BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B12

Length=542
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KDO87500.1|  hypothetical protein CISIN_1g027319mg                   166   1e-48   Citrus sinensis [apfelsine]
gb|KDO87501.1|  hypothetical protein CISIN_1g027319mg                   166   2e-48   Citrus sinensis [apfelsine]
ref|XP_010242542.1|  PREDICTED: uncharacterized protein LOC104586868    167   5e-48   Nelumbo nucifera [Indian lotus]
gb|KDO87499.1|  hypothetical protein CISIN_1g027319mg                   166   1e-47   Citrus sinensis [apfelsine]
ref|XP_006444158.1|  hypothetical protein CICLE_v10022169mg             166   1e-47   Citrus clementina [clementine]
ref|XP_002273337.1|  PREDICTED: uncharacterized protein LOC100240873    162   5e-46   Vitis vinifera
ref|XP_011079792.1|  PREDICTED: uncharacterized protein LOC105163222    160   3e-45   Sesamum indicum [beniseed]
ref|XP_009764088.1|  PREDICTED: uncharacterized protein LOC104215861    156   9e-44   Nicotiana sylvestris
ref|XP_004148871.1|  PREDICTED: uncharacterized protein LOC101218251    155   2e-43   Cucumis sativus [cucumbers]
ref|XP_008451405.1|  PREDICTED: uncharacterized protein LOC103492708    154   6e-43   Cucumis melo [Oriental melon]
ref|XP_011033669.1|  PREDICTED: uncharacterized protein LOC105132080    154   8e-43   Populus euphratica
ref|XP_002524796.1|  conserved hypothetical protein                     152   3e-42   Ricinus communis
ref|XP_002320387.2|  hypothetical protein POPTR_0014s13350g             152   3e-42   
ref|XP_007162384.1|  hypothetical protein PHAVU_001G147500g             149   5e-41   Phaseolus vulgaris [French bean]
ref|XP_010938883.1|  PREDICTED: uncharacterized protein LOC105057862    149   1e-40   
gb|KDP21518.1|  hypothetical protein JCGZ_21989                         147   3e-40   Jatropha curcas
ref|XP_006576881.1|  PREDICTED: uncharacterized protein LOC100795293    147   4e-40   Glycine max [soybeans]
ref|XP_009617107.1|  PREDICTED: uncharacterized protein LOC104109492    146   5e-40   Nicotiana tomentosiformis
gb|KJB23159.1|  hypothetical protein B456_004G084200                    145   5e-40   Gossypium raimondii
ref|XP_010038137.1|  PREDICTED: uncharacterized protein LOC104426699    146   6e-40   Eucalyptus grandis [rose gum]
gb|KHG20786.1|  Tetraspanin-31-B                                        145   1e-39   Gossypium arboreum [tree cotton]
gb|KJB23158.1|  hypothetical protein B456_004G084200                    145   2e-39   Gossypium raimondii
ref|XP_003554235.1|  PREDICTED: uncharacterized protein LOC100775266    145   3e-39   Glycine max [soybeans]
ref|XP_008648241.1|  PREDICTED: uncharacterized protein LOC100501...    146   3e-39   
ref|XP_004962134.1|  PREDICTED: uncharacterized protein LOC101762...    143   1e-38   
emb|CDP04242.1|  unnamed protein product                                144   1e-38   Coffea canephora [robusta coffee]
ref|XP_004962135.1|  PREDICTED: uncharacterized protein LOC101762...    143   1e-38   Setaria italica
ref|XP_009412178.1|  PREDICTED: uncharacterized protein LOC103993732    142   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010683572.1|  PREDICTED: uncharacterized protein LOC104898223    141   5e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008234927.1|  PREDICTED: uncharacterized protein LOC103333814    140   1e-37   Prunus mume [ume]
ref|XP_007050707.1|  Resistance to phytophthora 1 isoform 2             140   2e-37   
ref|XP_007050706.1|  Resistance to phytophthora 1 isoform 1             140   2e-37   
ref|XP_006654383.1|  PREDICTED: uncharacterized protein LOC102699685    140   2e-37   Oryza brachyantha
gb|KCW49950.1|  hypothetical protein EUGRSUZ_K03409                     138   2e-37   Eucalyptus grandis [rose gum]
ref|XP_008812255.1|  PREDICTED: uncharacterized protein LOC103723196    139   2e-37   
ref|XP_002441071.1|  hypothetical protein SORBIDRAFT_09g019840          140   3e-37   Sorghum bicolor [broomcorn]
ref|XP_009356720.1|  PREDICTED: uncharacterized protein LOC103947536    139   3e-37   Pyrus x bretschneideri [bai li]
ref|XP_007201514.1|  hypothetical protein PRUPE_ppa015205mg             139   4e-37   Prunus persica
ref|XP_004493635.1|  PREDICTED: uncharacterized protein LOC101494764    138   5e-37   Cicer arietinum [garbanzo]
ref|XP_004290691.1|  PREDICTED: uncharacterized protein LOC101300872    138   5e-37   Fragaria vesca subsp. vesca
ref|XP_010090342.1|  hypothetical protein L484_025007                   139   6e-37   Morus notabilis
ref|XP_008366555.1|  PREDICTED: uncharacterized protein LOC103430...    138   9e-37   Malus domestica [apple tree]
ref|XP_008368885.1|  PREDICTED: uncharacterized protein LOC103432465    138   1e-36   Malus domestica [apple tree]
gb|KEH23700.1|  resistance to phytophthora protein, putative            137   1e-36   Medicago truncatula
ref|XP_008366556.1|  PREDICTED: uncharacterized protein LOC103430...    137   1e-36   Malus domestica [apple tree]
ref|NP_001055503.1|  Os05g0404400                                       138   1e-36   
ref|XP_004239692.1|  PREDICTED: uncharacterized protein LOC101259047    137   2e-36   Solanum lycopersicum
ref|XP_006850863.1|  hypothetical protein AMTR_s00025p00143860          137   3e-36   Amborella trichopoda
ref|XP_003568495.1|  PREDICTED: uncharacterized protein LOC100821919    137   4e-36   Brachypodium distachyon [annual false brome]
ref|XP_006345816.1|  PREDICTED: uncharacterized protein LOC102592434    136   4e-36   Solanum tuberosum [potatoes]
gb|EYU46632.1|  hypothetical protein MIMGU_mgv1a013097mg                135   1e-35   Erythranthe guttata [common monkey flower]
gb|ABK26624.1|  unknown                                                 134   2e-35   Picea sitchensis
ref|XP_002880341.1|  predicted protein                                  131   1e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_006397998.1|  hypothetical protein EUTSA_v10001627mg             132   2e-34   Eutrema salsugineum [saltwater cress]
dbj|BAJ91408.1|  predicted protein                                      132   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ92442.1|  predicted protein                                      132   2e-34   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010552792.1|  PREDICTED: uncharacterized protein LOC104823061    130   1e-33   Tarenaya hassleriana [spider flower]
ref|NP_566122.1|  protein RESISTANCE TO PHYTOPHTHORA 1                  127   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189776.1|  protein RESISTANCE TO PHYTOPHTHORA 1               128   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010506853.1|  PREDICTED: uncharacterized protein LOC104783393    126   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_006294741.1|  hypothetical protein CARUB_v10023786mg             126   4e-32   
ref|XP_009142482.1|  PREDICTED: uncharacterized protein LOC103866331    125   5e-32   Brassica rapa
emb|CDY55190.1|  BnaCnng28340D                                          125   7e-32   Brassica napus [oilseed rape]
ref|XP_006294740.1|  hypothetical protein CARUB_v10023786mg             126   1e-31   
ref|XP_010497174.1|  PREDICTED: uncharacterized protein LOC104774213    115   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_002963539.1|  hypothetical protein SELMODRAFT_165828             115   3e-28   Selaginella moellendorffii
ref|XP_002981540.1|  hypothetical protein SELMODRAFT_178970             114   4e-28   
ref|XP_001785690.1|  predicted protein                                  108   2e-26   
ref|XP_002506207.1|  hypothetical protein MICPUN_109491               98.6    7e-22   Micromonas commoda
gb|KJB23157.1|  hypothetical protein B456_004G084200                  98.2    9e-22   Gossypium raimondii
ref|XP_003056689.1|  predicted protein                                92.4    2e-19   Micromonas pusilla CCMP1545
ref|XP_005849445.1|  hypothetical protein CHLNCDRAFT_13259            89.4    4e-19   Chlorella variabilis
ref|XP_005647446.1|  hypothetical protein COCSUDRAFT_16364            89.0    8e-19   Coccomyxa subellipsoidea C-169
ref|XP_002954628.1|  hypothetical protein VOLCADRAFT_82900            90.5    9e-19   Volvox carteri f. nagariensis
ref|XP_001419802.1|  predicted protein                                89.0    2e-18   Ostreococcus lucimarinus CCE9901
ref|XP_007510705.1|  predicted protein                                89.7    2e-18   Bathycoccus prasinos
ref|XP_001695624.1|  hypothetical protein CHLREDRAFT_184621           89.4    3e-18   Chlamydomonas reinhardtii
emb|CEF99111.1|  unnamed product                                      82.4    4e-16   Ostreococcus tauri
ref|NP_001183496.1|  uncharacterized protein LOC100501929             56.2    2e-07   
ref|XP_003081280.1|  unnamed protein product                          57.0    1e-06   



>gb|KDO87500.1| hypothetical protein CISIN_1g027319mg [Citrus sinensis]
Length=160

 Score =   166 bits (421),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGD  239
            MN L+ + SP+ S  + KFP    +LRN +   +F G S + +AS+N +D +   E    
Sbjct  1    MNTLIISTSPY-SCHVSKFP----LLRNRLCWPKFRGTSLKIQASANEVDAQATVEESSQ  55

Query  240  SAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVP  419
            + E   E ++ +K          S+T  PALDK+LKKVVQKTAATFAPRASTA+KNPAVP
Sbjct  56   NEEPLPEPKETNK---------LSSTAPPALDKDLKKVVQKTAATFAPRASTATKNPAVP  106

