  162

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  163  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  222

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  223  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  282

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  283  TITLEVESSDTIDNVKAK  300


 Score =   301 bits (772),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  184  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  238

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  239  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  298

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  299  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  347



>ref|XP_010493589.1| PREDICTED: polyubiquitin-like [Camelina sativa]
Length=430

 Score =   355 bits (911),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  188  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  242

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  243  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  302

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  303  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  362

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  363  TITLEVESSDTIDNVKAK  380


 Score =   354 bits (909),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 179/183 (98%), Positives = 180/183 (98%), Gaps = 0/183 (0%)
 Frame = +1

Query  64   LKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  243
             KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD
Sbjct  46   FKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLAD  105

Query  244  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  423
            YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR
Sbjct  106  YNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQR  165

Query  424  LIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  603
            LIFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV
Sbjct  166  LIFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNV  225

Query  604  KGQ  612
            K +
Sbjct  226  KAK  228


 Score =   353 bits (905),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  112  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  166

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDG TLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  167  IFAGKQLEDGHTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  226

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  227  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  286

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  287  TITLEVESSDTIDNVKAK  304


 Score =   304 bits (779),  Expect = 1e-97, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  264  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  318

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  319  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  427



>gb|KJB62483.1| hypothetical protein B456_009G418900 [Gossypium raimondii]
Length=381

 Score =   353 bits (907),  Expect = 1e-117, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (903),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   350 bits (899),  Expect = 2e-116, Method: Compositional matrix adjust.
 Identities = 177/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   304 bits (779),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  380



>ref|XP_001931824.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 ref|XP_003305664.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 ref|XP_003854274.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 ref|XP_007275950.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 ref|XP_007376605.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 ref|XP_007674454.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 ref|XP_007741026.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 ref|XP_009261437.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 ref|XP_009650785.1| ubiquitin [Verticillium dahliae VdLs.17]
 ref|XP_011319955.1| ubiquitin [Fusarium graminearum PH-1]
 gb|EDU40929.1| ubiquitin [Pyrenophora tritici-repentis Pt-1C-BFP]
 gb|EFQ86204.1| hypothetical protein PTT_18575 [Pyrenophora teres f. teres 0-1]
 gb|EGP89250.1| hypothetical protein MYCGRDRAFT_57170 [Zymoseptoria tritici IPO323]
 gb|EGW31827.1| polyubiquitin [Spathaspora passalidarum NRRL Y-27907]
 gb|EGY14431.1| ubiquitin [Verticillium dahliae VdLs.17]
 gb|EHK44351.1| hypothetical protein TRIATDRAFT_300588 [Trichoderma atroviride 
IMI 206040]
 gb|EJT46666.1| hypothetical protein A1Q1_04737 [Trichosporon asahii var. asahii 
CBS 2479]
 gb|EKJ69797.1| hypothetical protein FPSE_10045 [Fusarium pseudograminearum CS3096]
 gb|ELA35078.1| ubiquitin [Colletotrichum gloeosporioides Nara gc5]
 gb|EMC98317.1| hypothetical protein BAUCODRAFT_32336 [Baudoinia compniacensis 
UAMH 10762]
 gb|EME45125.1| hypothetical protein DOTSEDRAFT_70987 [Dothistroma septosporum 
NZE10]
 gb|ENH81500.1| ubiquitin [Colletotrichum orbiculare MAFF 240422]
 gb|ESU14530.1| ubiquitin [Fusarium graminearum PH-1]
 emb|CDK27817.1| unnamed protein product [Kuraishia capsulata CBS 1993]
 gb|EXJ73926.1| ubiquitin C [Cladophialophora psammophila CBS 110553]
 gb|EYB28525.1| hypothetical protein FG05_08768 [Fusarium graminearum]
 gb|KEQ58801.1| ubiquitin [Aureobasidium melanogenum CBS 110374]
 gb|KEQ70291.1| ubiquitin [Aureobasidium pullulans var. namibiae CBS 147.97]
 gb|KEQ87814.1| ubiquitin [Aureobasidium pullulans EXF-150]
 gb|KER00813.1| hypothetical protein AUEXF2481DRAFT_25097 [Aureobasidium subglaciale 
EXF-2481]
 emb|CEF77191.1| unnamed protein product [Fusarium graminearum]
 gb|KIV95571.1| polyubiquitin [Exophiala mesophila]
 gb|KIW22916.1| polyubiquitin [Cladophialophora immunda]
 gb|KIW83318.1| polyubiquitin [Fonsecaea pedrosoi CBS 271.37]
 gb|KIW87781.1| polyubiquitin [Cladophialophora bantiana CBS 173.52]
 gb|KIX98997.1| polyubiquitin [Fonsecaea multimorphosa CBS 102226]
Length=229

