BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B10

Length=513
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|ABC40984.1|  chloroplast allene oxide cyclase precursor              189   1e-56   Ipomoea nil [qian niu]
ref|XP_009790745.1|  PREDICTED: allene oxide cyclase 4, chloropla...    138   9e-37   Nicotiana sylvestris
emb|CAC83765.1|  allene oxide cyclase                                   137   3e-36   Nicotiana tabacum [American tobacco]
ref|NP_001289444.1|  uncharacterized protein LOC104120106               134   3e-35   Nicotiana tomentosiformis
gb|ACD12705.1|  AOC                                                     132   2e-34   Petunia x hybrida [garden petunia]
ref|XP_006363132.1|  PREDICTED: allene oxide cyclase 3, chloropla...    127   1e-32   
ref|XP_011021206.1|  PREDICTED: allene oxide cyclase 3, chloropla...    125   6e-32   Populus euphratica
gb|AAU11327.1|  allene oxide cyclase                                    124   2e-31   Hyoscyamus niger [black henbane]
ref|XP_010103817.1|  Allene oxide cyclase 4                             123   5e-31   Morus notabilis
ref|XP_010061864.1|  PREDICTED: allene oxide cyclase 4, chloropla...    123   6e-31   Eucalyptus grandis [rose gum]
gb|ABK94763.1|  unknown                                                 123   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_002305951.2|  mangrin family protein                             123   7e-31   Populus trichocarpa [western balsam poplar]
ref|XP_011004427.1|  PREDICTED: allene oxide cyclase 3, chloropla...    123   7e-31   Populus euphratica
ref|NP_001234019.1|  allene oxide cyclase                               122   8e-31   Solanum lycopersicum
ref|NP_001241361.1|  allene oxide cyclase 4, chloroplastic-like         123   8e-31   Glycine max [soybeans]
gb|AAA80500.1|  unknown                                                 122   9e-31   Solanum lycopersicum
ref|NP_001275212.1|  allene oxide cyclase                               122   1e-30   Solanum tuberosum [potatoes]
ref|XP_009394846.1|  PREDICTED: allene oxide cyclase 1, chloropla...    122   1e-30   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK96763.1|  unknown                                                 122   1e-30   Populus trichocarpa x Populus deltoides
gb|ADY38579.1|  allene oxide cyclase                                    121   2e-30   Camellia sinensis [black tea]
ref|XP_002530384.1|  Allene oxide cyclase 4, chloroplast precurso...    122   3e-30   Ricinus communis
ref|XP_004514328.1|  PREDICTED: allene oxide cyclase 3, chloropla...    121   3e-30   Cicer arietinum [garbanzo]
ref|XP_003518680.1|  PREDICTED: allene oxide cyclase 4, chloropla...    121   4e-30   
gb|AEE99197.1|  allene oxide cyclase 2                                  121   4e-30   Glycine max [soybeans]
gb|KJB22383.1|  hypothetical protein B456_004G0462002                   117   5e-30   Gossypium raimondii
gb|ACU19690.1|  unknown                                                 120   5e-30   Glycine max [soybeans]
ref|XP_007033324.1|  Allene oxide cyclase isoform 2                     119   5e-30   
ref|XP_003614458.1|  Allene oxide cyclase                               120   7e-30   Medicago truncatula
ref|XP_004508556.1|  PREDICTED: allene oxide cyclase 3, chloropla...    120   7e-30   Cicer arietinum [garbanzo]
gb|ACU24579.1|  unknown                                                 119   8e-30   Glycine max [soybeans]
gb|ACZ06580.1|  allene oxide cyclase                                    120   9e-30   Jatropha curcas
gb|AFB69864.1|  allene oxide cyclase                                    119   9e-30   Salvia miltiorrhiza [Chinese salvia]
dbj|BAE45342.1|  allene oxide cyclase                                   120   1e-29   Pisum sativum [garden pea]
gb|KEH30395.1|  allene oxide cyclase                                    120   1e-29   Medicago truncatula
ref|XP_009392456.1|  PREDICTED: allene oxide cyclase 3, chloropla...    119   1e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|EYU44656.1|  hypothetical protein MIMGU_mgv1a012403mg                119   1e-29   Erythranthe guttata [common monkey flower]
emb|CDP00580.1|  unnamed protein product                                119   1e-29   Coffea canephora [robusta coffee]
ref|XP_007033323.1|  Allene oxide cyclase 4 isoform 1                   119   1e-29   
ref|XP_008459463.1|  PREDICTED: allene oxide cyclase 4, chloropla...    119   2e-29   Cucumis melo [Oriental melon]
emb|CDP02799.1|  unnamed protein product                                119   2e-29   Coffea canephora [robusta coffee]
gb|EYU29945.1|  hypothetical protein MIMGU_mgv1a012640mg                119   2e-29   Erythranthe guttata [common monkey flower]
gb|AFK47606.1|  unknown                                                 119   2e-29   Medicago truncatula
gb|KEH21777.1|  allene oxide cyclase                                    119   2e-29   Medicago truncatula
emb|CAI29046.1|  allene-oxide cyclase                                   119   2e-29   Medicago truncatula
ref|XP_006430815.1|  hypothetical protein CICLE_v10012552mg             119   3e-29   Citrus clementina [clementine]
ref|XP_011099573.1|  PREDICTED: LOW QUALITY PROTEIN: allene oxide...    119   3e-29   Sesamum indicum [beniseed]
gb|AGR49302.1|  allene oxide cyclase                                    119   3e-29   Catharanthus roseus [chatas]
ref|NP_001240200.1|  membrane primary amine oxidase                     119   3e-29   Glycine max [soybeans]
ref|XP_010265246.1|  PREDICTED: allene oxide cyclase 2, chloropla...    118   4e-29   Nelumbo nucifera [Indian lotus]
ref|XP_006482294.1|  PREDICTED: allene oxide cyclase 4, chloropla...    118   5e-29   Citrus sinensis [apfelsine]
gb|KHG19305.1|  Allene oxide cyclase 4, chloroplastic -like protein     118   5e-29   Gossypium arboreum [tree cotton]
gb|KJB22404.1|  hypothetical protein B456_004G046400                    118   5e-29   Gossypium raimondii
ref|XP_007046300.1|  Allene oxide cyclase                               117   8e-29   Theobroma cacao [chocolate]
gb|ADL60034.1|  allene oxide cyclase                                    117   8e-29   Salvia miltiorrhiza [Chinese salvia]
ref|XP_009394154.1|  PREDICTED: allene oxide cyclase 2, chloropla...    117   8e-29   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010660502.1|  PREDICTED: allene oxide cyclase                    117   9e-29   Vitis vinifera
ref|XP_010044291.1|  PREDICTED: allene oxide cyclase 3, chloropla...    117   1e-28   Eucalyptus grandis [rose gum]
ref|NP_001240078.1|  allene oxide cyclase 3, chloroplastic-like         117   1e-28   Glycine max [soybeans]
ref|XP_007139329.1|  hypothetical protein PHAVU_008G020200g             117   1e-28   Phaseolus vulgaris [French bean]
gb|KHN47545.1|  Allene oxide cyclase 4, chloroplastic                   117   1e-28   Glycine soja [wild soybean]
ref|NP_001242726.1|  allene oxide cyclase 4, chloroplastic-like         117   2e-28   Glycine max [soybeans]
dbj|BAB21610.2|  mangrin                                                117   2e-28   Bruguiera sexangula
gb|KJB22342.1|  hypothetical protein B456_004G046100                    116   2e-28   Gossypium raimondii
ref|NP_001240033.1|  allene oxide cyclase 4, chloroplastic-like         117   2e-28   Glycine max [soybeans]
ref|XP_003637011.1|  Allene oxide cyclase C4                            116   2e-28   
gb|KHG22804.1|  Allene oxide cyclase 4, chloroplastic -like protein     116   2e-28   Gossypium arboreum [tree cotton]
gb|KHG22803.1|  Allene oxide cyclase 4, chloroplastic -like protein     116   2e-28   Gossypium arboreum [tree cotton]
gb|KHG19308.1|  Allene oxide cyclase 4, chloroplastic -like protein     114   2e-28   Gossypium arboreum [tree cotton]
ref|XP_008339701.1|  PREDICTED: allene oxide cyclase 4, chloropla...    116   2e-28   
ref|XP_004309482.1|  PREDICTED: allene oxide cyclase 3, chloropla...    116   2e-28   Fragaria vesca subsp. vesca
gb|AGU09699.1|  allene oxide cyclase                                    116   2e-28   Gossypium hirsutum [American cotton]
gb|AFK38605.1|  unknown                                                 116   2e-28   Lotus japonicus
gb|KJB22328.1|  hypothetical protein B456_004G046300                    114   2e-28   Gossypium raimondii
gb|KHG12052.1|  Allene oxide cyclase 3, chloroplastic -like protein     116   2e-28   Gossypium arboreum [tree cotton]
ref|XP_010093405.1|  Allene oxide cyclase 4                             116   3e-28   Morus notabilis
gb|ABK21165.1|  unknown                                                 116   3e-28   Picea sitchensis
gb|AFV68275.1|  allene oxide cyclase                                    116   3e-28   Catharanthus roseus [chatas]
ref|XP_009356280.1|  PREDICTED: allene oxide cyclase 4, chloropla...    116   3e-28   Pyrus x bretschneideri [bai li]
gb|AHZ35333.1|  allene oxide cyclase                                    115   4e-28   Picrorhiza kurrooa
ref|XP_009336614.1|  PREDICTED: allene oxide cyclase 4, chloropla...    115   4e-28   Pyrus x bretschneideri [bai li]
ref|XP_008459462.1|  PREDICTED: allene oxide cyclase 4, chloropla...    115   4e-28   
gb|ADE76918.1|  unknown                                                 116   5e-28   Picea sitchensis
gb|EPS67695.1|  allene oxide cyclase                                    113   5e-28   Genlisea aurea
ref|XP_008389309.1|  PREDICTED: allene oxide cyclase 4, chloropla...    115   6e-28   
ref|XP_007154351.1|  hypothetical protein PHAVU_003G111500g             115   6e-28   Phaseolus vulgaris [French bean]
gb|AEC11095.1|  allene oxide cyclase                                    115   7e-28   Torenia fournieri [bluewings]
ref|XP_008465778.1|  PREDICTED: allene oxide cyclase 1, chloropla...    115   8e-28   Cucumis melo [Oriental melon]
gb|AFK41265.1|  unknown                                                 115   8e-28   Lotus japonicus
gb|AAX56078.1|  allene oxide cyclase                                    114   1e-27   Camptotheca acuminata
ref|XP_004297139.1|  PREDICTED: allene oxide cyclase 3, chloropla...    114   1e-27   Fragaria vesca subsp. vesca
gb|AEO13839.1|  allene oxide cyclase                                    114   2e-27   Gladiolus hybrid cultivar
ref|XP_008243177.1|  PREDICTED: allene oxide cyclase 3, chloropla...    114   2e-27   Prunus mume [ume]
ref|XP_007151755.1|  hypothetical protein PHAVU_004G072000g             113   3e-27   Phaseolus vulgaris [French bean]
ref|XP_007042039.1|  Allene oxide cyclase, putative                     113   3e-27   
ref|XP_008459464.1|  PREDICTED: allene oxide cyclase 4, chloropla...    113   3e-27   
ref|XP_007223720.1|  hypothetical protein PRUPE_ppa010397mg             113   5e-27   Prunus persica
ref|XP_004141500.1|  PREDICTED: allene oxide cyclase 4, chloropla...    112   8e-27   Cucumis sativus [cucumbers]
gb|KJB50746.1|  hypothetical protein B456_008G185600                    112   8e-27   Gossypium raimondii
ref|XP_008810937.1|  PREDICTED: allene oxide cyclase 3, chloropla...    112   9e-27   Phoenix dactylifera
gb|KHG03969.1|  Allene oxide cyclase 4, chloroplastic -like protein     112   9e-27   Gossypium arboreum [tree cotton]
ref|XP_009395977.1|  PREDICTED: allene oxide cyclase 1, chloropla...    113   9e-27   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004161644.1|  PREDICTED: allene oxide cyclase 3, chloropla...    112   1e-26   
ref|XP_004140337.1|  PREDICTED: allene oxide cyclase 3, chloropla...    112   1e-26   Cucumis sativus [cucumbers]
ref|XP_007215041.1|  hypothetical protein PRUPE_ppa012079mg             110   1e-26   Prunus persica
ref|XP_008230384.1|  PREDICTED: allene oxide cyclase 4, chloropla...    110   1e-26   Prunus mume [ume]
gb|ADL16493.1|  allene oxide cyclase                                    111   2e-26   Artemisia annua [sweet Annie]
gb|AAT96852.1|  allene oxide cyclase C4                                 111   2e-26   Humulus lupulus [common hop]
ref|XP_006430816.1|  hypothetical protein CICLE_v10012528mg             111   2e-26   Citrus clementina [clementine]
gb|AAT96851.1|  allene oxide cyclase C1                                 111   2e-26   Humulus lupulus [common hop]
ref|XP_011078449.1|  PREDICTED: allene oxide cyclase 3, chloropla...    110   2e-26   
gb|AET50928.1|  allene oxide cylase                                     110   3e-26   Lilium longiflorum [Easter lily]
ref|XP_011021732.1|  PREDICTED: allene oxide cyclase 3, chloropla...    110   4e-26   Populus euphratica
ref|XP_006482293.1|  PREDICTED: allene oxide cyclase 4, chloropla...    110   5e-26   Citrus sinensis [apfelsine]
gb|AFH89625.1|  allene oxide cyclase                                    110   7e-26   Cymbidium ensifolium
ref|XP_006437732.1|  hypothetical protein CICLE_v10032510mg             109   8e-26   Citrus clementina [clementine]
ref|XP_010924770.1|  PREDICTED: allene oxide cyclase 4, chloropla...    109   1e-25   Elaeis guineensis
gb|AIR76995.1|  allene oxide cyclase                                    106   1e-25   Lilium longiflorum [Easter lily]