Query  420  GTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            GT LYTVFEVQGY SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  107  GTILYTVFEVQGYASMLLGGALSFNLIFPSNEPDIWRLMGM  147



>gb|KDO87501.1| hypothetical protein CISIN_1g027319mg [Citrus sinensis]
Length=167

 Score =   166 bits (421),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGD  239
            MN L+ + SP+ S  + KFP    +LRN +   +F G S + +AS+N +D +   E    
Sbjct  1    MNTLIISTSPY-SCHVSKFP----LLRNRLCWPKFRGTSLKIQASANEVDAQATVEESSQ  55

Query  240  SAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVP  419
            + E   E ++ +K          S+T  PALDK+LKKVVQKTAATFAPRASTA+KNPAVP
Sbjct  56   NEEPLPEPKETNK---------LSSTAPPALDKDLKKVVQKTAATFAPRASTATKNPAVP  106

Query  420  GTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            GT LYTVFEVQGY SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  107  GTILYTVFEVQGYASMLLGGALSFNLIFPSNEPDIWRLMGM  147



>ref|XP_010242542.1| PREDICTED: uncharacterized protein LOC104586868 [Nelumbo nucifera]
Length=221

 Score =   167 bits (422),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 89/161 (55%), Positives = 111/161 (69%), Gaps = 11/161 (7%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGD  239
            M AL+S  S ++ +S  +FP++  +LRN  +  +F   + + RASS+G D    EE    
Sbjct  1    MQALISNVSCYSHVS--RFPTTFPILRNDSYDTRFRRTTIKIRASSDGADTPTAEER---  55

Query  240  SAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVP  419
                  E E ES  +   S  +  ++  PA+DK++KKVVQKTAATFAPRASTA+KNPAVP
Sbjct  56   ------EGELESPDSKEESRNSNPSSTAPAIDKDIKKVVQKTAATFAPRASTATKNPAVP  109

Query  420  GTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            GTTLYTVFE+QGY SML GG LSFNLIFPSNEP IWRLMGM
Sbjct  110  GTTLYTVFELQGYASMLFGGVLSFNLIFPSNEPDIWRLMGM  150



>gb|KDO87499.1| hypothetical protein CISIN_1g027319mg [Citrus sinensis]
Length=225

 Score =   166 bits (421),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGD  239
            MN L+ + SP+ S  + KFP    +LRN +   +F G S + +AS+N +D +   E    
Sbjct  1    MNTLIISTSPY-SCHVSKFP----LLRNRLCWPKFRGTSLKIQASANEVDAQATVEESSQ  55

Query  240  SAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVP  419
            + E   E ++ +K          S+T  PALDK+LKKVVQKTAATFAPRASTA+KNPAVP
Sbjct  56   NEEPLPEPKETNK---------LSSTAPPALDKDLKKVVQKTAATFAPRASTATKNPAVP  106

Query  420  GTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            GT LYTVFEVQGY SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  107  GTILYTVFEVQGYASMLLGGALSFNLIFPSNEPDIWRLMGM  147



>ref|XP_006444158.1| hypothetical protein CICLE_v10022169mg [Citrus clementina]
 ref|XP_006479791.1| PREDICTED: uncharacterized protein LOC102608626 [Citrus sinensis]
 gb|ESR57398.1| hypothetical protein CICLE_v10022169mg [Citrus clementina]
 gb|KDO87498.1| hypothetical protein CISIN_1g027319mg [Citrus sinensis]
Length=218

 Score =   166 bits (420),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 93/161 (58%), Positives = 112/161 (70%), Gaps = 14/161 (9%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGD  239
            MN L+ + SP+ S  + KFP    +LRN +   +F G S + +AS+N +D +   E    
Sbjct  1    MNTLIISTSPY-SCHVSKFP----LLRNRLCWPKFRGTSLKIQASANEVDAQATVEESSQ  55

Query  240  SAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVP  419
            + E   E ++ +K          S+T  PALDK+LKKVVQKTAATFAPRASTA+KNPAVP
Sbjct  56   NEEPLPEPKETNK---------LSSTAPPALDKDLKKVVQKTAATFAPRASTATKNPAVP  106

Query  420  GTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            GT LYTVFEVQGY SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  107  GTILYTVFEVQGYASMLLGGALSFNLIFPSNEPDIWRLMGM  147



>ref|XP_002273337.1| PREDICTED: uncharacterized protein LOC100240873 [Vitis vinifera]
 emb|CBI32315.3| unnamed protein product [Vitis vinifera]
Length=215

 Score =   162 bits (409),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 100/128 (78%), Gaps = 11/128 (9%)
 Frame = +3

Query  159  QFWGKSSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDK  338
            QF  K++R  A+SN +D +  EE        + E+E ++ GA++IS  +++    PALDK
Sbjct  28   QFRTKTTRIHANSNEVDTQTVEE--------RTEEESQNNGASNISTPSSTA---PALDK  76

Query  339  ELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEP  518
            +LKKVVQKTAATFAPRASTA+KNPAVPGT LYTVFEVQGY+SMLLGGALSFN +FPSNEP
Sbjct  77   DLKKVVQKTAATFAPRASTATKNPAVPGTVLYTVFEVQGYLSMLLGGALSFNFLFPSNEP  136

Query  519  XIWRLMGM  542
             IWRLMGM
Sbjct  137  DIWRLMGM  144



>ref|XP_011079792.1| PREDICTED: uncharacterized protein LOC105163222 [Sesamum indicum]
Length=229

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 104/143 (73%), Gaps = 4/143 (3%)
 Frame = +3

Query  117  PSSPLVLRN-GVFRAQFWGKSSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSI  293
            P+  L  RN    R  F  +  R RASSN L+ + E+    D  +  V+ E+E++  + I
Sbjct  19   PTQCLFPRNLAQIRTGFQFRGFRIRASSNELETETEKWSEKDLDQEPVK-ERETQETSKI  77

Query  294  SNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLL  473
            S+G  S    PALDK+LKKVVQKTAATFAPRASTASKNPAVPGT LYTVFEVQGY S+L+
Sbjct  78   SSGPTSAA--PALDKDLKKVVQKTAATFAPRASTASKNPAVPGTVLYTVFEVQGYASLLV  135

Query  474  GGALSFNLIFPSNEPXIWRLMGM  542
            GGALSFNLIFPSNEP IWRLMGM
Sbjct  136  GGALSFNLIFPSNEPDIWRLMGM  158



>ref|XP_009764088.1| PREDICTED: uncharacterized protein LOC104215861 [Nicotiana sylvestris]
Length=230

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 95/165 (58%), Positives = 110/165 (67%), Gaps = 18/165 (11%)
 Frame = +3

Query  75   SAASPFTSISILKF--PSSPLVLRNGVFRAQFWGKSSRF--RASSNGLDKKVEEEGLGDS  242
            S ++   +  ILKF  P S + L++ +      GKS R    ASSN LDK++ E+   + 
Sbjct  5    SMSASVLNCQILKFLPPKSSIFLKSPLLS----GKSCRLCVSASSNELDKQLIEDPKEEI  60

Query  243  AETK----VEDEQESKGANSISNGAASTTINPALD-KELKKVVQKTAATFAPRASTASKN  407
             E      +  E+E +G NS S G      N  LD KELKK V KTAATFAPRASTA+KN
Sbjct  61   QEKTNGVIINSEEERRGENSTSTGP-----NAVLDNKELKKAVLKTAATFAPRASTATKN  115

Query  408  PAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            PAVPGT LYTVFEVQGYVSMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  116  PAVPGTVLYTVFEVQGYVSMLLGGALSFNLIFPSNEPDIWRLMGM  160



>ref|XP_004148871.1| PREDICTED: uncharacterized protein LOC101218251 [Cucumis sativus]
 ref|XP_004158931.1| PREDICTED: uncharacterized protein LOC101231741 [Cucumis sativus]
 gb|KGN44856.1| hypothetical protein Csa_7G392290 [Cucumis sativus]
Length=221

 Score =   155 bits (392),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 91/123 (74%), Gaps = 11/123 (9%)
 Frame = +3

Query  174  SSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKV  353
            S R RA+SN L  +  EE   +      E +Q++K +++           PALDK+LKKV
Sbjct  35   SHRLRANSNDLQTQAVEEPKEEENGIAAEPQQQTKASSA-----------PALDKDLKKV  83

Query  354  VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRL  533
            VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGY SMLLGG LSFNL+FPSNEP IWRL
Sbjct  84   VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYASMLLGGVLSFNLLFPSNEPDIWRL  143

Query  534  MGM  542
            MGM
Sbjct  144  MGM  146



>ref|XP_008451405.1| PREDICTED: uncharacterized protein LOC103492708 [Cucumis melo]
Length=221

 Score =   154 bits (388),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 90/123 (73%), Gaps = 11/123 (9%)
 Frame = +3

Query  174  SSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKV  353
            S R RA+SN L  +  EE   +      E +Q +K +++           PALDK+LKKV
Sbjct  35   SHRLRANSNHLQTQAIEEPKEEENGIAAEPQQLTKASSA-----------PALDKDLKKV  83

Query  354  VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRL  533
            VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGY SMLLGG LSFNL+FPSNEP IWRL
Sbjct  84   VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYASMLLGGVLSFNLLFPSNEPDIWRL  143

Query  534  MGM  542
            MGM
Sbjct  144  MGM  146



>ref|XP_011033669.1| PREDICTED: uncharacterized protein LOC105132080 [Populus euphratica]
Length=227

 Score =   154 bits (388),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 93/168 (55%), Positives = 115/168 (68%), Gaps = 19/168 (11%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSP----LVLRNGVFRAQFWGKSS---RFRASSNGLDKKV  218
            MNAL+S+++   +  ILK  S P    L L       Q+ G  S   R RAS+N  +   
Sbjct  1    MNALLSSSTSLCNSHILKLTSKPTSFRLSLPCNTNTTQYLGCDSLSLRRRASNNANEV--  58