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_719867.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 ref|XP_719750.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 emb|CAA76783.1| polyubiquitin [Candida albicans]
 gb|EAL00878.1| hypothetical protein CaO19.14063 [Candida albicans SC5314]
 gb|EAL01003.1| hypothetical protein CaO19.6771 [Candida albicans SC5314]
 gb|EEQ44747.1| hypothetical protein CAWG_03035 [Candida albicans WO-1]
 emb|CCE42351.1| hypothetical protein CPAR2_809000 [Candida parapsilosis]
 gb|EMG49099.1| hypothetical protein G210_0209 [Candida maltosa Xu316]
 gb|KHC79264.1| polyubiquitin [Candida albicans SC5314]
Length=229

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 152/170 (89%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>gb|AEG78435.1| ubiquitin C variant 3, partial [Epinephelus coioides]
Length=268

 Score =   349 bits (895),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 179/201 (89%), Positives = 186/201 (93%), Gaps = 5/201 (2%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  66   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRL  120

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVK
Sbjct  121  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVK  180

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  181  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  240

Query  559  TITLEVESSDTIDNVKGQDPG  621
            TITLEVE SDTI+NV GQDPG
Sbjct  241  TITLEVEPSDTIENVXGQDPG  261


 Score =   339 bits (869),  Expect = 2e-113, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 177/181 (98%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  2    MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  61

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  62   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLI  121

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE SDTI+NVK 
Sbjct  122  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKA  181

Query  610  Q  612
            +
Sbjct  182  K  182



>ref|XP_001797032.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
 gb|EAT86498.1| hypothetical protein SNOG_06667 [Phaeosphaeria nodorum SN15]
Length=234

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 4e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>gb|EPX74297.1| ubiquitin [Schizosaccharomyces octosporus yFS286]
Length=230

 Score =   348 bits (892),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 175/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (763),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  228



>ref|XP_001755307.1| predicted protein [Physcomitrella patens]
 gb|EDQ79787.1| predicted protein [Physcomitrella patens]
Length=305

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 183/196 (93%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  240  TITLEVESSDTIDNVK  255


 Score =   349 bits (896),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>ref|XP_002980153.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
 ref|XP_002991828.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ07090.1| hypothetical protein SELMODRAFT_162003 [Selaginella moellendorffii]
 gb|EFJ19023.1| hypothetical protein SELMODRAFT_271419 [Selaginella moellendorffii]
Length=306

 Score =   350 bits (899),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 183/196 (93%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  240  TITLEVESSDTIDNVK  255


 Score =   349 bits (896),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (769),  Expect = 7e-98, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 156/169 (92%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  304



>emb|CBY16339.1| unnamed protein product [Oikopleura dioica]
Length=188

 Score =   346 bits (887),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 171/181 (94%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVK 
Sbjct  121  FAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   213 bits (541),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 109/128 (85%), Positives = 116/128 (91%), Gaps = 5/128 (4%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVE+SDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVEASDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVE+SDTI+NVK
Sbjct  120  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEASDTIENVK  179

Query  379  AKIQDKEG  402
            AKIQDKE 
Sbjct  180  AKIQDKEA  187



>ref|XP_002953480.1| polyubiquitin [Volvox carteri f. nagariensis]
 gb|EFJ45453.1| polyubiquitin [Volvox carteri f. nagariensis]
Length=305

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTI+NVK +
Sbjct  240  TITLEVESSDTIENVKAK  257


 Score =   349 bits (896),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   302 bits (774),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 159/170 (94%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG+
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGL  305



>ref|XP_003052575.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU46862.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|ENH62031.1| Polyubiquitin [Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG38736.1| polyubiquitin [Fusarium verticillioides 7600]
 gb|EWY88137.1| ubiquitin C [Fusarium oxysporum FOSC 3-a]
 gb|EWZ87537.1| ubiquitin C [Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA41161.1| ubiquitin C [Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK33938.1| ubiquitin C [Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK99281.1| ubiquitin C [Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL44710.1| ubiquitin C [Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL88175.1| ubiquitin C [Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM08998.1| ubiquitin C [Fusarium oxysporum f. sp. cubense tropical race 
4 54006]
 gb|EXM34538.1| ubiquitin C [Fusarium oxysporum f. sp. vasinfectum 25433]
 gb|KIL89583.1| polyubiquitin [Fusarium avenaceum]
Length=305