ref|XP_009357038.1|  PREDICTED: allene oxide cyclase 4, chloropla...    107   1e-25   Pyrus x bretschneideri [bai li]
ref|XP_008348108.1|  PREDICTED: allene oxide cyclase 4, chloropla...    107   1e-25   
ref|XP_008379524.1|  PREDICTED: allene oxide cyclase 4, chloropla...    107   1e-25   
gb|AAT66741.1|  plastid allene oxide cyclase                            108   2e-25   Humulus lupulus [common hop]
ref|XP_002278768.1|  PREDICTED: allene oxide cyclase 4, chloropla...    108   2e-25   Vitis vinifera
gb|EYU29946.1|  hypothetical protein MIMGU_mgv1a012460mg                108   3e-25   Erythranthe guttata [common monkey flower]
ref|XP_010916944.1|  PREDICTED: allene oxide cyclase 1, chloropla...    108   3e-25   Elaeis guineensis
gb|ACS96438.1|  allene oxide cyclase                                    108   4e-25   Jatropha curcas
dbj|BAI58602.1|  mangrin                                                105   4e-25   Rhizophora mucronata
ref|XP_003637010.1|  Allene-oxide cyclase                               107   4e-25   
ref|XP_008792377.1|  PREDICTED: allene oxide cyclase 4, chloropla...    107   6e-25   Phoenix dactylifera
dbj|BAI58542.1|  mangrin                                                105   9e-25   Rhizophora apiculata
ref|XP_004304145.1|  PREDICTED: allene oxide cyclase 4, chloropla...    104   1e-24   Fragaria vesca subsp. vesca
gb|AHZ21033.1|  mangrin                                                 105   2e-24   Kandelia candel
ref|XP_006857130.1|  hypothetical protein AMTR_s00065p00146710          105   3e-24   Amborella trichopoda
ref|XP_002465087.1|  hypothetical protein SORBIDRAFT_01g031870          101   1e-22   Sorghum bicolor [broomcorn]
gb|EMS52587.1|  Allene oxide cyclase 3, chloroplastic                   100   1e-22   Triticum urartu
ref|XP_008359967.1|  PREDICTED: allene oxide cyclase 1, chloropla...    100   2e-22   
ref|XP_008388976.1|  PREDICTED: allene oxide cyclase 1, chloropla...    100   2e-22   
gb|AFP87550.1|  allene oxide cyclase 4                                  100   2e-22   Oryza sativa Indica Group [Indian rice]
ref|NP_001050447.1|  Os03g0438100                                       100   2e-22   
gb|EMT08815.1|  Allene oxide cyclase 3, chloroplastic                   100   2e-22   
ref|XP_003562362.1|  PREDICTED: allene oxide cyclase 3, chloropla...    100   2e-22   Brachypodium distachyon [annual false brome]
ref|XP_004983950.1|  PREDICTED: allene oxide cyclase 3, chloropla...    100   3e-22   Setaria italica
gb|EAZ27451.1|  hypothetical protein OsJ_11399                          100   3e-22   Oryza sativa Japonica Group [Japonica rice]
gb|AHA93095.1|  allene oxide cyclase 1                                99.8    3e-22   Triticum aestivum [Canadian hard winter wheat]
gb|AFP87304.1|  chloroplast allene oxide cyclase                      99.8    3e-22   Leymus mollis
ref|XP_010692616.1|  PREDICTED: allene oxide cyclase 2, chloropla...  99.8    4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010692623.1|  PREDICTED: allene oxide cyclase 2, chloropla...  99.8    4e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006650236.1|  PREDICTED: allene oxide cyclase 3, chloropla...  99.4    4e-22   Oryza brachyantha
ref|NP_001105245.1|  allene oxide cyclase1                            99.4    5e-22   Zea mays [maize]
ref|NP_001141267.1|  allene oxide cyclase 4                           99.4    5e-22   Zea mays [maize]
gb|ACG39242.1|  allene oxide cyclase 4                                99.0    5e-22   Zea mays [maize]
dbj|BAJ96870.1|  predicted protein                                    99.0    7e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY59866.1|  BnaC09g52550D                                        99.0    7e-22   Brassica napus [oilseed rape]
gb|ACY74378.1|  allene oxidase cyclase                                99.0    7e-22   Brassica napus [oilseed rape]
gb|ACG32920.1|  allene oxide cyclase 4                                99.0    7e-22   Zea mays [maize]
ref|XP_009114114.1|  PREDICTED: allene oxide cyclase 3, chloropla...  99.0    8e-22   Brassica rapa
gb|ACY74377.1|  allene oxidase cyclase                                99.0    8e-22   Brassica napus [oilseed rape]
emb|CAC83766.1|  allene oxide cyclase                                 98.6    8e-22   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|KFK35078.1|  hypothetical protein AALP_AA5G232400                  98.6    1e-21   Arabis alpina [alpine rockcress]
ref|XP_006395626.1|  hypothetical protein EUTSA_v10004810mg           97.8    2e-21   Eutrema salsugineum [saltwater cress]
gb|ABO61151.1|  allene oxide cyclase                                  93.6    3e-21   Nicotiana attenuata
ref|XP_009152186.1|  PREDICTED: allene oxide cyclase 3, chloropla...  96.7    3e-21   Brassica rapa
gb|AGU41846.1|  allene oxide cyclase                                  97.4    3e-21   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010556382.1|  PREDICTED: allene oxide cyclase 3, chloropla...  96.7    5e-21   Tarenaya hassleriana [spider flower]
ref|NP_001267900.1|  allene oxide cyclase                             96.7    6e-21   Vitis vinifera
ref|XP_010502459.1|  PREDICTED: allene oxide cyclase 3, chloropla...  95.9    1e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002875279.1|  hypothetical protein ARALYDRAFT_484340           95.9    1e-20   
ref|XP_006292768.1|  hypothetical protein CARUB_v10019017mg           95.9    1e-20   Capsella rubella
ref|NP_566777.1|  allene oxide cyclase 3                              95.9    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010528046.1|  PREDICTED: allene oxide cyclase 3, chloropla...  95.5    1e-20   Tarenaya hassleriana [spider flower]
ref|XP_010514199.1|  PREDICTED: allene oxide cyclase 3, chloropla...  95.5    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_002524412.1|  Allene oxide cyclase 3, chloroplast precurso...  95.1    2e-20   Ricinus communis
ref|XP_010554241.1|  PREDICTED: allene oxide cyclase 3, chloropla...  94.4    3e-20   Tarenaya hassleriana [spider flower]
ref|XP_010425230.1|  PREDICTED: allene oxide cyclase 3, chloropla...  92.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010476324.1|  PREDICTED: allene oxide cyclase 4, chloropla...  92.8    1e-19   Camelina sativa [gold-of-pleasure]
ref|XP_001783824.1|  predicted protein                                91.7    1e-19   
pdb|4H6B|A  Chain A, Structural Basis For Allene Oxide Cyclizatio...  91.7    2e-19   Physcomitrella patens
ref|NP_172786.1|  allene oxide cyclase 4                              92.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
gb|AAG09557.1|AC011810_16  Unknown Protein                            90.9    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002889998.1|  hypothetical protein ARALYDRAFT_334627           92.0    2e-19   
ref|XP_010514196.1|  PREDICTED: allene oxide cyclase 2, chloropla...  91.7    4e-19   
pdb|4CQ6|A  Chain A, The Crystal Structure Of The Allene Oxide Cy...  90.5    4e-19   Arabidopsis thaliana [mouse-ear cress]
pdb|2GIN|A  Chain A, X-Ray Structure Of The Wt Allene Oxide Cycla...  90.5    4e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010425228.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.9    5e-19   Camelina sativa [gold-of-pleasure]
ref|XP_010495179.1|  PREDICTED: allene oxide cyclase 4, chloropla...  91.3    5e-19   Camelina sativa [gold-of-pleasure]
gb|KFK35075.1|  hypothetical protein AALP_AA5G232000                  94.4    5e-19   Arabis alpina [alpine rockcress]
ref|NP_566776.1|  allene oxide cyclase 2                              90.9    6e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291721.1|  hypothetical protein CARUB_v10017888mg           90.9    6e-19   Capsella rubella
ref|XP_010458779.1|  PREDICTED: allene oxide cyclase 4, chloropla...  90.9    6e-19   Camelina sativa [gold-of-pleasure]
ref|XP_008370524.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.9    7e-19   
gb|KFK43593.1|  hypothetical protein AALP_AA1G146300                  90.9    7e-19   Arabis alpina [alpine rockcress]
ref|XP_002875278.1|  hypothetical protein ARALYDRAFT_484339           90.9    7e-19   
pdb|2DIO|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...  89.7    8e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514195.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.5    8e-19   Camelina sativa [gold-of-pleasure]
gb|ACN27052.1|  unknown                                               90.5    8e-19   Zea mays [maize]
pdb|1Z8K|A  Chain A, X-ray Structure Of Allene Oxide Cyclase From...  89.7    9e-19   Arabidopsis thaliana [mouse-ear cress]
pdb|2BRJ|A  Chain A, X-Ray Structure Of The Allene Oxide Cyclase ...  89.4    9e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010502447.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.5    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010502446.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_006304140.1|  hypothetical protein CARUB_v10010123mg           90.1    1e-18   Capsella rubella
ref|XP_010425227.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.1    1e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002875277.1|  ERD12 protein                                    89.7    2e-18   Arabidopsis lyrata subsp. lyrata
ref|XP_006291745.1|  hypothetical protein CARUB_v10017913mg           89.7    2e-18   Capsella rubella
emb|CDY50180.1|  BnaC08g15790D                                        89.7    2e-18   Brassica napus [oilseed rape]
ref|XP_010430726.1|  PREDICTED: allene oxide cyclase 2, chloropla...  90.1    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009110591.1|  PREDICTED: allene oxide cyclase 4, chloropla...  89.4    3e-18   Brassica rapa
ref|XP_001751254.1|  predicted protein                                88.2    3e-18   
gb|ABV89668.1|  ERD12 protein                                         89.0    3e-18   Brassica rapa
pdb|4H69|A  Chain A, Crystal Structure Of The Allene Oxide Cyclas...  88.2    3e-18   Physcomitrella patens
ref|XP_002969526.1|  hypothetical protein SELMODRAFT_91887            87.4    4e-18   
pdb|1ZVC|A  Chain A, X-Ray Structure Of Allene Oxide Cyclase From...  87.8    4e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAD48753.1|  allene oxide cyclase                                 87.4    5e-18   Physcomitrella patens
ref|NP_189204.1|  allene oxide cyclase 1                              88.6    5e-18   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB63918.1|  ERD12 protein                                        88.2    6e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010514198.1|  PREDICTED: allene oxide cyclase 2, chloropla...  87.8    8e-18   Camelina sativa [gold-of-pleasure]
emb|CDX83551.1|  BnaC07g22910D                                        87.4    1e-17   
emb|CDY13583.1|  BnaA06g33400D                                        86.3    1e-17   Brassica napus [oilseed rape]
ref|XP_006395628.1|  hypothetical protein EUTSA_v10004824mg           87.0    1e-17   Eutrema salsugineum [saltwater cress]
emb|CDY13582.1|  BnaA06g33410D                                        86.7    2e-17   Brassica napus [oilseed rape]
emb|CDX83550.1|  BnaC07g22900D                                        86.7    2e-17   
emb|CDY72244.1|  BnaCnng76690D                                        86.3    3e-17   Brassica napus [oilseed rape]
ref|XP_009114115.1|  PREDICTED: allene oxide cyclase 2, chloropla...  86.3    3e-17   Brassica rapa
emb|CDY59869.1|  BnaC09g52570D                                        86.3    3e-17   Brassica napus [oilseed rape]
ref|XP_010502458.1|  PREDICTED: allene oxide cyclase 3, chloropla...  84.0    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010425226.1|  PREDICTED: allene oxide cyclase 2, chloropla...  82.8    5e-16   Camelina sativa [gold-of-pleasure]
ref|XP_009394152.1|  PREDICTED: uncharacterized protein LOC103979...  82.4    7e-16   
ref|XP_009152113.1|  PREDICTED: allene oxide cyclase 2, chloropla...  82.0    9e-16   Brassica rapa
ref|XP_009394153.1|  PREDICTED: uncharacterized protein LOC103979...  82.4    1e-15   
emb|CAN68566.1|  hypothetical protein VITISV_032173                   77.8    2e-14   Vitis vinifera
ref|XP_010554242.1|  PREDICTED: allene oxide cyclase 3, chloropla...  77.4    3e-14   Tarenaya hassleriana [spider flower]
ref|XP_001760307.1|  predicted protein                                75.9    8e-14   
ref|XP_006373455.1|  hypothetical protein POPTR_0017s13940g           73.9    2e-13   
gb|AGL75607.1|  mangrin                                               68.6    2e-12   Rhizophora apiculata
ref|XP_001779767.1|  predicted protein                                70.5    7e-12   
ref|XP_001771240.1|  predicted protein                                70.1    1e-11   
tpg|DAA45889.1|  TPA: hypothetical protein ZEAMMB73_165754            67.4    3e-11   
ref|XP_003628626.1|  Allene-oxide cyclase                             64.7    3e-10   
dbj|BAO93687.1|  allene oxide cyclase                                 57.8    3e-07   Marchantia polymorpha