Query  219  EEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTA  398
                  D+  TK  ++Q ++ +N +S+ +++     ALDK+LKKVVQKTAATFAPRASTA
Sbjct  59   ------DTQTTK--EDQATETSNQVSSSSSAAPP--ALDKDLKKVVQKTAATFAPRASTA  108

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            +KNPAVPGTTLYTVFEVQGYV MLLGGALSFNLIFPSN+P IWRLMGM
Sbjct  109  TKNPAVPGTTLYTVFEVQGYVCMLLGGALSFNLIFPSNDPDIWRLMGM  156



>ref|XP_002524796.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF37639.1| conserved hypothetical protein [Ricinus communis]
Length=228

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 86/163 (53%), Positives = 113/163 (69%), Gaps = 8/163 (5%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFP--SSPLVLRNGVFRAQFWGKSSRFRASSNGLDKKVEEEGL  233
            MN+L+S  S F +  I K P  S+    R+ +       K+ + RA++N +D ++  E  
Sbjct  1    MNSLVS--SSFCNYHITKLPLTSTRFRCRHSLCNTHLSIKNLKVRANTNEVDTQIAAE--  56

Query  234  GDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPA  413
               +E +++ E++    + +S+ ++ST     +DK+LKK VQKTAATFAPRASTA+KNPA
Sbjct  57   --ESEQELKLEEKLNETSKVSSSSSSTVPALDIDKDLKKAVQKTAATFAPRASTATKNPA  114

Query  414  VPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VPGT LYTVFEVQGY SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  115  VPGTALYTVFEVQGYASMLLGGALSFNLIFPSNEPDIWRLMGM  157



>ref|XP_002320387.2| hypothetical protein POPTR_0014s13350g [Populus trichocarpa]
 gb|EEE98702.2| hypothetical protein POPTR_0014s13350g [Populus trichocarpa]
Length=227

 Score =   152 bits (385),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 115/168 (68%), Gaps = 19/168 (11%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSP----LVLRNGVFRAQFWGKSS---RFRASSNGLDKKV  218
            MNAL+S+++   +  ILK  S P    L L       ++ G  S   R RAS+N    +V
Sbjct  1    MNALLSSSTSLCNSHILKLTSKPTSFRLSLPCNTNTTRYLGCDSLSLRIRASNNA--NEV  58

Query  219  EEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTA  398
            + +          +++Q ++ +N +S+ +++     A+DK+LKKVVQKTAATFAPRASTA
Sbjct  59   DTQ--------TAKEDQATETSNQVSSSSSAAPP--AIDKDLKKVVQKTAATFAPRASTA  108

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            +KNPAVPGTTLYTVFEVQGYV MLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  109  TKNPAVPGTTLYTVFEVQGYVCMLLGGALSFNLIFPSNEPDIWRLMGM  156



>ref|XP_007162384.1| hypothetical protein PHAVU_001G147500g [Phaseolus vulgaris]
 gb|ESW34378.1| hypothetical protein PHAVU_001G147500g [Phaseolus vulgaris]
Length=237

 Score =   149 bits (376),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 92/119 (77%), Gaps = 11/119 (9%)
 Frame = +3

Query  186  RASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKT  365
            RA+S+ +D ++  E L +  ET VE++         +N   ++T +  +DKELKKV QKT
Sbjct  59   RAASDEVDTQIVTEELAE--ETNVEEK---------TNKENTSTFSAPIDKELKKVAQKT  107

Query  366  AATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AATFAPRASTASKNPAVPG+ LYTVFEVQGYVSMLLGGALSFNLIFPS+EP IWRLMGM
Sbjct  108  AATFAPRASTASKNPAVPGSVLYTVFEVQGYVSMLLGGALSFNLIFPSDEPDIWRLMGM  166



>ref|XP_010938883.1| PREDICTED: uncharacterized protein LOC105057862 [Elaeis guineensis]
Length=256

 Score =   149 bits (375),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 88/163 (54%), Positives = 105/163 (64%), Gaps = 12/163 (7%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGVFRAQFWGKSSRFRAS--SNGLDKKVEEEGL  233
            M +L S   P +S  I KF +   +LR    +A F G+ +R RA   S+GLD    +EG 
Sbjct  33   MYSLYSITVPCSS-KISKFSTIFPILRPSSHQATF-GRRTRVRAEARSDGLDTSTVQEG-  89

Query  234  GDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPA  413
                    E ++    +NS        +  P +DK LKKVVQKTA+TFAPRASTA+KNPA
Sbjct  90   -------SEQQEAESSSNSKPKPPPLPSAAPDIDKNLKKVVQKTASTFAPRASTATKNPA  142

Query  414  VPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VPGT LYT+FEVQGY SML GGALSFNLIFPSNEP IWRLMGM
Sbjct  143  VPGTALYTLFEVQGYASMLFGGALSFNLIFPSNEPDIWRLMGM  185



>gb|KDP21518.1| hypothetical protein JCGZ_21989 [Jatropha curcas]
Length=223

 Score =   147 bits (370),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 89/167 (53%), Positives = 106/167 (63%), Gaps = 21/167 (13%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKFPSSPLVLRNGV------FRAQFWGKSSRFRASSNGLDKKVE  221
            MN+L+S  S   +  I K P +   LR G         AQ   K+ +  A++N +D +  
Sbjct  1    MNSLIS--SSLCNCHISKLPLTRTRLRYGHRYNFCNINAQIPSKNLKISANTNEVDTQTL  58

Query  222  EEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTAS  401
            EE   +  + +  DE             AS    PA+DKELKK VQKTAATFAPRASTA+
Sbjct  59   EESEQELEQEQEPDE-------------ASKVSAPAIDKELKKAVQKTAATFAPRASTAT  105

Query  402  KNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            KNPAVPGT LYTVFEVQGYVS+LLGGALSFN+IFPSNEP IWRLMGM
Sbjct  106  KNPAVPGTALYTVFEVQGYVSLLLGGALSFNIIFPSNEPDIWRLMGM  152



>ref|XP_006576881.1| PREDICTED: uncharacterized protein LOC100795293 [Glycine max]
 gb|KHN19856.1| hypothetical protein glysoja_033488 [Glycine soja]
Length=239

 Score =   147 bits (370),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 77/119 (65%), Positives = 89/119 (75%), Gaps = 9/119 (8%)
 Frame = +3

Query  186  RASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKT  365
            RA+S+ +D +   E L  S E KVE+       N+       +T +  +DKELKKV QKT
Sbjct  59   RATSDEVDTQTVVEEL--SEENKVEENTNEDNTNT-------STFSAPIDKELKKVAQKT  109

Query  366  AATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AATFAPRASTA+KNPAVPGT LY+VFEVQGYVSMLLGGALSFNLIFPS+EP IWRLMGM
Sbjct  110  AATFAPRASTATKNPAVPGTVLYSVFEVQGYVSMLLGGALSFNLIFPSDEPDIWRLMGM  168



>ref|XP_009617107.1| PREDICTED: uncharacterized protein LOC104109492 [Nicotiana tomentosiformis]
Length=230

 Score =   146 bits (369),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 90/165 (55%), Positives = 105/165 (64%), Gaps = 18/165 (11%)
 Frame = +3

Query  75   SAASPFTSISILKF--PSSPLVLRNGVFRAQFWGKSSRF--RASSNGLDKKVEEEGLGDS  242
            S ++   +  ILKF  P   + L++ +       KS R    ASSN LDK++ E+   + 
Sbjct  5    SMSASVLNCQILKFLPPKKTIFLKSPLLNV----KSCRLCVSASSNELDKQIIEDPKEEI  60

Query  243  AETK----VEDEQESKGANSISNGAASTTINPALD-KELKKVVQKTAATFAPRASTASKN  407
             E      +  E+E +G NS S G      N  LD KELKK V KTAATFAPRASTA+KN
Sbjct  61   EEKTNGVIINSEEERRGENSTSFGP-----NAVLDNKELKKAVLKTAATFAPRASTATKN  115

Query  408  PAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            PAVPGT LYTVFEVQ Y SM LGGALSFNLIFPSNEP IWRLMGM
Sbjct  116  PAVPGTVLYTVFEVQAYASMFLGGALSFNLIFPSNEPDIWRLMGM  160



>gb|KJB23159.1| hypothetical protein B456_004G084200 [Gossypium raimondii]
Length=198

 Score =   145 bits (367),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 7/95 (7%)
 Frame = +3

Query  258  EDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYT  437
            E  +ESK  +S    A STT    LDK+LKKVVQKTAATFAPRASTA+KNPAVPGTTLYT
Sbjct  68   EPRKESKSISS----ATSTT---PLDKDLKKVVQKTAATFAPRASTATKNPAVPGTTLYT  120

Query  438  VFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VFEVQGYVS+LLGGALSFNLIFPSNEP IWRLMGM
Sbjct  121  VFEVQGYVSLLLGGALSFNLIFPSNEPDIWRLMGM  155



>ref|XP_010038137.1| PREDICTED: uncharacterized protein LOC104426699 [Eucalyptus grandis]
 gb|KCW49949.1| hypothetical protein EUGRSUZ_K03409 [Eucalyptus grandis]
Length=226

 Score =   146 bits (369),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 110/159 (69%), Gaps = 17/159 (11%)
 Frame = +3

Query  93   TSISILKFPS----SPLVLRNGVFRAQFWGKSSRFR---ASSNGLDKK-VEEEGLGDSAE  248
            TSI   + P     S  +LRNGV       +S  F+   +SSN ++ + V E+G G    
Sbjct  5    TSICACRLPPNVAPSSFLLRNGVPGPPR-RRSRSFKIVASSSNEVEARAVAEQGGG----  59