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 180/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKSK  257


 Score =   349 bits (896),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 176/181 (97%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKS  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   298 bits (764),  Expect = 4e-97, Method: Compositional matrix adjust.
 Identities = 152/169 (90%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK+KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKSKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            +KIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  256  SKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  304



>ref|XP_006372519.1| polyubiquitin family protein [Populus trichocarpa]
 gb|ERP50316.1| polyubiquitin family protein [Populus trichocarpa]
Length=305

 Score =   350 bits (898),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 181/196 (92%), Positives = 183/196 (93%), Gaps = 5/196 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVK  606
            TITLEVESSDTIDNVK
Sbjct  240  TITLEVESSDTIDNVK  255


 Score =   349 bits (895),  Expect = 6e-117, Method: Compositional matrix adjust.
 Identities = 177/179 (99%), Positives = 177/179 (99%), Gaps = 0/179 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179


 Score =   300 bits (769),  Expect = 8e-98, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVK KIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKTKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
             KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  256  TKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  305



>gb|ACX46987.1| ubiquitin [Guzmania wittmackii x Guzmania lingulata]
Length=441

 Score =   355 bits (911),  Expect = 2e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  392  TITLEVESSDTIDNVKAK  409


 Score =   353 bits (907),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPP+QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPEQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   353 bits (906),  Expect = 1e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPP+QQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPEQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   258 bits (659),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 133/146 (91%), Positives = 135/146 (92%), Gaps = 5/146 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDG  456
            AKIQDKEGIPPDQQRLIFAGKQLEDG
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDG  433



>ref|XP_010436682.1| PREDICTED: polyubiquitin 4-like [Camelina sativa]
Length=462

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  145  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  199

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  200  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  259

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  260  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  319

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  320  TITLEVESSDTIDNVKAK  337


 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  221  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  275

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  276  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  335

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  336  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  395

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  396  TITLEVESSDTIDNVKAK  413


 Score =   353 bits (905),  Expect = 3e-116, Method: Compositional matrix adjust.
 Identities = 178/181 (98%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            +QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  81   IQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  140

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  141  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  200

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  201  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  260

Query  610  Q  612
            +
Sbjct  261  K  261


 Score =   321 bits (823),  Expect = 8e-104, Method: Compositional matrix adjust.
 Identities = 163/181 (90%), Positives = 172/181 (95%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQI  KTLT KTITL+V+SSDTI+NVKA+IQD+EGIP DQQRLIF+GK L+DG TLADYN
Sbjct  5    MQIHAKTLTEKTITLDVKSSDTINNVKAQIQDREGIPLDQQRLIFSGKLLDDGLTLADYN  64

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKES LHL LRLRGG+QIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  65   IQKESILHLALRLRGGIQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  124

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  125  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  184

Query  610  Q  612
            +
Sbjct  185  K  185


 Score =   305 bits (781),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  297  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  351

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  352  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  411

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  412  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  460



>gb|EGO00841.1| hypothetical protein SERLA73DRAFT_121253 [Serpula lacrymans var. 
lacrymans S7.3]
Length=371

 Score =   352 bits (904),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 181/198 (91%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  131  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  185

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  186  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  245

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  246  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  305

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  306  TITLEVESSDTIDNVKAK  323


 Score =   322 bits (826),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 170/198 (86%), Positives = 175/198 (88%), Gaps = 15/198 (8%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ  
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH-  118

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
                     GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  119  ---------GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  169

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  170  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGK  229

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  230  TITLEVESSDTIDNVKAK  247


 Score =   322 bits (824),  Expect = 3e-105, Method: Compositional matrix adjust.
 Identities = 166/181 (92%), Positives = 169/181 (93%), Gaps = 10/181 (6%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQ   
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQH--  118

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
                    GRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  119  --------GRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  170

Query  610  Q  612
            +
Sbjct  171  K  171


 Score =   302 bits (773),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 154/169 (91%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  207  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  261

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  262  IFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  321

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG
Sbjct  322  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGG  370



>gb|AIS40894.1| polyubiquitin [Kalanchoe fedtschenkoi]
Length=470

 Score =   356 bits (913),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/182 (99%), Positives = 181/182 (99%), Gaps = 0/182 (0%)
 Frame = +1

Query  67   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  246
            KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY
Sbjct  13   KMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADY  72