>gb|ABC40984.1| chloroplast allene oxide cyclase precursor [Ipomoea nil]
Length=245

 Score =   189 bits (481),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 119/119 (100%), Positives = 119/119 (100%), Gaps = 0/119 (0%)
 Frame = +2

Query  155  ISSSAKLPSTSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKVQE  334
            ISSSAKLPSTSPAVLKFQPFKRTNPLISKSLGLTASTAAAASKRSVTVKSQSAPAGKVQE
Sbjct  17   ISSSAKLPSTSPAVLKFQPFKRTNPLISKSLGLTASTAAAASKRSVTVKSQSAPAGKVQE  76

Query  335  LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  511
            LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE
Sbjct  77   LCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  135



>ref|XP_009790745.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Nicotiana 
sylvestris]
Length=245

 Score =   138 bits (347),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 95/122 (78%), Gaps = 3/122 (2%)
 Frame = +2

Query  155  ISSSAKLPSTSP---AVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  325
            ISSSAKL S+ P   A  K +PFK  NPLIS+SL L+ ST++ +        S  +   K
Sbjct  14   ISSSAKLTSSFPTTTASQKIRPFKLPNPLISQSLKLSTSTSSKSFYCKSQSSSTDSTTTK  73

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  506  HE  511
            HE
Sbjct  134  HE  135



>emb|CAC83765.1| allene oxide cyclase [Nicotiana tabacum]
Length=245

 Score =   137 bits (344),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 81/122 (66%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  155  ISSSAKLPSTSP---AVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  325
            ISSSAKL S+ P   A  K + FK  NPLIS+SL L  ST + +        S  +   K
Sbjct  14   ISSSAKLTSSFPTTSASQKIRSFKLPNPLISQSLKLGTSTNSKSFYCKSQSGSTDSSTTK  73

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  506  HE  511
            HE
Sbjct  134  HE  135



>ref|NP_001289444.1| uncharacterized protein LOC104120106 [Nicotiana tomentosiformis]
 gb|AGR88649.1| allene oxide cyclase [Nicotiana tomentosiformis]
Length=245

 Score =   134 bits (337),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 92/122 (75%), Gaps = 3/122 (2%)
 Frame = +2

Query  155  ISSSAKL-PS--TSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGK  325
            ISSSAKL PS  T+ A  K + FK  NPLIS+SL L  ST + +        S      K
Sbjct  14   ISSSAKLTPSFPTTSASQKIRSFKLPNPLISQSLKLGTSTNSKSFYCKSQSGSTDPSTTK  73

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIK
Sbjct  74   VQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIK  133

Query  506  HE  511
            HE
Sbjct  134  HE  135



>gb|ACD12705.1| AOC [Petunia x hybrida]
Length=243

 Score =   132 bits (332),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 73/108 (68%), Positives = 83/108 (77%), Gaps = 0/108 (0%)
 Frame = +2

Query  188  PAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKVQELCVYEINERDR  367
            P   K Q FK  NPLISK+L L+ ST + +        S  +   KVQEL VYE+NERDR
Sbjct  26   PTTQKIQSFKLPNPLISKTLKLSTSTNSKSFYCKSQSSSTDSTNTKVQELSVYEMNERDR  85

Query  368  GSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  511
            GSPAYLRLSQK+VN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIKHE
Sbjct  86   GSPAYLRLSQKTVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIKHE  133



>ref|XP_006363132.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Solanum tuberosum]
Length=244

 Score =   127 bits (320),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 75/121 (62%), Positives = 90/121 (74%), Gaps = 5/121 (4%)
 Frame = +2

Query  158  SSSAKLPS---TSPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAGKV  328
            SSS KLPS   T+    K Q FK  NPLIS++  LT ++ + + K   +    +    +V
Sbjct  16   SSSYKLPSAFQTTSLSQKIQSFKLPNPLISQTHKLTTASRSFSCKSQNSSTDSTNT--EV  73

Query  329  QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKH  508
            QEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILIKH
Sbjct  74   QELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILIKH  133

Query  509  E  511
            E
Sbjct  134  E  134



>ref|XP_011021206.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=254

 Score =   125 bits (315),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 59/69 (86%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             S PA KVQEL VYEINERDRGSPAYLRLS + VNTLGDLVPFSNKLYTGDLQKR+GITA
Sbjct  75   DSRPATKVQELNVYEINERDRGSPAYLRLSYRPVNTLGDLVPFSNKLYTGDLQKRIGITA  134