Query  249  TKVEDEQESKGANSISNGAASTTI-NPALDKELKKVVQKTAATFAPRASTASKNPAVPGT  425
               E ++E+ G++     + ST+  N AL+K+LKKVVQKTA+TFAPRASTASKNPAVPGT
Sbjct  60   ---EKQEEAAGSDGPDRPSTSTSASNAALEKDLKKVVQKTASTFAPRASTASKNPAVPGT  116

Query  426  TLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
             LYTVFEVQGY S+LLGGALSFNL+FPSNEP IWRLMGM
Sbjct  117  ALYTVFEVQGYASLLLGGALSFNLLFPSNEPDIWRLMGM  155



>gb|KHG20786.1| Tetraspanin-31-B [Gossypium arboreum]
Length=222

 Score =   145 bits (366),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 7/95 (7%)
 Frame = +3

Query  258  EDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYT  437
            E  +ESK  +S    A STT    LDK+LKKVVQKTAATFAPRASTA+KNPAVPGTTLYT
Sbjct  64   EPRKESKSISS----ATSTT---PLDKDLKKVVQKTAATFAPRASTATKNPAVPGTTLYT  116

Query  438  VFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VFEVQGYVS+LLGGALSFNLIFPSNEP IWRLMGM
Sbjct  117  VFEVQGYVSLLLGGALSFNLIFPSNEPDIWRLMGM  151



>gb|KJB23158.1| hypothetical protein B456_004G084200 [Gossypium raimondii]
Length=226

 Score =   145 bits (366),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/95 (80%), Positives = 81/95 (85%), Gaps = 7/95 (7%)
 Frame = +3

Query  258  EDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYT  437
            E  +ESK  +S    A STT    LDK+LKKVVQKTAATFAPRASTA+KNPAVPGTTLYT
Sbjct  68   EPRKESKSISS----ATSTT---PLDKDLKKVVQKTAATFAPRASTATKNPAVPGTTLYT  120

Query  438  VFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VFEVQGYVS+LLGGALSFNLIFPSNEP IWRLMGM
Sbjct  121  VFEVQGYVSLLLGGALSFNLIFPSNEPDIWRLMGM  155



>ref|XP_003554235.1| PREDICTED: uncharacterized protein LOC100775266 [Glycine max]
 gb|KHN45384.1| hypothetical protein glysoja_028391 [Glycine soja]
Length=236

 Score =   145 bits (365),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 75/119 (63%), Positives = 88/119 (74%), Gaps = 11/119 (9%)
 Frame = +3

Query  186  RASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKT  365
            RA+S+ +D            +T VE+  E K     +N   ++T +  +DKELKKV QKT
Sbjct  58   RATSDEVD-----------TQTVVEELAEEKKVEENTNEDNTSTFSSPIDKELKKVAQKT  106

Query  366  AATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AATFAPRASTA+KNPAVPGT LY+VFEVQGYVSMLLGGALSFNLIFPS+EP IWRLMGM
Sbjct  107  AATFAPRASTATKNPAVPGTVLYSVFEVQGYVSMLLGGALSFNLIFPSDEPDIWRLMGM  165



>ref|XP_008648241.1| PREDICTED: uncharacterized protein LOC100501929 isoform X1 [Zea 
mays]
Length=304

 Score =   146 bits (369),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 90/123 (73%), Gaps = 4/123 (3%)
 Frame = +3

Query  186  RASSNGLDK---KVEEEGLGDSAETKVEDEQES-KGANSISNGAASTTINPALDKELKKV  353
            RAS NG        E   +GD+ E +     E+   A+  SN      ++P ++KELKKV
Sbjct  111  RASYNGSGSGAAAAEPSTVGDTLEREEGGGTEAGASADESSNRKQPPPVDPKIEKELKKV  170

Query  354  VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRL  533
            VQKTAATFAPRAST +KNPAVPG+TLYTVFEVQGYVSMLLGGALSFNLIFPSNEP IWRL
Sbjct  171  VQKTAATFAPRASTKTKNPAVPGSTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPDIWRL  230

Query  534  MGM  542
            MGM
Sbjct  231  MGM  233



>ref|XP_004962134.1| PREDICTED: uncharacterized protein LOC101762415 isoform X1 [Setaria 
italica]
Length=246

 Score =   143 bits (361),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  231  LGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNP  410
            +GDS E +     E   +   S G     ++P ++KELKK VQKTAATFAPRAST +KNP
Sbjct  65   VGDSLEREEGGGGEGVASADSSAGKQPPPVDPKIEKELKKAVQKTAATFAPRASTKTKNP  124

Query  411  AVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AVPGTTLY+VFEVQGYVSMLLGGALSFNL+FPSNEP IWRLMGM
Sbjct  125  AVPGTTLYSVFEVQGYVSMLLGGALSFNLVFPSNEPDIWRLMGM  168



>emb|CDP04242.1| unnamed protein product [Coffea canephora]
Length=255

 Score =   144 bits (362),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 82/110 (75%), Gaps = 9/110 (8%)
 Frame = +3

Query  213  KVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRAS  392
            +V +E  G       E E E    NS S GA      P LDK+LKKVVQKTAATFAPRAS
Sbjct  82   RVVQEFNGKEVAQLPEKEGER---NSSSTGA------PLLDKDLKKVVQKTAATFAPRAS  132

Query  393  TASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
             A+KNPAVPGT LYTVFEVQGYVSMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  133  VATKNPAVPGTILYTVFEVQGYVSMLLGGALSFNLIFPSNEPDIWRLMGM  182



>ref|XP_004962135.1| PREDICTED: uncharacterized protein LOC101762415 isoform X2 [Setaria 
italica]
Length=239

 Score =   143 bits (360),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 71/104 (68%), Positives = 81/104 (78%), Gaps = 0/104 (0%)
 Frame = +3

Query  231  LGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNP  410
            +GDS E +     E   +   S G     ++P ++KELKK VQKTAATFAPRAST +KNP
Sbjct  65   VGDSLEREEGGGGEGVASADSSAGKQPPPVDPKIEKELKKAVQKTAATFAPRASTKTKNP  124

Query  411  AVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AVPGTTLY+VFEVQGYVSMLLGGALSFNL+FPSNEP IWRLMGM
Sbjct  125  AVPGTTLYSVFEVQGYVSMLLGGALSFNLVFPSNEPDIWRLMGM  168



>ref|XP_009412178.1| PREDICTED: uncharacterized protein LOC103993732 [Musa acuminata 
subsp. malaccensis]
Length=227

 Score =   142 bits (358),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/92 (75%), Positives = 78/92 (85%), Gaps = 0/92 (0%)
 Frame = +3

Query  267  QESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFE  446
            QE+  ++S S  +  T + P  DKE+KKVVQKTAATFAPRASTA+KNPAVPGT LY+VFE
Sbjct  65   QEAPESSSGSGNSKPTLVTPISDKEIKKVVQKTAATFAPRASTATKNPAVPGTALYSVFE  124

Query  447  VQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VQGY SMLLGGALSFNLIFPSN+P IWRLMGM
Sbjct  125  VQGYASMLLGGALSFNLIFPSNQPDIWRLMGM  156



>ref|XP_010683572.1| PREDICTED: uncharacterized protein LOC104898223 [Beta vulgaris 
subsp. vulgaris]
Length=226

 Score =   141 bits (356),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 86/123 (70%), Gaps = 9/123 (7%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNG--AASTTINPALDKELKKV  353
            R   SS+ LD  +       + E  VE++ +        N    +S+T  PA++K+LKKV
Sbjct  40   RIHGSSDKLDTPI-------TMEVNVEEDMQVTNLEERENEIRVSSSTAAPAMEKDLKKV  92

Query  354  VQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRL  533
            V K AATFAPRASTASKNPAVPG+TLYTVFEVQ Y SMLLGG LSFNL+FPSNEP IWRL
Sbjct  93   VNKAAATFAPRASTASKNPAVPGSTLYTVFEVQAYASMLLGGVLSFNLVFPSNEPDIWRL  152

Query  534  MGM  542
            MGM
Sbjct  153  MGM  155



>ref|XP_008234927.1| PREDICTED: uncharacterized protein LOC103333814 [Prunus mume]
Length=218

 Score =   140 bits (353),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/104 (71%), Positives = 81/104 (78%), Gaps = 6/104 (6%)
 Frame = +3

Query  237  DSAETKVEDEQESKGANSISNGAASTTINPA--LDKELKKVVQKTAATFAPRASTASKNP  410
            D+    VE+ ++   A+    G AS    PA  LDK+LKKVVQKTAATFAPRASTASKNP
Sbjct  48   DTQAQAVEEPKQELEADPKEAGKAS----PASPLDKDLKKVVQKTAATFAPRASTASKNP  103

Query  411  AVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AVPG+TLYTVFEVQ Y SMLLGG LSFNLIFPSNEP IWRLMGM
Sbjct  104  AVPGSTLYTVFEVQAYASMLLGGVLSFNLIFPSNEPDIWRLMGM  147



>ref|XP_007050707.1| Resistance to phytophthora 1 isoform 2 [Theobroma cacao]
 gb|EOX94864.1| Resistance to phytophthora 1 isoform 2 [Theobroma cacao]
Length=227

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPS  509
            LDK+LKKV+QKTAATFAPRASTA+KNPAVPGT LYTVFEVQGYVSMLLGGALSFNLIFPS
Sbjct  88   LDKDLKKVLQKTAATFAPRASTATKNPAVPGTALYTVFEVQGYVSMLLGGALSFNLIFPS  147

Query  510  NEPXIWRLMGM  542
            NEP IWRLMGM
Sbjct  148  NEPDIWRLMGM  158



>ref|XP_007050706.1| Resistance to phytophthora 1 isoform 1 [Theobroma cacao]
 gb|EOX94863.1| Resistance to phytophthora 1 isoform 1 [Theobroma cacao]
Length=229