Query  247  NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  426
            NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  73   NIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  427  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  606
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192

Query  607  GQ  612
             +
Sbjct  193  AK  194


 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  78   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  132

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  133  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  192

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  193  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  252

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  253  TITLEVESSDTIDNVKAK  270


 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  154  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  208

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  209  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  268

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  269  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  328

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  329  TITLEVESSDTIDNVKAK  346


 Score =   355 bits (911),  Expect = 5e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  230  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  284

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  285  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  344

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  345  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  404

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  405  TITLEVESSDTIDNVKAK  422


 Score =   305 bits (780),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 156/169 (92%), Positives = 158/169 (93%), Gaps = 5/169 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  306  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  360

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  361  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  420

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  525
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG
Sbjct  421  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG  469



>gb|KDP42860.1| hypothetical protein JCGZ_23802 [Jatropha curcas]
Length=457

 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   355 bits (912),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  392  TITLEVESSDTIDNVKAK  409


 Score =   354 bits (909),  Expect = 7e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   301 bits (771),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 155/170 (91%), Positives = 157/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPP QQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPVQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



>ref|XP_010537590.1| PREDICTED: polyubiquitin 11 [Tarenaya hassleriana]
 ref|XP_010537592.1| PREDICTED: polyubiquitin 11 [Tarenaya hassleriana]
Length=229

 Score =   347 bits (890),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 180/206 (87%), Positives = 189/206 (92%), Gaps = 1/206 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTI+NVK+KIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIENVKSKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVKS  180

Query  610  QDPGQGXESPQISRXLSSPENSWEDG  687
            +   +   SP   R + + +   EDG
Sbjct  181  KIQDKEGISPDQQRLIFAGKQ-LEDG  205


 Score =   294 bits (752),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 150/170 (88%), Positives = 156/170 (92%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTI+NVK KIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIENVKTKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTI+NVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIENVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            +KIQDKEGI PDQQRLIFAGKQLEDGRTL+DYNIQKESTLHLVLRLRGG 
Sbjct  180  SKIQDKEGISPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGF  229



>ref|XP_010324326.1| PREDICTED: polyubiquitin isoform X1 [Solanum lycopersicum]
Length=457

 Score =   355 bits (911),  Expect = 3e-117, Method: Compositional matrix adjust.
 Identities = 183/198 (92%), Positives = 186/198 (94%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  65   STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  119

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  120  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  179

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  180  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  239

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  240  TITLEVESSDTIDNVKAK  257


 Score =   354 bits (909),  Expect = 8e-117, Method: Compositional matrix adjust.
 Identities = 179/181 (99%), Positives = 180/181 (99%), Gaps = 0/181 (0%)
 Frame = +1

Query  70   MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  249
            MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN
Sbjct  1    MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYN  60

Query  250  IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  429
            IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI
Sbjct  61   IQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRLI  120

Query  430  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKG  609
            FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK 
Sbjct  121  FAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVKA  180

Query  610  Q  612
            +
Sbjct  181  K  181


 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  141  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  195

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  196  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  255

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIP DQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  256  AKIQDKEGIPSDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  315

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  316  TITLEVESSDTIDNVKAK  333


 Score =   352 bits (903),  Expect = 6e-116, Method: Compositional matrix adjust.
 Identities = 182/198 (92%), Positives = 185/198 (93%), Gaps = 5/198 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIP DQQRL
Sbjct  217  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPSDQQRL  271

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  272  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  331

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  558
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK
Sbjct  332  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGK  391

Query  559  TITLEVESSDTIDNVKGQ  612
            TITLEVESSDTIDNVK +
Sbjct  392  TITLEVESSDTIDNVKAK  409


 Score =   305 bits (780),  Expect = 2e-97, Method: Compositional matrix adjust.
 Identities = 156/170 (92%), Positives = 158/170 (93%), Gaps = 5/170 (3%)
 Frame = +1

Query  19   CSLNLFYHLRHSCSYLKMQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  198
             +L+L   LR       MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL
Sbjct  293  STLHLVLRLRGG-----MQIFVKTLTGKTITLEVESSDTIDNVKAKIQDKEGIPPDQQRL  347

Query  199  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  378
            IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK
Sbjct  348  IFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVESSDTIDNVK  407

Query  379  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGM  528
            AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGG 
Sbjct  408  AKIQDKEGIPPDQQRLIFAGKQLEDGRTLADYNIQKESTLHLVLRLRGGF  457



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 1454382771890