Query  485  GLCILIKHE  511
            GLCILI+H+
Sbjct  135  GLCILIQHK  143



>gb|AAU11327.1| allene oxide cyclase [Hyoscyamus niger]
Length=248

 Score =   124 bits (311),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 77/122 (63%), Positives = 89/122 (73%), Gaps = 4/122 (3%)
 Frame = +2

Query  158  SSSAKLPSTSP---AVLKFQPFKRTNPLIskslg-ltastaaaaskrsvtvksQSAPAGK  325
            SS+ KLPST P   A  K Q FK  NPLIS+SL   T++T + +        S  +   K
Sbjct  17   SSTYKLPSTFPLTSASQKIQSFKLPNPLISQSLKLNTSTTTSRSFSCKSQSSSTDSTTTK  76

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYE+NE DRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCIL K
Sbjct  77   VQELSVYELNEHDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILTK  136

Query  506  HE  511
            HE
Sbjct  137  HE  138



>ref|XP_010103817.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB97179.1| Allene oxide cyclase 4 [Morus notabilis]
Length=247

 Score =   123 bits (309),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +2

Query  314  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  493
            P  KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDLQKR+GITAG+C
Sbjct  72   PPTKVQELYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRIGITAGIC  131

Query  494  ILIKHE  511
            +LI+++
Sbjct  132  VLIQNK  137



>ref|XP_010061864.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Eucalyptus 
grandis]
 gb|KCW68894.1| hypothetical protein EUGRSUZ_F02479 [Eucalyptus grandis]
Length=256

 Score =   123 bits (308),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 59/75 (79%), Positives = 67/75 (89%), Gaps = 6/75 (8%)
 Frame = +2

Query  305  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQK  466
            Q+APAG      KVQELC+YEINERDRGSPA L+LSQK VN+LGDLVPFSNKLYTGDLQK
Sbjct  72   QAAPAGGDSAPGKVQELCIYEINERDRGSPAILKLSQKPVNSLGDLVPFSNKLYTGDLQK  131

Query  467  RVGITAGLCILIKHE  511
            RVGITAG+CILI+++
Sbjct  132  RVGITAGICILIQNK  146



>gb|ABK94763.1| unknown [Populus trichocarpa]
Length=251

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  503  KHE  511
            +++
Sbjct  138  QNK  140



>ref|XP_002305951.2| mangrin family protein [Populus trichocarpa]
 gb|ABK94126.1| unknown [Populus trichocarpa]
 gb|EEE86462.2| mangrin family protein [Populus trichocarpa]
Length=251

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  503  KHE  511
            +++
Sbjct  138  QNK  140



>ref|XP_011004427.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=251

 Score =   123 bits (308),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 57/63 (90%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  503  KHE  511
            +++
Sbjct  138  QNK  140



>ref|NP_001234019.1| allene oxide cyclase [Solanum lycopersicum]
 gb|AAK62358.1|AF384374_1 allene oxide cylase [Solanum lycopersicum]
 emb|CAB95731.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83759.1| allene oxide cyclase [Solanum lycopersicum]
 emb|CAC83760.1| allene oxide cyclase [Solanum lycopersicum]
Length=244

 Score =   122 bits (307),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  72   EVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  131

Query  503  KHE  511
            KHE
Sbjct  132  KHE  134



>ref|NP_001241361.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99196.1| allene oxide cyclase 1 [Glycine max]
 gb|KHN10797.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   123 bits (308),  Expect = 8e-31, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 64/68 (94%), Gaps = 1/68 (1%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S PA KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG
Sbjct  79   SQPA-KVQELFVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYSGDLQKRLGITAG  137

Query  488  LCILIKHE  511
            LC+LI+HE
Sbjct  138  LCVLIQHE  145



>gb|AAA80500.1| unknown, partial [Solanum lycopersicum]
Length=214

 Score =   122 bits (305),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  42   EVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  101

Query  503  KHE  511
            KHE
Sbjct  102  KHE  104



>ref|NP_001275212.1| allene oxide cyclase [Solanum tuberosum]
 gb|AAN37418.1| allene oxide cyclase [Solanum tuberosum]
Length=246

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 75/123 (61%), Positives = 90/123 (73%), Gaps = 5/123 (4%)
 Frame = +2

Query  158  SSSAKLPST---SPAVLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPAG--  322
            SSS KLPS    +    K Q  K  NPLIS++  LT ++  A+   S   ++ S  +   
Sbjct  16   SSSYKLPSAFQITSLSQKIQSLKLPNPLISQTHKLTTTSTTASRSFSCKSQNSSTDSTNT  75

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL VYE+NERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYT DL+KR+GITAGLCILI
Sbjct  76   EVQELSVYELNERDRGSPAYLRLSQKNVNSLGDLVPFSNKLYTADLKKRIGITAGLCILI  135

Query  503  KHE  511
            KHE
Sbjct  136  KHE  138



>ref|XP_009394846.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=249

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLY+G+L+KRVGITAG+C+LI
Sbjct  77   KVQELCVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYSGNLEKRVGITAGICVLI  136

Query  503  KH  508
            +H
Sbjct  137  QH  138



>gb|ABK96763.1| unknown [Populus trichocarpa x Populus deltoides]
Length=251

 Score =   122 bits (306),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 62/63 (98%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLYTGDLQKRVGITAGLC+LI
Sbjct  78   KVQELSVYEINERDRGSPAYLRLSQKAVNSLGDLVPFSNKLYTGDLQKRVGITAGLCVLI  137

Query  503  KHE  511
            +++
Sbjct  138  QNK  140



>gb|ADY38579.1| allene oxide cyclase [Camellia sinensis]
Length=245

 Score =   121 bits (304),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 62/62 (100%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQ+LCVYEINERDRGSPAYLRLSQKSVN+LGDLVPF+NK+YTGDLQKR+GITAG+CILI
Sbjct  73   KVQQLCVYEINERDRGSPAYLRLSQKSVNSLGDLVPFTNKVYTGDLQKRLGITAGICILI  132

Query  503  KH  508
            ++
Sbjct  133  QN  134



>ref|XP_002530384.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF31990.1| Allene oxide cyclase 4, chloroplast precursor, putative [Ricinus 
communis]
Length=263

 Score =   122 bits (305),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 57/75 (76%), Positives = 67/75 (89%), Gaps = 6/75 (8%)
 Frame = +2

Query  305  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQK  466
            Q+AP+       +VQELCVYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLYTGDLQ+
Sbjct  78   QAAPSDDNSRPTEVQELCVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNKLYTGDLQQ  137

Query  467  RVGITAGLCILIKHE  511
            R+GITAG+CILI+++
Sbjct  138  RIGITAGICILIQNK  152



>ref|XP_004514328.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=252

 Score =   121 bits (303),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 58/68 (85%), Positives = 65/68 (96%), Gaps = 1/68 (1%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S PA KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G+L+KR+GIT+G
Sbjct  76   SKPA-KVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGITSG  134

Query  488  LCILIKHE  511
            LCILI+HE
Sbjct  135  LCILIQHE  142



>ref|XP_003518680.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Glycine 
max]
Length=255

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAGLC+LI
Sbjct  83   KVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAGLCVLI  142

Query  503  KHE  511
            +HE
Sbjct  143  QHE  145



>gb|AEE99197.1| allene oxide cyclase 2 [Glycine max]
 gb|KHN23766.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   121 bits (303),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAGLC+LI
Sbjct  83   KVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAGLCVLI  142

Query  503  KHE  511
            +HE
Sbjct  143  QHE  145



>gb|KJB22383.1| hypothetical protein B456_004G0462002, partial [Gossypium raimondii]
Length=140

 Score =   117 bits (294),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  128  GICILIEHK  136



>gb|ACU19690.1| unknown [Glycine max]
Length=255

 Score =   120 bits (302),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYL+LSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAGLC+LI
Sbjct  83   KVQELFVYEINERDRGSPAYLKLSQKQVNSLGDLVPFSNKIYSGDLQKRLGITAGLCVLI  142

Query  503  KHE  511
            +HE
Sbjct  143  QHE  145



>ref|XP_007033324.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
 gb|EOY04250.1| Allene oxide cyclase isoform 2 [Theobroma cacao]
Length=191

 Score =   119 bits (298),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+YTGDLQKR+GIT+G+CILI
Sbjct  19   KVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYTGDLQKRIGITSGICILI  78

Query  503  KH  508
            +H
Sbjct  79   EH  80



>ref|XP_003614458.1| Allene oxide cyclase [Medicago truncatula]
 emb|CAC83767.1| allene oxide cyclase [Medicago truncatula]
 gb|ACJ84503.1| unknown [Medicago truncatula]
 gb|AES97416.1| allene oxide cyclase [Medicago truncatula]
 gb|AFK35723.1| unknown [Medicago truncatula]
Length=252

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 65/69 (94%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            +S+   KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G+L+KR+GIT+
Sbjct  74   ESSKPAKVQELFVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGNLEKRLGITS  133

Query  485  GLCILIKHE  511
            GLCILI++E
Sbjct  134  GLCILIQNE  142



>ref|XP_004508556.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cicer 
arietinum]
Length=260

 Score =   120 bits (301),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL +YE+NERDRGSPAYLRLS KSVNTLGDLVPFSNKLYTGDLQKR+GITAG+CILI
Sbjct  87   RVQELHLYELNERDRGSPAYLRLSNKSVNTLGDLVPFSNKLYTGDLQKRIGITAGICILI  146

Query  503  KH  508
            +H
Sbjct  147  QH  148



>gb|ACU24579.1| unknown [Glycine max]
Length=213

 Score =   119 bits (298),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+G LQKRVGITAG
Sbjct  80   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  139

Query  488  LCILIKHE  511
            +C+LI+++
Sbjct  140  ICVLIQNK  147



>gb|ACZ06580.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP32930.1| hypothetical protein JCGZ_12961 [Jatropha curcas]
Length=250

 Score =   120 bits (300),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K QEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLYTGDLQKR+GITAG+CILI
Sbjct  78   KFQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKLYTGDLQKRIGITAGICILI  137

Query  503  KHE  511
            +H+
Sbjct  138  EHK  140



>gb|AFB69864.1| allene oxide cyclase [Salvia miltiorrhiza]
 gb|AFB69865.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=239

 Score =   119 bits (299),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 55/63 (87%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGDL+KR GITAG+CILI
Sbjct  67   KVQELHVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRAGITAGICILI  126