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/71 (93%), Positives = 69/71 (97%), Gaps = 0/71 (0%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPS  509
            LDK+LKKV+QKTAATFAPRASTA+KNPAVPGT LYTVFEVQGYVSMLLGGALSFNLIFPS
Sbjct  88   LDKDLKKVLQKTAATFAPRASTATKNPAVPGTALYTVFEVQGYVSMLLGGALSFNLIFPS  147

Query  510  NEPXIWRLMGM  542
            NEP IWRLMGM
Sbjct  148  NEPDIWRLMGM  158



>ref|XP_006654383.1| PREDICTED: uncharacterized protein LOC102699685 [Oryza brachyantha]
Length=247

 Score =   140 bits (353),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 85/115 (74%), Gaps = 15/115 (13%)
 Frame = +3

Query  201  GLDKKVEEEG-LGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATF  377
            G  K+ EE G  G SAE+  E +                 ++P ++KELKK VQKTAATF
Sbjct  76   GESKEGEETGGRGSSAESSTEKKP--------------APVDPKIEKELKKAVQKTAATF  121

Query  378  APRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            APRASTA+KNPAVPG+TLY++FEVQGYVSMLLGGALSFNL+FPSNEP IWRLMGM
Sbjct  122  APRASTATKNPAVPGSTLYSIFEVQGYVSMLLGGALSFNLVFPSNEPDIWRLMGM  176



>gb|KCW49950.1| hypothetical protein EUGRSUZ_K03409 [Eucalyptus grandis]
Length=173

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/92 (76%), Positives = 77/92 (84%), Gaps = 4/92 (4%)
 Frame = +3

Query  267  QESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFE  446
            QE +   S S  A+    N AL+K+LKKVVQKTA+TFAPRASTASKNPAVPGT LYTVFE
Sbjct  15   QEWRPRPSTSTSAS----NAALEKDLKKVVQKTASTFAPRASTASKNPAVPGTALYTVFE  70

Query  447  VQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VQGY S+LLGGALSFNL+FPSNEP IWRLMGM
Sbjct  71   VQGYASLLLGGALSFNLLFPSNEPDIWRLMGM  102



>ref|XP_008812255.1| PREDICTED: uncharacterized protein LOC103723196, partial [Phoenix 
dactylifera]
Length=212

 Score =   139 bits (350),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 106/168 (63%), Gaps = 22/168 (13%)
 Frame = +3

Query  60   MNALMSAASPFTSISILK--FPSSPLVLRNGVFRAQFWGKSSRFRAS--SNGLDKKVEEE  227
            M +L S A     IS     FP+    L+   + A F G+ +R RA   S+GLD    +E
Sbjct  26   MYSLYSTAPCIPRISKFSIIFPT----LKTSSYDAGF-GRRTRVRAEARSDGLDTPTVQE  80

Query  228  GLGDSAETKVEDEQESKGANSISNGAASTTI---NPALDKELKKVVQKTAATFAPRASTA  398
                        EQ+  G++S S+ +    +    P +DK++KKV QKTAATFAPRASTA
Sbjct  81   S----------SEQQEAGSSSNSSNSKPPPLPSAAPDIDKKIKKVAQKTAATFAPRASTA  130

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            +KNPAVPGT LYT+FEVQGY SML GGALSFNLIFPSNEP IWRLMGM
Sbjct  131  TKNPAVPGTALYTLFEVQGYASMLFGGALSFNLIFPSNEPDIWRLMGM  178



>ref|XP_002441071.1| hypothetical protein SORBIDRAFT_09g019840 [Sorghum bicolor]
 gb|EES19501.1| hypothetical protein SORBIDRAFT_09g019840 [Sorghum bicolor]
Length=245

 Score =   140 bits (352),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  282  ANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYV  461
            A S SN      ++P ++KELKK VQKTAATFAPRAST +KNPAVPGT LY++FEVQGYV
Sbjct  88   AESSSNRKQPPPVDPKIEKELKKAVQKTAATFAPRASTKTKNPAVPGTALYSIFEVQGYV  147

Query  462  SMLLGGALSFNLIFPSNEPXIWRLMGM  542
            SMLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  148  SMLLGGALSFNLIFPSNEPDIWRLMGM  174



>ref|XP_009356720.1| PREDICTED: uncharacterized protein LOC103947536 [Pyrus x bretschneideri]
Length=220

 Score =   139 bits (350),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 76/121 (63%), Positives = 87/121 (72%), Gaps = 9/121 (7%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R  A++N LD     E      + ++E+ +  +   S +  AAS      LDK+LKKVVQ
Sbjct  38   RLYANANELDAPAAVE----EPKPELEEAKPPEVGKSSTFSAAS-----PLDKDLKKVVQ  88

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            KTAATFAPRASTASKNPAVPG+TLYTVFEVQ Y SMLLGG LSFNLIFPSNEP IWRLMG
Sbjct  89   KTAATFAPRASTASKNPAVPGSTLYTVFEVQAYASMLLGGFLSFNLIFPSNEPDIWRLMG  148

Query  540  M  542
            M
Sbjct  149  M  149



>ref|XP_007201514.1| hypothetical protein PRUPE_ppa015205mg [Prunus persica]
 gb|EMJ02713.1| hypothetical protein PRUPE_ppa015205mg [Prunus persica]
Length=218

 Score =   139 bits (349),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 72/104 (69%), Positives = 81/104 (78%), Gaps = 6/104 (6%)
 Frame = +3

Query  237  DSAETKVEDEQESKGANSISNGAASTTINPA--LDKELKKVVQKTAATFAPRASTASKNP  410
            D+    VE+ ++   A+    G AS    PA  LDK+LKKVVQKTAATFAPRASTASKNP
Sbjct  48   DTQAQAVEEPKQELEADPKEAGKAS----PASPLDKDLKKVVQKTAATFAPRASTASKNP  103

Query  411  AVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            AVPG+TLYTVFEVQ Y SMLLGG LSFN++FPSNEP IWRLMGM
Sbjct  104  AVPGSTLYTVFEVQAYASMLLGGVLSFNIVFPSNEPDIWRLMGM  147



>ref|XP_004493635.1| PREDICTED: uncharacterized protein LOC101494764 [Cicer arietinum]
Length=214

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/78 (83%), Positives = 72/78 (92%), Gaps = 0/78 (0%)
 Frame = +3

Query  309  STTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALS  488
            STT +  +DKELK+V QKTAATFAPRASTASKNPA+PG+TLYTVFEVQ YVSMLLGGALS
Sbjct  66   STTFSTPIDKELKRVAQKTAATFAPRASTASKNPAIPGSTLYTVFEVQAYVSMLLGGALS  125

Query  489  FNLIFPSNEPXIWRLMGM  542
            FNLIFPS++P IWRLMGM
Sbjct  126  FNLIFPSDQPDIWRLMGM  143



>ref|XP_004290691.1| PREDICTED: uncharacterized protein LOC101300872 [Fragaria vesca 
subsp. vesca]
Length=221

 Score =   138 bits (348),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 4/100 (4%)
 Frame = +3

Query  243  AETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPG  422
            AE K E E + K A   S+ +A+      LD++LKKVVQKTAATFAPRASTASKNPAVPG
Sbjct  55   AEPKQEQEAQPKEATKSSSKSATA----PLDQDLKKVVQKTAATFAPRASTASKNPAVPG  110

Query  423  TTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            + LYTVFEVQ Y  MLLGG LSFNLIFPSNEP +WRLMGM
Sbjct  111  SVLYTVFEVQAYACMLLGGVLSFNLIFPSNEPDLWRLMGM  150



>ref|XP_010090342.1| hypothetical protein L484_025007 [Morus notabilis]
 gb|EXB39312.1| hypothetical protein L484_025007 [Morus notabilis]
Length=230

 Score =   139 bits (349),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 92/121 (76%), Gaps = 7/121 (6%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R  A+SN +D +  EE    + E K E  +E+   +S S+ +A+      LDK+LKKVVQ
Sbjct  46   RVYANSNEVDTQALEEP--STEELKQEQPKEASKLSSTSSASAA-----PLDKDLKKVVQ  98

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            KTAATFAPRASTA+KNPAVPGTTLYTVFEVQGY S++LGG LSFNL+FPSNEP IWRLMG
Sbjct  99   KTAATFAPRASTATKNPAVPGTTLYTVFEVQGYASLVLGGVLSFNLLFPSNEPDIWRLMG  158

Query  540  M  542
            M
Sbjct  159  M  159



>ref|XP_008366555.1| PREDICTED: uncharacterized protein LOC103430198 isoform X1 [Malus 
domestica]
Length=240

 Score =   138 bits (348),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 86/121 (71%), Gaps = 8/121 (7%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R  A++N LD       + +  +   E E    G +S  + AAS      LDK+LKKVVQ
Sbjct  41   RLYANANELD---APAAVEEPKQEPEEAEPPEAGKSSTFSAAAS-----PLDKDLKKVVQ  92

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            KTAATFAPRASTASKNPAVPG+TLYTVFEVQ Y SMLLGG LSFNLIFPSNEP IWRLMG
Sbjct  93   KTAATFAPRASTASKNPAVPGSTLYTVFEVQAYASMLLGGVLSFNLIFPSNEPDIWRLMG  152

Query  540  M  542
            M
Sbjct  153  M  153



>ref|XP_008368885.1| PREDICTED: uncharacterized protein LOC103432465 [Malus domestica]
Length=225

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/71 (92%), Positives = 67/71 (94%), Gaps = 0/71 (0%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPS  509
            LDK+LKKVVQKTAATFAPRASTASKNPAVPG+TLYTVFEVQ Y SMLLGG LSFNLIFPS
Sbjct  84   LDKDLKKVVQKTAATFAPRASTASKNPAVPGSTLYTVFEVQAYASMLLGGVLSFNLIFPS  143

Query  510  NEPXIWRLMGM  542
            NEP IWRLMGM
Sbjct  144  NEPDIWRLMGM  154



>gb|KEH23700.1| resistance to phytophthora protein, putative [Medicago truncatula]
Length=218

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/80 (81%), Positives = 73/80 (91%), Gaps = 0/80 (0%)
 Frame = +3

Query  303  AASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGA  482
            + S+T +  +DKELKKV QKTAATFAPRASTASKNPAVPG+TLYTVFEVQ YVSMLLGGA
Sbjct  68   STSSTFSTPIDKELKKVAQKTAATFAPRASTASKNPAVPGSTLYTVFEVQAYVSMLLGGA  127

Query  483  LSFNLIFPSNEPXIWRLMGM  542
            LSFNLIFPS++P +WRLMGM
Sbjct  128  LSFNLIFPSDQPDLWRLMGM  147



>ref|XP_008366556.1| PREDICTED: uncharacterized protein LOC103430198 isoform X2 [Malus 
domestica]
Length=224

 Score =   137 bits (346),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/121 (64%), Positives = 86/121 (71%), Gaps = 8/121 (7%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R  A++N LD       + +  +   E E    G +S  + AAS      LDK+LKKVVQ
Sbjct  41   RLYANANELD---APAAVEEPKQEPEEAEPPEAGKSSTFSAAAS-----PLDKDLKKVVQ  92

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            KTAATFAPRASTASKNPAVPG+TLYTVFEVQ Y SMLLGG LSFNLIFPSNEP IWRLMG
Sbjct  93   KTAATFAPRASTASKNPAVPGSTLYTVFEVQAYASMLLGGVLSFNLIFPSNEPDIWRLMG  152

Query  540  M  542
            M
Sbjct  153  M  153



>ref|NP_001055503.1| Os05g0404400 [Oryza sativa Japonica Group]
 gb|AAT85080.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAT85221.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF17417.1| Os05g0404400 [Oryza sativa Japonica Group]
 dbj|BAG96474.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89514.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC79203.1| hypothetical protein OsI_19917 [Oryza sativa Indica Group]
 gb|EEE63679.1| hypothetical protein OsJ_18497 [Oryza sativa Japonica Group]
Length=239

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/75 (84%), Positives = 70/75 (93%), Gaps = 0/75 (0%)
 Frame = +3

Query  318  INPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNL  497
            ++P ++KELKK VQKTAATFAPRASTA+KNPAVPGT LYT+FEVQGY SMLLGGALSFNL
Sbjct  94   VDPKIEKELKKAVQKTAATFAPRASTATKNPAVPGTALYTIFEVQGYASMLLGGALSFNL  153

Query  498  IFPSNEPXIWRLMGM  542
            +FPSNEP IWRLMGM
Sbjct  154  VFPSNEPDIWRLMGM  168



>ref|XP_004239692.1| PREDICTED: uncharacterized protein LOC101259047 [Solanum lycopersicum]
Length=236

 Score =   137 bits (346),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 90/176 (51%), Positives = 108/176 (61%), Gaps = 26/176 (15%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKF--PSSPLVLRNGVFRAQFWGKSSRF--RASSNGLDKKVEEE  227
            MN   + ++   +  ILKF  P     LR+ + R    GKS RF   ASSN L+K+V E+
Sbjct  1    MNLATTMSASVLNYQILKFFPPQKNGFLRSPLIR----GKSCRFCVSASSNELNKQVIED  56

Query  228  GLGDSAETKVEDE-----------QESKGANSISNGAASTTINPALDKELKKVVQKTAAT  374
                  E +V+ +           +E  G NS S G ++   N    KELKK V KTA+T
Sbjct  57   ---PKEEIQVKSDGVIVNSTEEDEEERSGENSTSTGPSTVLDN----KELKKAVLKTAST  109

Query  375  FAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            FAPRASTA+KNPA PGT LYTVFEVQ Y SML+GGALSFNLIFPS EP IWRLMGM
Sbjct  110  FAPRASTATKNPAKPGTVLYTVFEVQAYASMLIGGALSFNLIFPSTEPDIWRLMGM  165



>ref|XP_006850863.1| hypothetical protein AMTR_s00025p00143860 [Amborella trichopoda]
 gb|ERN12444.1| hypothetical protein AMTR_s00025p00143860 [Amborella trichopoda]
Length=250

 Score =   137 bits (345),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/108 (62%), Positives = 84/108 (78%), Gaps = 2/108 (2%)
 Frame = +3

Query  219  EEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTA  398
            +EE   +   + +   +E +G     N    ++I+P ++ ++KKVVQKTA+TFAPRASTA
Sbjct  74   DEELTKELGVSMITGNEEREG--RFENRPPPSSISPKIENDIKKVVQKTASTFAPRASTA  131

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            +KNPA+PGTTLYTVFEVQGY SMLLGGALSFNL+FPSNEP IWRLMGM
Sbjct  132  TKNPALPGTTLYTVFEVQGYASMLLGGALSFNLLFPSNEPDIWRLMGM  179



>ref|XP_003568495.1| PREDICTED: uncharacterized protein LOC100821919 [Brachypodium 
distachyon]
Length=236

 Score =   137 bits (344),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 62/75 (83%), Positives = 71/75 (95%), Gaps = 0/75 (0%)
 Frame = +3

Query  318  INPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNL  497
            ++P+++KELKK VQKTAATFAPRASTA+KNPAVPG+TLYTVFEVQ Y SML+GGALSFNL
Sbjct  91   VDPSIEKELKKAVQKTAATFAPRASTATKNPAVPGSTLYTVFEVQAYASMLVGGALSFNL  150

Query  498  IFPSNEPXIWRLMGM  542
            +FPSNEP IWRLMGM
Sbjct  151  VFPSNEPDIWRLMGM  165



>ref|XP_006345816.1| PREDICTED: uncharacterized protein LOC102592434 [Solanum tuberosum]
Length=235

 Score =   136 bits (343),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 87/168 (52%), Positives = 106/168 (63%), Gaps = 11/168 (7%)
 Frame = +3

Query  60   MNALMSAASPFTSISILKF--PSSPLVLRNGVFRAQFWGKSSRF--RASSNGLDKKVEEE  227
            MN+  + ++   +  ILKF  P     L++ + R    GK  RF   ASSN L+K+V E+
Sbjct  1    MNSATTMSASVLNYQILKFFPPQKNGFLKSPLIR----GKICRFCVSASSNELNKQVIED  56

Query  228  GLGDSAETKVEDEQESKGANSISNGAASTTINPA--LD-KELKKVVQKTAATFAPRASTA  398
               ++ E        S       +G  ST+  P+  LD KELKK V KTA+TFAPRASTA
Sbjct  57   PKEETQEKSDGVIVNSTEEEEERSGENSTSTGPSTVLDNKELKKAVLKTASTFAPRASTA  116

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            +KNPA PGT LYTVFEVQ Y SML+GGALSFNLIFPS EP IWRLMGM
Sbjct  117  TKNPAKPGTVLYTVFEVQAYASMLIGGALSFNLIFPSTEPDIWRLMGM  164



>gb|EYU46632.1| hypothetical protein MIMGU_mgv1a013097mg [Erythranthe guttata]
Length=230

 Score =   135 bits (340),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 82/138 (59%), Positives = 96/138 (70%), Gaps = 7/138 (5%)
 Frame = +3

Query  132  VLRNGVF-RAQFWGKSSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAA  308
            V RN  F   QF  +  R RASSN L  K E+   G   E +  +E E    N     +A
Sbjct  28   VRRNTAFINTQFPIRILRIRASSNELGTKTEQ---GYKDEEEDLEESEESSKNYSGPSSA  84

Query  309  STTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALS  488
            S+    +LDK++KKVVQKTAATFAPRASTA+KNPAVPG+ LYTVFEVQ Y S+L+GGALS
Sbjct  85   SSP---SLDKDIKKVVQKTAATFAPRASTATKNPAVPGSVLYTVFEVQAYASLLIGGALS  141

Query  489  FNLIFPSNEPXIWRLMGM  542
            +NLIFPSNEP IWRLMGM
Sbjct  142  YNLIFPSNEPDIWRLMGM  159



>gb|ABK26624.1| unknown [Picea sitchensis]
Length=209

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/102 (60%), Positives = 80/102 (78%), Gaps = 0/102 (0%)
 Frame = +3

Query  237  DSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAV  416
            ++ E    + ++ +    +   A S  ++P++D ++KKVVQKTA TFAPRASTA KNPAV
Sbjct  37   ETEEAPTPNPKQEEEIKPLQAPAPSKILSPSIDIDIKKVVQKTAGTFAPRASTARKNPAV  96

Query  417  PGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            PG+TLYT+FEVQGY+SM+ GGAL+FNLIFPS+EP IWRLMGM
Sbjct  97   PGSTLYTIFEVQGYLSMVFGGALAFNLIFPSSEPDIWRLMGM  138



>ref|XP_002880341.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH56600.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=197

 Score =   131 bits (330),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/72 (86%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPA+PGTTLY VFEVQGY SMLLGG LSFNL+FP
Sbjct  55   ALGKDLKKVVNKTAATFAPRASTASKNPALPGTTLYKVFEVQGYASMLLGGVLSFNLLFP  114

Query  507  SNEPXIWRLMGM  542
            SNEP +WRLMGM
Sbjct  115  SNEPDLWRLMGM  126



>ref|XP_006397998.1| hypothetical protein EUTSA_v10001627mg [Eutrema salsugineum]
 gb|ESQ39451.1| hypothetical protein EUTSA_v10001627mg [Eutrema salsugineum]
Length=217

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/72 (88%), Positives = 66/72 (92%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPAVPGTTLY VFEVQGY SML+GG LSFNL+FP
Sbjct  75   ALGKDLKKVVNKTAATFAPRASTASKNPAVPGTTLYKVFEVQGYASMLVGGVLSFNLLFP  134

Query  507  SNEPXIWRLMGM  542
            SNEP IWRLMGM
Sbjct  135  SNEPDIWRLMGM  146



>dbj|BAJ91408.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=218

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 75/103 (73%), Gaps = 14/103 (14%)
 Frame = +3