Query  503  KHE  511
            K+E
Sbjct  127  KNE  129



>dbj|BAE45342.1| allene oxide cyclase [Pisum sativum]
Length=252

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            QS+  GKVQEL VYE+NER RGSPAYL+LSQKS+N+LGDLVPFSNKLY+G+L+KR+GITA
Sbjct  74   QSSKPGKVQELFVYEMNERGRGSPAYLKLSQKSMNSLGDLVPFSNKLYSGNLEKRIGITA  133

Query  485  GLCILIKH  508
            GLCILI+H
Sbjct  134  GLCILIQH  141



>gb|KEH30395.1| allene oxide cyclase [Medicago truncatula]
Length=257

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q++   KVQEL VYEINERDRGSPAYLRL  KSVN+LGDLVPFSNKLYTGDLQKR+GITA
Sbjct  79   QNSDIEKVQELNVYEINERDRGSPAYLRLGFKSVNSLGDLVPFSNKLYTGDLQKRIGITA  138

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  139  GICILIQHK  147



>ref|XP_009392456.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=250

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +2

Query  311  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
             PA  VQE+CVYEINE DR SPAYLRLSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAGL
Sbjct  74   GPATDVQEMCVYEINELDRNSPAYLRLSQKDVNSLGDLVPFSNKVYSGDLQKRLGITAGL  133

Query  491  CILIKH  508
            C+LI+H
Sbjct  134  CVLIQH  139



>gb|EYU44656.1| hypothetical protein MIMGU_mgv1a012403mg [Erythranthe guttata]
Length=251

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 93/126 (74%), Gaps = 9/126 (7%)
 Frame = +2

Query  158  SSSAKLPSTSPA-------VLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAP  316
            +SSAKLP ++ A       +L F+P  + NPLI + L  +A+  +  S +S  +   S  
Sbjct  17   TSSAKLPPSTTAAAAVAQKLLSFRPLIK-NPLIPQPLKFSAAQRSHFSCKSAQITDPSDT  75

Query  317  -AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  493
             + K+QEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGD++KR GITAG+C
Sbjct  76   RSSKIQELNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDMKKRAGITAGIC  135

Query  494  ILIKHE  511
            +LIK+E
Sbjct  136  VLIKNE  141



>emb|CDP00580.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K  N+LGDLVPFSNKLYTGDLQKR+GIT+GLC+LI
Sbjct  80   KVQELYVYEINERDRGSPAYLRLSKKDANSLGDLVPFSNKLYTGDLQKRLGITSGLCVLI  139

Query  503  KH  508
            KH
Sbjct  140  KH  141



>ref|XP_007033323.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
 gb|EOY04249.1| Allene oxide cyclase 4 isoform 1 [Theobroma cacao]
Length=253

 Score =   119 bits (299),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+YTGDLQKR+GIT+G+CILI
Sbjct  81   KVQELYVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKIYTGDLQKRIGITSGICILI  140

Query  503  KHE  511
            +H+
Sbjct  141  EHK  143



>ref|XP_008459463.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X2 [Cucumis melo]
Length=247

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S P+G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKRVGIT+G
Sbjct  70   SNPSGRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSG  129

Query  488  LCILIKHE  511
            LCIL++++
Sbjct  130  LCILVQNK  137



>emb|CDP02799.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 73/120 (61%), Positives = 90/120 (75%), Gaps = 11/120 (9%)
 Frame = +2

Query  173  LPSTSPA---VLKFQPFKRTNPLIskslgltastaaaaskrsvtvksQSAPA----GKVQ  331
            L S+SP    +L F+PF  +NPLIS +  LTA+ AA     +     QSAP+     KVQ
Sbjct  21   LTSSSPTAQNILSFKPF--SNPLISNNFRLTANFAATCRSFTCKS--QSAPSDSTPAKVQ  76

Query  332  ELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  511
            EL VYEINERDRGSPA+L+LSQK VN+LGDL+PF+NK+Y+G LQKR+GITAG+CILIKHE
Sbjct  77   ELNVYEINERDRGSPAFLKLSQKDVNSLGDLIPFTNKIYSGCLQKRLGITAGICILIKHE  136



>gb|EYU29945.1| hypothetical protein MIMGU_mgv1a012640mg [Erythranthe guttata]
Length=244

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/62 (87%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKLY+GDLQKR+GITAGLC+LI
Sbjct  72   KVQELYVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYSGDLQKRLGITAGLCVLI  131

Query  503  KH  508
            +H
Sbjct  132  QH  133



>gb|AFK47606.1| unknown [Medicago truncatula]
Length=251

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            + A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT 
Sbjct  71   EYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITT  130

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  131  GICILIEHK  139



>gb|KEH21777.1| allene oxide cyclase [Medicago truncatula]
Length=250

 Score =   119 bits (298),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            + A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT 
Sbjct  71   EYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITT  130

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  131  GICILIEHK  139



>emb|CAI29046.1| allene-oxide cyclase [Medicago truncatula]
Length=250

 Score =   119 bits (297),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            + A   KVQE+ VYE+NERDRGSPAYLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT 
Sbjct  71   EYADTEKVQEMHVYELNERDRGSPAYLRLSNKSVNSLGDLVPFSNKLYTGDLQKRIGITT  130

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  131  GICILIEHK  139



>ref|XP_006430815.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
 gb|ESR44055.1| hypothetical protein CICLE_v10012552mg [Citrus clementina]
Length=251

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLYTGDLQKRVGITAG+CILI
Sbjct  79   KVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYTGDLQKRVGITAGICILI  138

Query  503  KHE  511
            +++
Sbjct  139  ENK  141



>ref|XP_011099573.1| PREDICTED: LOW QUALITY PROTEIN: allene oxide cyclase 4, chloroplastic-like 
[Sesamum indicum]
Length=247

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/65 (82%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            + KVQ+L VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGDL+KR GITAG+C+
Sbjct  76   SSKVQQLNVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRAGITAGICV  135

Query  497  LIKHE  511
            LIK+E
Sbjct  136  LIKNE  140



>gb|AGR49302.1| allene oxide cyclase [Catharanthus roseus]
Length=254

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            QS+   KVQEL VYEINERDRGSPA+L+LS+K VN+LGDLVPF+NKLYTGDLQKR+GITA
Sbjct  76   QSSVPTKVQELFVYEINERDRGSPAFLKLSKKEVNSLGDLVPFTNKLYTGDLQKRLGITA  135

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  136  GLCVLIQH  143



>ref|NP_001240200.1| membrane primary amine oxidase [Glycine max]
 gb|AEE99198.1| allene oxide cyclase 3 [Glycine max]
 gb|KHN28337.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=257

 Score =   119 bits (297),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+G LQKRVGITAG
Sbjct  80   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  139

Query  488  LCILIKHE  511
            +C+LI+++
Sbjct  140  ICVLIQNK  147



>ref|XP_010265246.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Nelumbo 
nucifera]
Length=256

 Score =   118 bits (296),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDLQKR+GITAG+C+LI
Sbjct  84   KVQELHVYEINERDRGSPAYLRLSQKEVNSLGDLVPFSNKIYSGDLQKRLGITAGICVLI  143

Query  503  KH  508
            +H
Sbjct  144  QH  145



>ref|XP_006482294.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
 gb|KDO36048.1| hypothetical protein CISIN_1g025525mg [Citrus sinensis]
Length=251

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 56/63 (89%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLYTGDLQKR+GITAGLCILI
Sbjct  79   KVQELHVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYTGDLQKRLGITAGLCILI  138

Query  503  KHE  511
            +++
Sbjct  139  ENK  141



>gb|KHG19305.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=245

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GITA
Sbjct  68   NSAP-DKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKMYRGDLEKRIGITA  126

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  127  GICILIEHK  135



>gb|KJB22404.1| hypothetical protein B456_004G046400 [Gossypium raimondii]
Length=245

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL +YE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GITA
Sbjct  68   NSAP-DKVQELHIYEMNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITA  126

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  127  GICILIEHK  135



>ref|XP_007046300.1| Allene oxide cyclase [Theobroma cacao]
 gb|EOY02132.1| Allene oxide cyclase [Theobroma cacao]
Length=256

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQELCVYEINERDR SPA L+LSQK VN+LGDLVPF+NKLYTGDLQKR+GITAGLC+LI
Sbjct  84   KVQELCVYEINERDRNSPAVLKLSQKPVNSLGDLVPFTNKLYTGDLQKRLGITAGLCVLI  143

Query  503  KH  508
            +H
Sbjct  144  QH  145



>gb|ADL60034.1| allene oxide cyclase [Salvia miltiorrhiza]
Length=245

 Score =   117 bits (293),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 53/62 (85%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NERDRGSPAYLRL QK  NTLGDLVPFSNKLY+GDLQKR+GITAGLC+LI
Sbjct  73   KVQELYVYEMNERDRGSPAYLRLGQKQQNTLGDLVPFSNKLYSGDLQKRLGITAGLCVLI  132

Query  503  KH  508
            +H
Sbjct  133  QH  134



>ref|XP_009394154.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X3 [Musa acuminata subsp. malaccensis]
Length=259

 Score =   117 bits (294),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNKLY+G+L+KR+GIT+G+C+LI
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNKLYSGNLEKRLGITSGICVLI  146

Query  503  KH  508
            +H
Sbjct  147  QH  148



>ref|XP_010660502.1| PREDICTED: allene oxide cyclase [Vitis vinifera]
 emb|CBI16856.3| unnamed protein product [Vitis vinifera]
Length=251

 Score =   117 bits (293),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/73 (77%), Positives = 66/73 (90%), Gaps = 5/73 (7%)
 Frame = +2

Query  305  QSAPAG-----KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKR  469
            QS+P+      KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNK+YTGDL+KR
Sbjct  68   QSSPSDPPRPTKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYTGDLEKR  127

Query  470  VGITAGLCILIKH  508
            +G+TAGLC+LI++
Sbjct  128  LGVTAGLCVLIQN  140



>ref|XP_010044291.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Eucalyptus 
grandis]
Length=253

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 61/62 (98%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQELCVYEINERDRGSPA+LRLS+K VN+LGDLVPF+NKLY+GDLQ+R+G+T+GLC++I
Sbjct  81   KVQELCVYEINERDRGSPAFLRLSEKPVNSLGDLVPFTNKLYSGDLQRRLGVTSGLCVVI  140

Query  503  KH  508
            +H
Sbjct  141  QH  142



>ref|NP_001240078.1| allene oxide cyclase 3, chloroplastic-like [Glycine max]
 gb|AEE99199.1| allene oxide cyclase 4 [Glycine max]
 gb|KHN47653.1| Allene oxide cyclase 3, chloroplastic [Glycine soja]
Length=253