Query  234  GDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPA  413
            G SAE   E +Q                ++P ++KELKK VQKTAATFAPRAST SKNPA
Sbjct  59   GASAEPAAEKQQP--------------VVDPRIEKELKKAVQKTAATFAPRASTKSKNPA  104

Query  414  VPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VPG+TLYT+FEVQ Y SML GGALSFNL+FPS+EP IWRLMGM
Sbjct  105  VPGSTLYTIFEVQAYASMLAGGALSFNLVFPSSEPDIWRLMGM  147



>dbj|BAJ92442.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=234

 Score =   132 bits (331),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/103 (64%), Positives = 75/103 (73%), Gaps = 14/103 (14%)
 Frame = +3

Query  234  GDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPA  413
            G SAE   E +Q                ++P ++KELKK VQKTAATFAPRAST SKNPA
Sbjct  75   GASAEPAAEKQQP--------------VVDPRIEKELKKAVQKTAATFAPRASTKSKNPA  120

Query  414  VPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            VPG+TLYT+FEVQ Y SML GGALSFNL+FPS+EP IWRLMGM
Sbjct  121  VPGSTLYTIFEVQAYASMLAGGALSFNLVFPSSEPDIWRLMGM  163



>ref|XP_010552792.1| PREDICTED: uncharacterized protein LOC104823061 [Tarenaya hassleriana]
Length=227

 Score =   130 bits (326),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 76/135 (56%), Positives = 91/135 (67%), Gaps = 14/135 (10%)
 Frame = +3

Query  138  RNGVFRAQFWGKSSRFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTT  317
            R G+FR           ASS+G++ K E     +  ET      E+  A+   +  +S++
Sbjct  36   RAGIFRIC---------ASSDGVEAKEELRQEAEPIETG-----ETSAASPSPSSTSSSS  81

Query  318  INPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNL  497
              P   K+LKKVV KTAATFAPRASTA+KNPAVPGTTLY VFEVQGY SM+LGG LSFNL
Sbjct  82   APPLFGKDLKKVVNKTAATFAPRASTANKNPAVPGTTLYKVFEVQGYASMVLGGVLSFNL  141

Query  498  IFPSNEPXIWRLMGM  542
            +FPSNEP IWRLMGM
Sbjct  142  LFPSNEPDIWRLMGM  156



>ref|NP_566122.1| protein RESISTANCE TO PHYTOPHTHORA 1 [Arabidopsis thaliana]
 ref|NP_850484.1| protein RESISTANCE TO PHYTOPHTHORA 1 [Arabidopsis thaliana]
 gb|AAK76457.1| unknown protein [Arabidopsis thaliana]
 gb|AAL85089.1| unknown protein [Arabidopsis thaliana]
 gb|AAD13710.2| expressed protein [Arabidopsis thaliana]
 gb|AEC10928.1| resistance to phytophthora 1 protein [Arabidopsis thaliana]
 gb|AEC10929.1| resistance to phytophthora 1 protein [Arabidopsis thaliana]
Length=197

 Score =   127 bits (320),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPA+PGTTLY VFEVQGY SM LGG LSFNL+FP
Sbjct  55   ALGKDLKKVVNKTAATFAPRASTASKNPALPGTTLYKVFEVQGYASMFLGGVLSFNLLFP  114

Query  507  SNEPXIWRLMGM  542
            S+EP +WRLMGM
Sbjct  115  SSEPDLWRLMGM  126



>ref|NP_001189776.1| protein RESISTANCE TO PHYTOPHTHORA 1 [Arabidopsis thaliana]
 gb|AEC10930.1| resistance to phytophthora 1 protein [Arabidopsis thaliana]
Length=201

 Score =   128 bits (321),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/72 (83%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPA+PGTTLY VFEVQGY SM LGG LSFNL+FP
Sbjct  55   ALGKDLKKVVNKTAATFAPRASTASKNPALPGTTLYKVFEVQGYASMFLGGVLSFNLLFP  114

Query  507  SNEPXIWRLMGM  542
            S+EP +WRLMGM
Sbjct  115  SSEPDLWRLMGM  126



>ref|XP_010506853.1| PREDICTED: uncharacterized protein LOC104783393 [Camelina sativa]
Length=211

 Score =   126 bits (317),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 69/121 (57%), Positives = 85/121 (70%), Gaps = 17/121 (14%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R RA+S+G++ K ++E L       + D              +S++ + AL K+LKKVV 
Sbjct  37   RIRATSDGVESKDDDEPL-------LPDNPP----------VSSSSSSSALGKDLKKVVN  79

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            KTAATFAPRASTASKNPAVPGTTLY VFEVQ Y SM +GG LSFNL+FPSNEP +WRL+G
Sbjct  80   KTAATFAPRASTASKNPAVPGTTLYKVFEVQAYASMFVGGVLSFNLLFPSNEPDLWRLIG  139

Query  540  M  542
            M
Sbjct  140  M  140



>ref|XP_006294741.1| hypothetical protein CARUB_v10023786mg [Capsella rubella]
 gb|EOA27639.1| hypothetical protein CARUB_v10023786mg [Capsella rubella]
Length=228

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL  +LKKVV KTAATFAPRASTASKNPAVPG+TLY VFEVQGY SM +GG LSFNL+FP
Sbjct  86   ALGTDLKKVVNKTAATFAPRASTASKNPAVPGSTLYKVFEVQGYASMFVGGVLSFNLLFP  145

Query  507  SNEPXIWRLMGM  542
            SNEP +WRLMGM
Sbjct  146  SNEPDLWRLMGM  157



>ref|XP_009142482.1| PREDICTED: uncharacterized protein LOC103866331 [Brassica rapa]
 emb|CDX80146.1| BnaA05g00100D [Brassica napus]
Length=204

 Score =   125 bits (313),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPA+PGTTLY VFEVQGY SML GG LSFNL+FP
Sbjct  62   ALGKDLKKVVNKTAATFAPRASTASKNPALPGTTLYKVFEVQGYASMLAGGVLSFNLLFP  121

Query  507  SNEPXIWRLMGM  542
            S +P +WRLMGM
Sbjct  122  STQPDLWRLMGM  133



>emb|CDY55190.1| BnaCnng28340D [Brassica napus]
Length=235

 Score =   125 bits (315),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL K+LKKVV KTAATFAPRASTASKNPA+PGTTLY VFEVQGY SML+GG LSFNL+FP
Sbjct  93   ALGKDLKKVVNKTAATFAPRASTASKNPALPGTTLYKVFEVQGYASMLVGGVLSFNLLFP  152

Query  507  SNEPXIWRLMGM  542
            S +P +WRLMGM
Sbjct  153  STQPDLWRLMGM  164



>ref|XP_006294740.1| hypothetical protein CARUB_v10023786mg [Capsella rubella]
 gb|EOA27638.1| hypothetical protein CARUB_v10023786mg [Capsella rubella]
Length=285

 Score =   126 bits (316),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 59/72 (82%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  327  ALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            AL  +LKKVV KTAATFAPRASTASKNPAVPG+TLY VFEVQGY SM +GG LSFNL+FP
Sbjct  86   ALGTDLKKVVNKTAATFAPRASTASKNPAVPGSTLYKVFEVQGYASMFVGGVLSFNLLFP  145

Query  507  SNEPXIWRLMGM  542
            SNEP +WRLMGM
Sbjct  146  SNEPDLWRLMGM  157



>ref|XP_010497174.1| PREDICTED: uncharacterized protein LOC104774213, partial [Camelina 
sativa]
Length=141

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/67 (79%), Positives = 59/67 (88%), Gaps = 0/67 (0%)
 Frame = +3

Query  342  LKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPX  521
            + +VV KTAATFAPRASTASKNPAVPGTTLY VFEVQ Y SM +GG LSFNL+FPSNEP 
Sbjct  4    INQVVNKTAATFAPRASTASKNPAVPGTTLYKVFEVQAYASMFVGGVLSFNLLFPSNEPD  63

Query  522  IWRLMGM  542
            +WRL+GM
Sbjct  64   LWRLIGM  70



>ref|XP_002963539.1| hypothetical protein SELMODRAFT_165828 [Selaginella moellendorffii]
 gb|EFJ35410.1| hypothetical protein SELMODRAFT_165828 [Selaginella moellendorffii]
Length=193

 Score =   115 bits (287),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 11/96 (11%)
 Frame = +3

Query  255  VEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLY  434
            VE E+++K ++S           P ++KEL K V+KTAATFAPR+STA KNPAVPG+ LY
Sbjct  33   VETEEKTKASSS-----------PNVEKELSKAVKKTAATFAPRSSTAKKNPAVPGSVLY  81

Query  435  TVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            TVFEVQGY+SM +GG L++N +FPS+EP I RLMGM
Sbjct  82   TVFEVQGYLSMAVGGLLAYNYLFPSDEPDIARLMGM  117



>ref|XP_002981540.1| hypothetical protein SELMODRAFT_178970 [Selaginella moellendorffii]
 gb|EFJ17355.1| hypothetical protein SELMODRAFT_178970 [Selaginella moellendorffii]
Length=191

 Score =   114 bits (286),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 57/96 (59%), Positives = 73/96 (76%), Gaps = 11/96 (11%)
 Frame = +3

Query  255  VEDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLY  434
            VE E+++K ++S           P ++KEL K V+KTAATFAPR+STA KNPAVPG+ LY
Sbjct  31   VETEEKTKASSS-----------PNVEKELSKAVKKTAATFAPRSSTAKKNPAVPGSVLY  79

Query  435  TVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            TVFEVQGY+SM +GG L++N +FPS+EP I RLMGM
Sbjct  80   TVFEVQGYLSMAVGGLLAYNYLFPSDEPDIARLMGM  115



>ref|XP_001785690.1| predicted protein [Physcomitrella patens]
 gb|EDQ49503.1| predicted protein, partial [Physcomitrella patens]
Length=136

 Score =   108 bits (271),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 1/66 (2%)
 Frame = +3