 Score =   117 bits (293),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 54/68 (79%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S+ + KVQEL VYEINERDRGSPAYLRLSQK+VN+LGDLVPFSNKLY+G LQKRVGITAG
Sbjct  76   SSDSAKVQELSVYEINERDRGSPAYLRLSQKTVNSLGDLVPFSNKLYSGCLQKRVGITAG  135

Query  488  LCILIKHE  511
            +C+LI+++
Sbjct  136  ICVLIQNK  143



>ref|XP_007139329.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
 gb|ESW11323.1| hypothetical protein PHAVU_008G020200g [Phaseolus vulgaris]
Length=250

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/69 (77%), Positives = 62/69 (90%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q   + KVQEL VYEINERDRGSP YLRLS K+VN+LGDLVPFSNKLYTGDLQKR+GIT+
Sbjct  72   QPVSSEKVQELSVYEINERDRGSPVYLRLSYKTVNSLGDLVPFSNKLYTGDLQKRIGITS  131

Query  485  GLCILIKHE  511
            G+CILI+++
Sbjct  132  GICILIQNK  140



>gb|KHN47545.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=257

 Score =   117 bits (292),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT+G+CILI
Sbjct  85   KVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  144

Query  503  KHE  511
            +++
Sbjct  145  QNK  147



>ref|NP_001242726.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99200.1| allene oxide cyclase 5 [Glycine max]
Length=257

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT+G+CILI
Sbjct  85   KVQELTVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  144

Query  503  KHE  511
            +++
Sbjct  145  QNK  147



>dbj|BAB21610.2| mangrin [Bruguiera sexangula]
Length=256

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQELCVYE+NERDRGSPA LRLSQK VN+LGDLVPFSNK+Y+GDLQKR+G+TAG+CILI
Sbjct  84   KVQELCVYEMNERDRGSPAVLRLSQKPVNSLGDLVPFSNKVYSGDLQKRIGVTAGICILI  143

Query  503  KHE  511
            +++
Sbjct  144  QNK  146



>gb|KJB22342.1| hypothetical protein B456_004G046100 [Gossypium raimondii]
Length=246

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  128  GICILIEHK  136



>ref|NP_001240033.1| allene oxide cyclase 4, chloroplastic-like [Glycine max]
 gb|AEE99201.1| allene oxide cyclase 6 [Glycine max]
 gb|KHN13814.1| Allene oxide cyclase 4, chloroplastic [Glycine soja]
Length=255

 Score =   117 bits (292),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/63 (84%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSP YLRLS KSVN+LGDLVPFSNKLYTGDLQKR+GIT+G+CILI
Sbjct  83   KVQELSVYEINERDRGSPVYLRLSYKSVNSLGDLVPFSNKLYTGDLQKRIGITSGICILI  142

Query  503  KHE  511
            +++
Sbjct  143  QNK  145



>ref|XP_003637011.1| Allene oxide cyclase C4 [Medicago truncatula]
 gb|KEH25317.1| allene oxide cyclase [Medicago truncatula]
Length=234

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/69 (78%), Positives = 64/69 (93%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            QS+ + KVQEL VYEINE+DRGSPAYLRLSQK+VNTL DLVPFSNKLY+G LQKRVGITA
Sbjct  71   QSSNSVKVQELSVYEINEKDRGSPAYLRLSQKNVNTLNDLVPFSNKLYSGCLQKRVGITA  130

Query  485  GLCILIKHE  511
            G+C+LI+++
Sbjct  131  GICVLIQNK  139



>gb|KHG22804.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  128  GICILIEHK  136



>gb|KHG22803.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=246

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  128  GICILIEHK  136



>gb|KHG19308.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=178

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  311  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPFSNK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  491  CILIKH  508
            CILI+H
Sbjct  62   CILIEH  67



>ref|XP_008339701.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
Length=253

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VNTLGDLVPFSNK+Y+G+L+KR+GITAGLC+LI
Sbjct  81   KVQELHVYEINERDRGSPAYLRLSQKQVNTLGDLVPFSNKIYSGBLEKRLGITAGLCVLI  140

Query  503  KH  508
            ++
Sbjct  141  QN  142



>ref|XP_004309482.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=249

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/75 (73%), Positives = 66/75 (88%), Gaps = 6/75 (8%)
 Frame = +2

Query  305  QSAPAG------KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQK  466
            QS+P+       KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPFSNKLYTGDLQK
Sbjct  64   QSSPSSETERSTKVQELNVYEINERDRGSPAFLKLSQKPVNSLGDLVPFSNKLYTGDLQK  123

Query  467  RVGITAGLCILIKHE  511
            R+GITAG+C+LI+++
Sbjct  124  RIGITAGICVLIENK  138



>gb|AGU09699.1| allene oxide cyclase [Gossypium hirsutum]
Length=246

 Score =   116 bits (290),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/69 (80%), Positives = 64/69 (93%), Gaps = 1/69 (1%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
             SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+
Sbjct  69   NSAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITS  127

Query  485  GLCILIKHE  511
            G+CILI+H+
Sbjct  128  GICILIEHK  136



>gb|AFK38605.1| unknown [Lotus japonicus]
Length=248

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 54/63 (86%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY+G LQKRVGITAG+C+LI
Sbjct  76   KVQELSVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYSGCLQKRVGITAGICVLI  135

Query  503  KHE  511
            +++
Sbjct  136  ENK  138



>gb|KJB22328.1| hypothetical protein B456_004G046300 [Gossypium raimondii]
Length=178

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +2

Query  311  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
            A + KVQEL VYE+NERDRGSPAYLRLSQK VN+LGD+VPFSNK+Y GDL+KR+GITAG+
Sbjct  2    AASDKVQELHVYEMNERDRGSPAYLRLSQKPVNSLGDIVPFSNKIYRGDLEKRIGITAGM  61

Query  491  CILIKH  508
            CILI+H
Sbjct  62   CILIEH  67



>gb|KHG12052.1| Allene oxide cyclase 3, chloroplastic -like protein [Gossypium 
arboreum]
Length=260

 Score =   116 bits (291),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 63/67 (94%), Gaps = 1/67 (1%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            SAP  KVQEL VYE+NERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y GDL+KR+GIT+G
Sbjct  84   SAPE-KVQELHVYELNERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYRGDLEKRIGITSG  142

Query  488  LCILIKH  508
            +CILI+H
Sbjct  143  ICILIEH  149



>ref|XP_010093405.1| Allene oxide cyclase 4 [Morus notabilis]
 gb|EXB53999.1| Allene oxide cyclase 4 [Morus notabilis]
Length=255

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            +S+   KVQEL VYEINERDRGSPA+L+LSQK VN+LGDLVPF+NK+YTGDLQKR+GIT+
Sbjct  77   ESSRPTKVQELHVYEINERDRGSPAFLKLSQKQVNSLGDLVPFTNKIYTGDLQKRLGITS  136

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  137  GLCVLIQH  144



>gb|ABK21165.1| unknown [Picea sitchensis]
Length=276

 Score =   116 bits (291),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 55/68 (81%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q  P+G VQEL VYEINE DRGSPAYLRLSQK VN LGDLVPFSNKLYTG+LQKR+GITA
Sbjct  96   QGPPSGSVQELHVYEINELDRGSPAYLRLSQKPVNHLGDLVPFSNKLYTGNLQKRIGITA  155

Query  485  GLCILIKH  508
            G+CILI+ 
Sbjct  156  GICILIQQ  163



>gb|AFV68275.1| allene oxide cyclase [Catharanthus roseus]
Length=251

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 61/63 (97%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K+QEL VYEINERDRGSPAYLRLSQK+ N+LGDLVPF+NK+Y+GDLQKR+GIT+G+CILI
Sbjct  79   KIQELHVYEINERDRGSPAYLRLSQKTANSLGDLVPFTNKVYSGDLQKRLGITSGICILI  138

Query  503  KHE  511
            K+E
Sbjct  139  KNE  141



>ref|XP_009356280.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=253

 Score =   116 bits (290),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNK+Y+GDL+KR+GITAGLC+LI
Sbjct  81   KVQELHVYEINERDRGSPAYLRLSQKQVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  140

Query  503  KH  508
            ++
Sbjct  141  QN  142



>gb|AHZ35333.1| allene oxide cyclase [Picrorhiza kurrooa]
Length=254

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            A +VQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPF+NKLY+GDLQKR+GITAGL +
Sbjct  80   ATRVQELYVYEINERDRGSPAYLRLSQKEVNSLGDLVPFTNKLYSGDLQKRLGITAGLTV  139

Query  497  LIKH  508
            LI+H
Sbjct  140  LIQH  143



>ref|XP_009336614.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Pyrus x bretschneideri]
Length=252

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+GITAGLC+LI
Sbjct  80   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  139

Query  503  KH  508
            ++
Sbjct  140  QN  141



>ref|XP_008459462.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X1 [Cucumis melo]
Length=251

 Score =   115 bits (289),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 52/65 (80%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
             G+VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKRVGIT+GLCI
Sbjct  77   GGRVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSGLCI  136

Query  497  LIKHE  511
            L++++
Sbjct  137  LVQNK  141



>gb|ADE76918.1| unknown [Picea sitchensis]
Length=274

 Score =   116 bits (290),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q  P+G VQEL VYE+NE DRGSPAYLRLSQK VN LGD+VPFSNKLY+G+LQKR+GITA
Sbjct  96   QGPPSGSVQELYVYEMNELDRGSPAYLRLSQKPVNHLGDIVPFSNKLYSGNLQKRLGITA  155

Query  485  GLCILIKH  508
            G+CILI+H
Sbjct  156  GICILIQH  163



>gb|EPS67695.1| allene oxide cyclase, partial [Genlisea aurea]
Length=175

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS K+VN++GDLVPFSNK+YTGDL+KR GITAG+C+L+
Sbjct  3    KVQELNVYEINERDRGSPAYLRLSNKTVNSIGDLVPFSNKIYTGDLKKRAGITAGICLLV  62

Query  503  KHE  511
            ++E
Sbjct  63   RNE  65



>ref|XP_008389309.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Malus domestica]
 ref|XP_008350872.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=252

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+GITAGLC+LI
Sbjct  80   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITAGLCVLI  139

Query  503  KH  508
            ++
Sbjct  140  QN  141



>ref|XP_007154351.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
 gb|ESW26345.1| hypothetical protein PHAVU_003G111500g [Phaseolus vulgaris]
Length=254

 Score =   115 bits (288),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  320  GKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
             KVQEL VYEINERDRGSPA+LRLSQK VN+LGDLVPFSNK+Y+G+L+KR+GITAGLC+L
Sbjct  81   AKVQELFVYEINERDRGSPAFLRLSQKPVNSLGDLVPFSNKIYSGNLEKRLGITAGLCVL  140

Query  500  IKH  508
            I+H
Sbjct  141  IQH  143



>gb|AEC11095.1| allene oxide cyclase [Torenia fournieri]
Length=240

 Score =   115 bits (287),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 60/63 (95%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQE+ VYEINE DRGSPAYLRLSQK+VN+LGDLVPFSNK+YTGDL+KR GIT+G+CILI
Sbjct  67   QVQEMHVYEINELDRGSPAYLRLSQKTVNSLGDLVPFSNKVYTGDLKKRCGITSGICILI  126

Query  503  KHE  511
            KHE
Sbjct  127  KHE  129



>ref|XP_008465778.1| PREDICTED: allene oxide cyclase 1, chloroplastic [Cucumis melo]
Length=250

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            + KVQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GITAGLC+
Sbjct  76   SAKVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITAGLCV  135

Query  497  LIKH  508
            LI+H
Sbjct  136  LIQH  139



>gb|AFK41265.1| unknown [Lotus japonicus]
Length=256

 Score =   115 bits (287),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/67 (81%), Positives = 62/67 (93%), Gaps = 1/67 (1%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S PA KVQEL VYEINERDRGSPAYLRLSQK VN+LGDLVPFSNKLY+G+L+KR+GIT G
Sbjct  80   SRPA-KVQELSVYEINERDRGSPAYLRLSQKPVNSLGDLVPFSNKLYSGNLEKRLGITTG  138

Query  488  LCILIKH  508
            LC+LI++
Sbjct  139  LCVLIQN  145



>gb|AAX56078.1| allene oxide cyclase [Camptotheca acuminata]
Length=246

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 93/125 (74%), Gaps = 8/125 (6%)
 Frame = +2

Query  155  ISSSAKLPS----TSPAVLKFQPFKRTNPLIskslgltastaaaaskrs---vtvksQSA  313
            ISSS KLP+    TSPA  K   FK +NP +S++L LT + A +    +    +  S S+
Sbjct  12   ISSSVKLPTATAITSPA-QKLTHFKLSNPFVSQNLRLTTTAAPSRISFTCKCQSSXSDSS  70

Query  314  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  493
               KVQEL VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNK+Y+G L+KR+G+TAG+C
Sbjct  71   RPSKVQELHVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKIYSGCLKKRLGVTAGIC  130

Query  494  ILIKH  508
            +LI++
Sbjct  131  VLIRN  135



>ref|XP_004297139.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Fragaria vesca 
subsp. vesca]
Length=250

 Score =   114 bits (285),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+GIT+GLC+LI
Sbjct  78   KVQELNVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGITSGLCVLI  137

Query  503  KH  508
            ++
Sbjct  138  QN  139



>gb|AEO13839.1| allene oxide cyclase [Gladiolus hybrid cultivar]
Length=244

 Score =   114 bits (284),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/62 (84%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K+Q+L VYEINERDRGSPAYLRLSQKSVN+LGDLVPFSNKLY G+L+KR+GITAGLC LI
Sbjct  72   KIQKLYVYEINERDRGSPAYLRLSQKSVNSLGDLVPFSNKLYHGNLEKRLGITAGLCTLI  131

Query  503  KH  508
            +H
Sbjct  132  QH  133



>ref|XP_008243177.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Prunus mume]
Length=274

 Score =   114 bits (285),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPFSNK+Y+GDL+KR+G+TAGLC+LI
Sbjct  101  KVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFSNKIYSGDLEKRLGVTAGLCVLI  160

Query  503  KH  508
            ++
Sbjct  161  QN  162



>ref|XP_007151755.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
 gb|ESW23749.1| hypothetical protein PHAVU_004G072000g [Phaseolus vulgaris]
Length=253

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/69 (74%), Positives = 63/69 (91%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            +++ + KVQEL VYEINERDRGSPAYLRL QK+ N+LGDLVPFSNKLY+G LQKRVGITA
Sbjct  75   RTSDSAKVQELSVYEINERDRGSPAYLRLGQKTTNSLGDLVPFSNKLYSGCLQKRVGITA  134

Query  485  GLCILIKHE  511
            G+C+LI+++
Sbjct  135  GICVLIQNK  143



>ref|XP_007042039.1| Allene oxide cyclase, putative [Theobroma cacao]
 gb|EOX97870.1| Allene oxide cyclase, putative [Theobroma cacao]
Length=251

 Score =   113 bits (283),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYL LSQKSV +LGDLV FSNKLYTGD+QKR+GIT+G+CIL+
Sbjct  79   KVQELYVYEINERDRGSPAYLSLSQKSVKSLGDLVCFSNKLYTGDMQKRIGITSGMCILV  138

Query  503  KHE  511
            +H+
Sbjct  139  QHK  141



>ref|XP_008459464.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like isoform 
X3 [Cucumis melo]
Length=246

 Score =   113 bits (282),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLYTGDLQKRVGIT+GLCIL+
Sbjct  74   RVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYTGDLQKRVGITSGLCILV  133

Query  503  KHE  511
            +++
Sbjct  134  QNK  136



>ref|XP_007223720.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
 gb|EMJ24919.1| hypothetical protein PRUPE_ppa010397mg [Prunus persica]
Length=251

 Score =   113 bits (282),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 60/62 (97%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPAYLRLS+K VN+LGDLVPF+NK+Y+GDL+KR+G+TAGLC+LI
Sbjct  78   KVQELHVYEINERDRGSPAYLRLSKKEVNSLGDLVPFTNKIYSGDLEKRLGVTAGLCVLI  137

Query  503  KH  508
            ++
Sbjct  138  QN  139



>ref|XP_004141500.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Cucumis 
sativus]
 gb|KGN52574.1| hypothetical protein Csa_5G644020 [Cucumis sativus]
Length=247

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            +VQEL VYEINERDR SPAYLRLSQK+ N LGDLVPF+NKLY+GDLQKRVGITAGLCIL+
Sbjct  75   RVQELYVYEINERDRQSPAYLRLSQKNTNALGDLVPFTNKLYSGDLQKRVGITAGLCILV  134

Query  503  KHE  511
            +++
Sbjct  135  QNK  137



>gb|KJB50746.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
 gb|KJB50747.1| hypothetical protein B456_008G185600 [Gossypium raimondii]
Length=253

 Score =   112 bits (280),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF+NKLY+GDLQKRVGITAGLC+LI
Sbjct  81   KVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQKRVGITAGLCVLI  140

Query  503  KH  508
            +H
Sbjct  141  QH  142



>ref|XP_008810937.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   112 bits (279),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQE+CVYEINERDR SPAYLRLSQK VN+LGDLVPFSNK+Y G+L+KR+GITAG+ ILI
Sbjct  73   KVQEMCVYEINERDRNSPAYLRLSQKEVNSLGDLVPFSNKVYHGNLEKRLGITAGITILI  132

Query  503  KH  508
            +H
Sbjct  133  QH  134



>gb|KHG03969.1| Allene oxide cyclase 4, chloroplastic -like protein [Gossypium 
arboreum]
Length=253

 Score =   112 bits (280),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NERDR SPA L+LSQK VN+LGDLVPF+NKLY+GDLQKRVGITAGLC+LI
Sbjct  81   KVQELHVYEMNERDRSSPAVLKLSQKPVNSLGDLVPFTNKLYSGDLQKRVGITAGLCVLI  140

Query  503  KH  508
            +H
Sbjct  141  QH  142



>ref|XP_009395977.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Musa acuminata 
subsp. malaccensis]
Length=312

 Score =   113 bits (282),  Expect = 9e-27, Method: Compositional matrix adjust.
 Identities = 51/62 (82%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSP YLRLSQK VN LGDLVPFSNKLY+G+L+KR+GITAG+C+LI
Sbjct  140  KVQELSVYEINERDRGSPVYLRLSQKEVNCLGDLVPFSNKLYSGNLEKRLGITAGICVLI  199

Query  503  KH  508
            +H
Sbjct  200  QH  201



>ref|XP_004161644.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
Length=250

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  497  LIKH  508
            LI+H
Sbjct  136  LIQH  139



>ref|XP_004140337.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Cucumis 
sativus]
 gb|KGN50952.1| Allene oxide cyclase [Cucumis sativus]
Length=250

 Score =   112 bits (279),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            + +VQEL VYEINERDRGSPA+L+LS+K+ N+LGDLVPFSNKLY+GDLQKR+GIT GLC+
Sbjct  76   SARVQELFVYEINERDRGSPAFLKLSKKAENSLGDLVPFSNKLYSGDLQKRLGITTGLCV  135

Query  497  LIKH  508
            LI+H
Sbjct  136  LIQH  139



>ref|XP_007215041.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
 gb|EMJ16240.1| hypothetical protein PRUPE_ppa012079mg [Prunus persica]
Length=184

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF+NK+YTGDLQKR+G+TAG+CILI
Sbjct  11   KVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVTAGICILI  70

Query  503  KH  508
            ++
Sbjct  71   EN  72



>ref|XP_008230384.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Prunus 
mume]
Length=184

 Score =   110 bits (275),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 58/62 (94%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPF+NK+YTGDLQKR+G+TAG+CILI
Sbjct  11   KVQELHVYEINERDRASPAYLSLSQKPVNSLGDLVPFTNKIYTGDLQKRLGVTAGICILI  70

Query  503  KH  508
            ++
Sbjct  71   EN  72



>gb|ADL16493.1| allene oxide cyclase [Artemisia annua]
Length=249

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KV ELCVYEINERDRGSPAYLRL QK VN+LGDLVPF+NK+Y+ DL+ R+GITAG+CILI
Sbjct  76   KVHELCVYEINERDRGSPAYLRLGQKPVNSLGDLVPFTNKIYSADLKTRLGITAGICILI  135

Query  503  KH  508
            K+
Sbjct  136  KN  137



>gb|AAT96852.1| allene oxide cyclase C4 [Humulus lupulus]
Length=254

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 59/63 (94%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYLRLS+K VN+LGDLVPFSNKLYTG LQKR+GITAG+CILI
Sbjct  82   KVQELHVYEINERDRSSPAYLRLSKKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICILI  141

Query  503  KHE  511
            +++
Sbjct  142  QNK  144



>ref|XP_006430816.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
 gb|ESR44056.1| hypothetical protein CICLE_v10012528mg [Citrus clementina]
Length=256

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPFSNKLY+GDLQKRVGITAG+CIL
Sbjct  84   KVQELYVYEINELDRGSPAYLRLSKKCFINSLGDLVPFSNKLYSGDLQKRVGITAGICIL  143