Query  348  KVVQKTAATFAPRASTA-SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXI  524
            KVV+KTAATFAPRAS+A +KNPA PGT LYT+FEVQ Y+SML+GG LSFNL+FPS+ P I
Sbjct  1    KVVRKTAATFAPRASSAKNKNPAQPGTMLYTIFEVQAYISMLVGGILSFNLLFPSDHPDI  60

Query  525  WRLMGM  542
            WRLMGM
Sbjct  61   WRLMGM  66



>ref|XP_002506207.1| hypothetical protein MICPUN_109491 [Micromonas sp. RCC299]
 gb|ACO67465.1| hypothetical protein MICPUN_109491 [Micromonas sp. RCC299]
Length=216

 Score = 98.6 bits (244),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 70/121 (58%), Gaps = 28/121 (23%)
 Frame = +3

Query  180  RFRASSNGLDKKVEEEGLGDSAETKVEDEQESKGANSISNGAASTTINPALDKELKKVVQ  359
            R RASSN      +++G G    TK  D                      +DKELKK   
Sbjct  43   RVRASSN------DDDGTGAGVRTKEVD----------------------VDKELKKNAA  74

Query  360  KTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMG  539
            K A TFAPR+STA KNPA  G+ LYT+FEVQ Y+S+++G  LS+N++ PS+EP I RLMG
Sbjct  75   KIAGTFAPRSSTAKKNPAFKGSALYTIFEVQAYLSLVVGSMLSYNVLLPSDEPNIARLMG  134

Query  540  M  542
            M
Sbjct  135  M  135



>gb|KJB23157.1| hypothetical protein B456_004G084200 [Gossypium raimondii]
Length=197

 Score = 98.2 bits (243),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 54/73 (74%), Positives = 59/73 (81%), Gaps = 7/73 (10%)
 Frame = +3

Query  258  EDEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYT  437
            E  +ESK  +S    A STT    LDK+LKKVVQKTAATFAPRASTA+KNPAVPGTTLYT
Sbjct  68   EPRKESKSISS----ATSTT---PLDKDLKKVVQKTAATFAPRASTATKNPAVPGTTLYT  120

Query  438  VFEVQGYVSMLLG  476
            VFEVQGYVS+LL 
Sbjct  121  VFEVQGYVSLLLA  133



>ref|XP_003056689.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH58334.1| predicted protein [Micromonas pusilla CCMP1545]
Length=230

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/73 (60%), Positives = 58/73 (79%), Gaps = 2/73 (3%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTAS--KNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIF  503
            LDKE+ K  +K A+TFAPR+ST +  KNPA  G+TLYT+FEVQ YVS+++G  LS+N++ 
Sbjct  66   LDKEVSKRAKKIASTFAPRSSTPAGKKNPAFKGSTLYTIFEVQAYVSLVVGSLLSYNVLL  125

Query  504  PSNEPXIWRLMGM  542
            PS+EP I RLMGM
Sbjct  126  PSDEPNIARLMGM  138



>ref|XP_005849445.1| hypothetical protein CHLNCDRAFT_13259, partial [Chlorella variabilis]
 gb|EFN57343.1| hypothetical protein CHLNCDRAFT_13259, partial [Chlorella variabilis]
Length=126

 Score = 89.4 bits (220),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/72 (61%), Positives = 55/72 (76%), Gaps = 1/72 (1%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTAS-KNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFP  506
            +DKE+ K  +  A TFAPRAS A+ KNPA  G+ LYTVFEVQ + ++ LGG LSFNLIFP
Sbjct  1    IDKEVSKFARNAATTFAPRASGATGKNPAYKGSLLYTVFEVQAWAALALGGLLSFNLIFP  60

Query  507  SNEPXIWRLMGM  542
            S++P I RL+GM
Sbjct  61   SDQPDIARLLGM  72



>ref|XP_005647446.1| hypothetical protein COCSUDRAFT_16364, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22902.1| hypothetical protein COCSUDRAFT_16364, partial [Coccomyxa subellipsoidea 
C-169]
Length=141

 Score = 89.0 bits (219),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 42/67 (63%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +3

Query  342  LKKVVQKTAATFAPRASTASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPX  521
            + K   K A TFAPRAS ASKNPA  G+ LYTVFEVQ ++ +++GG LSFN+IFPS+EP 
Sbjct  1    ISKFATKAATTFAPRASGASKNPAFKGSLLYTVFEVQAWLFLVIGGLLSFNIIFPSDEPN  60

Query  522  IWRLMGM  542
            I RL+GM
Sbjct  61   IARLLGM  67



>ref|XP_002954628.1| hypothetical protein VOLCADRAFT_82900 [Volvox carteri f. nagariensis]
 gb|EFJ44269.1| hypothetical protein VOLCADRAFT_82900 [Volvox carteri f. nagariensis]
Length=231

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 46/108 (43%), Positives = 67/108 (62%), Gaps = 8/108 (7%)
 Frame = +3

Query  243  AETKVEDEQESKGANSISNGAASTTINPA--------LDKELKKVVQKTAATFAPRASTA  398
            A  +V    +     S +NGA  T   P+        L+KE+ K+ ++ A TFAPR+ST 
Sbjct  20   ACPRVHGMAQPLVVRSANNGAPQTAEQPSTSTGAEVDLEKEVTKLTRQAAGTFAPRSSTK  79

Query  399  SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
             KNPAV G+ LY +FE Q ++ ++ GG LSFN+I+P++EP I RL+GM
Sbjct  80   QKNPAVKGSVLYDIFEYQSWICLVAGGLLSFNIIWPTDEPSIPRLLGM  127



>ref|XP_001419802.1| predicted protein [Ostreococcus lucimarinus CCE9901]
 gb|ABO98095.1| predicted protein [Ostreococcus lucimarinus CCE9901]
Length=195

 Score = 89.0 bits (219),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/74 (57%), Positives = 57/74 (77%), Gaps = 3/74 (4%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRASTASK---NPAVPGTTLYTVFEVQGYVSMLLGGALSFNLI  500
            L++ L K V+KTA TFAP +S  +K   NPA  G+ LYTVFEVQ Y+++++GG L+FN+I
Sbjct  39   LERNLSKFVKKTATTFAPSSSGEAKKKKNPAYKGSVLYTVFEVQAYLAVIVGGLLAFNVI  98

Query  501  FPSNEPXIWRLMGM  542
            +PS+EP I RLMGM
Sbjct  99   YPSDEPSIARLMGM  112



>ref|XP_007510705.1| predicted protein [Bathycoccus prasinos]
 emb|CCO18238.1| predicted protein [Bathycoccus prasinos]
Length=249

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/74 (59%), Positives = 53/74 (72%), Gaps = 3/74 (4%)
 Frame = +3

Query  330  LDKELKKVVQKTAATFAPRAS---TASKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLI  500
             DK L K V+KTA TFAP +S      KNPA  GT LY VFEVQ Y+++L+GG L+FN+I
Sbjct  96   FDKNLNKFVKKTATTFAPSSSGDAKKKKNPAQKGTVLYQVFEVQAYLAILIGGLLAFNVI  155

Query  501  FPSNEPXIWRLMGM  542
            +PS EP I RLMGM
Sbjct  156  YPSEEPTIARLMGM  169



>ref|XP_001695624.1| hypothetical protein CHLREDRAFT_184621 [Chlamydomonas reinhardtii]
 gb|EDP01411.1| predicted protein [Chlamydomonas reinhardtii]
Length=227

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 65/94 (69%), Gaps = 5/94 (5%)
 Frame = +3

Query  261  DEQESKGANSISNGAASTTINPALDKELKKVVQKTAATFAPRASTASKNPAVPGTTLYTV  440
            +EQ++  A        ST+  P+++K++ +  ++ A TFAPR+ST SKNPA  GT LY V
Sbjct  37   NEQQTTTAEQ-----PSTSSTPSVEKDILRSTRQIAGTFAPRSSTKSKNPATKGTVLYDV  91

Query  441  FEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            FE Q ++ ++ GG LSFN+I+P++EP I RL+GM
Sbjct  92   FEWQSWICLVAGGLLSFNIIWPTDEPSIPRLLGM  125



>emb|CEF99111.1| unnamed product, partial [Ostreococcus tauri]
Length=198

 Score = 82.4 bits (202),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 1/70 (1%)
 Frame = +3

Query  336  KELKKVVQKTAATFAPRASTA-SKNPAVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSN  512
            K+L    +KTA TFAPR S A  KNPA  G+ LY +FE Q Y ++ +GG L+FN+I+PS+
Sbjct  38   KDLSTFAKKTATTFAPRQSGAVKKNPAYKGSALYAIFEAQAYAAVAVGGLLAFNVIYPSD  97

Query  513  EPXIWRLMGM  542
            EP I RLMGM
Sbjct  98   EPSIARLMGM  107



>ref|NP_001183496.1| uncharacterized protein LOC100501929 [Zea mays]
 gb|ACR36964.1| unknown [Zea mays]
Length=97

 Score = 56.2 bits (134),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 25/26 (96%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +3

Query  465  MLLGGALSFNLIFPSNEPXIWRLMGM  542
            MLLGGALSFNLIFPSNEP IWRLMGM
Sbjct  1    MLLGGALSFNLIFPSNEPDIWRLMGM  26



>ref|XP_003081280.1| unnamed protein product, partial [Ostreococcus tauri]
Length=588

 Score = 57.0 bits (136),  Expect = 1e-06, Method: Composition-based stats.
 Identities = 24/44 (55%), Positives = 33/44 (75%), Gaps = 0/44 (0%)
 Frame = +3

Query  411  AVPGTTLYTVFEVQGYVSMLLGGALSFNLIFPSNEPXIWRLMGM  542
            A  G+ LY +FE Q Y ++ +GG L+FN+I+PS+EP I RLMGM
Sbjct  2    AYKGSALYAIFEAQAYAAVSVGGLLAFNVIYPSDEPSIARLMGM  45



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 565229601645