Query  500  IKHE  511
            I+H+
Sbjct  144  IQHK  147



>gb|AAT96851.1| allene oxide cyclase C1 [Humulus lupulus]
Length=255

 Score =   111 bits (277),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/63 (83%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKLYTG LQKR+GITAG+CILI
Sbjct  82   KVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICILI  141

Query  503  KHE  511
            +++
Sbjct  142  QNK  144



>ref|XP_011078449.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Sesamum indicum]
Length=248

 Score =   110 bits (276),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            QS+   KVQEL VYE+NERDRGSPAYL+LSQK    LGDLVPFSNKLY+GDLQKR+GITA
Sbjct  79   QSSRPTKVQELYVYEMNERDRGSPAYLKLSQKEGKFLGDLVPFSNKLYSGDLQKRLGITA  138

Query  485  GLCILIKH  508
            GLC+LI++
Sbjct  139  GLCMLIQN  146



>gb|AET50928.1| allene oxide cylase [Lilium longiflorum]
Length=246

 Score =   110 bits (276),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 51/65 (78%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +2

Query  314  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  493
            PAGK+QEL VYEINE DR SPAYL+LS+K VN+LGDLVPFSNKLY G+LQ R+GIT+GLC
Sbjct  71   PAGKIQELRVYEINELDRSSPAYLKLSEKPVNSLGDLVPFSNKLYHGNLQMRLGITSGLC  130

Query  494  ILIKH  508
            ILI+H
Sbjct  131  ILIQH  135



>ref|XP_011021732.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Populus 
euphratica]
Length=258

 Score =   110 bits (276),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 59/62 (95%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDRGSPA+L+LSQK  N+LGDLVPFSNKLY+GDLQKR+GIT+GLC+LI
Sbjct  86   KVQELHVYEINERDRGSPAFLKLSQKPQNSLGDLVPFSNKLYSGDLQKRLGITSGLCVLI  145

Query  503  KH  508
            ++
Sbjct  146  QN  147



>ref|XP_006482293.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Citrus 
sinensis]
Length=255

 Score =   110 bits (275),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 53/64 (83%), Positives = 60/64 (94%), Gaps = 1/64 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKS-VNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYEINE DRGSPAYLRLS+K  +N+LGDLVPFSNKLY+GDLQKRVGITAG+CIL
Sbjct  83   KVQELYVYEINELDRGSPAYLRLSKKFFINSLGDLVPFSNKLYSGDLQKRVGITAGICIL  142

Query  500  IKHE  511
            I+H+
Sbjct  143  IQHK  146



>gb|AFH89625.1| allene oxide cyclase [Cymbidium ensifolium]
Length=256

 Score =   110 bits (274),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 50/63 (79%), Positives = 58/63 (92%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
             VQEL VYEINERDRGSP YLRLSQK VN+LGDLVPFSNK+Y+GDL+KR+GITAG+ ILI
Sbjct  84   NVQELHVYEINERDRGSPVYLRLSQKEVNSLGDLVPFSNKVYSGDLEKRLGITAGITILI  143

Query  503  KHE  511
            ++E
Sbjct  144  QNE  146



>ref|XP_006437732.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 ref|XP_006484415.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Citrus 
sinensis]
 gb|ESR50972.1| hypothetical protein CICLE_v10032510mg [Citrus clementina]
 gb|KDO70085.1| hypothetical protein CISIN_1g025155mg [Citrus sinensis]
Length=257

 Score =   109 bits (273),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 55/70 (79%), Positives = 61/70 (87%), Gaps = 2/70 (3%)
 Frame = +2

Query  308  SAPAG-KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGIT  481
            S PA  KVQEL VYEINERDR SPA L+LSQK  + T+GDLVPF+NKLYTGDLQKR+GIT
Sbjct  78   SRPANNKVQELFVYEINERDRNSPAILKLSQKPEHLTIGDLVPFTNKLYTGDLQKRIGIT  137

Query  482  AGLCILIKHE  511
            AGLC+LIKHE
Sbjct  138  AGLCVLIKHE  147



>ref|XP_010924770.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   109 bits (272),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK VN+LGDLVPFSNK+Y G+L+KR+GITAG+CILI
Sbjct  73   KVQELYVYEINERDRNSPAYLSLSQKEVNSLGDLVPFSNKVYHGNLEKRLGITAGICILI  132

Query  503  KH  508
            +H
Sbjct  133  QH  134



>gb|AIR76995.1| allene oxide cyclase, partial [Lilium longiflorum]
Length=133

 Score =   106 bits (264),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 49/61 (80%), Positives = 56/61 (92%), Gaps = 0/61 (0%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYEINE DR SPAYL+LS+K +N+LGDLVPFSNKLY G+LQKR+GITAGLCILI+
Sbjct  1    VQELSVYEINELDRSSPAYLKLSEKPINSLGDLVPFSNKLYHGNLQKRLGITAGLCILIQ  60

Query  506  H  508
            H
Sbjct  61   H  61



>ref|XP_009357038.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Pyrus 
x bretschneideri]
Length=184

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  503  KH  508
            ++
Sbjct  71   EN  72



>ref|XP_008348108.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  503  KH  508
            ++
Sbjct  71   EN  72



>ref|XP_008379524.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Malus 
domestica]
Length=184

 Score =   107 bits (268),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/62 (81%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPAYL LSQK V+ LGDLVPF+NK+YTGDLQKR+GITAG+CILI
Sbjct  11   KVQELNVYEINERDRSSPAYLSLSQKPVHALGDLVPFTNKIYTGDLQKRLGITAGICILI  70

Query  503  KH  508
            ++
Sbjct  71   EN  72



>gb|AAT66741.1| plastid allene oxide cyclase [Humulus lupulus]
Length=255

 Score =   108 bits (271),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 51/63 (81%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KV EL VYEINERDR SPAYLRLSQK VN+LGDLVPFSNKLYTG LQKR+GITAG+C LI
Sbjct  82   KVHELRVYEINERDRSSPAYLRLSQKEVNSLGDLVPFSNKLYTGCLQKRIGITAGICTLI  141

Query  503  KHE  511
            +++
Sbjct  142  QNK  144



>ref|XP_002278768.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Vitis vinifera]
 emb|CBI27060.3| unnamed protein product [Vitis vinifera]
Length=254

 Score =   108 bits (270),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/61 (75%), Positives = 57/61 (93%), Gaps = 0/61 (0%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYEINERDR SPA+L+LSQK  N+LGDLVPF+NK+YTGDL+KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLVPFTNKIYTGDLEKRLGVTAGICVLIQ  142

Query  506  H  508
            H
Sbjct  143  H  143



>gb|EYU29946.1| hypothetical protein MIMGU_mgv1a012460mg [Erythranthe guttata]
Length=250

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 47/62 (76%), Positives = 57/62 (92%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQE+CVYEINE+DRGSP YL+LS K  N+LGDL PF+NKLY+G+LQKR+GITAGLC+LI
Sbjct  78   KVQEMCVYEINEQDRGSPVYLKLSPKKENSLGDLGPFTNKLYSGNLQKRLGITAGLCVLI  137

Query  503  KH  508
            +H
Sbjct  138  QH  139



>ref|XP_010916944.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Elaeis 
guineensis]
Length=245

 Score =   108 bits (269),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 58/64 (91%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            + KVQE+ VYEINERDRGSP YLRLSQK VN+LGDLVP +NK+Y G+L+KR+GITAG+C+
Sbjct  71   SSKVQEMYVYEINERDRGSPVYLRLSQKEVNSLGDLVPLTNKVYHGNLEKRLGITAGICV  130

Query  497  LIKH  508
            L++H
Sbjct  131  LVQH  134



>gb|ACS96438.1| allene oxide cyclase [Jatropha curcas]
 gb|KDP29368.1| hypothetical protein JCGZ_18289 [Jatropha curcas]
Length=258

 Score =   108 bits (269),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 57/65 (88%), Gaps = 0/65 (0%)
 Frame = +2

Query  314  PAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLC  493
            PAGKVQ+L VYEINERDR SPA L+LS+K    LGDLVPF+NKLY+GDLQKR GITAGLC
Sbjct  83   PAGKVQQLNVYEINERDRDSPAILKLSKKPELALGDLVPFTNKLYSGDLQKRFGITAGLC  142

Query  494  ILIKH  508
            +LI+H
Sbjct  143  VLIQH  147



>dbj|BAI58602.1| mangrin [Rhizophora mucronata]
 dbj|BAI58603.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58604.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58605.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58606.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58607.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58608.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58609.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58610.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58611.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58612.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58613.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58614.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58615.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58616.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58617.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58618.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58619.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58620.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58621.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58622.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58623.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58624.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58625.1| mangrin [Rhizophora mucronata]
 dbj|BAI58626.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58627.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58628.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58629.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58630.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58631.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58632.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58633.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58634.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58635.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58636.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58637.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58638.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58639.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58640.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58641.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58642.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58643.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58644.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58645.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58646.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58647.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58648.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58649.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58650.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58651.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58652.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58653.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58654.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58655.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58656.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58657.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58658.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58659.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58660.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58661.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58662.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58663.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58664.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58665.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58666.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58667.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58668.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58669.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58670.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58671.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58672.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58673.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58674.1| mangrin, partial [Rhizophora mucronata]
 dbj|BAI58675.1| mangrin, partial [Rhizophora mucronata]
Length=142

 Score =   105 bits (261),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK+Y+GDLQKR+GITAG+C+ I
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNKVYSGDLQKRIGITAGICVQI  60

Query  503  KH  508
            +H
Sbjct  61   QH  62



>ref|XP_003637010.1| Allene-oxide cyclase [Medicago truncatula]
 gb|KEH25316.1| allene oxide cyclase [Medicago truncatula]
Length=249

 Score =   107 bits (268),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 50/69 (72%), Positives = 61/69 (88%), Gaps = 0/69 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            QS+ + KVQEL VYEINE+DRGSP YLRLSQK+VN L DL+ FSNKLY+G LQKRVGITA
Sbjct  70   QSSNSVKVQELSVYEINEKDRGSPVYLRLSQKNVNILDDLISFSNKLYSGCLQKRVGITA  129

Query  485  GLCILIKHE  511
            G+C+LI+++
Sbjct  130  GICVLIQNK  138



>ref|XP_008792377.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Phoenix 
dactylifera]
Length=245

 Score =   107 bits (266),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 49/62 (79%), Positives = 56/62 (90%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQE+ VYEINERDR SPAYLRLSQK  N+LGDLVPFSNK+Y G L+KR+GITAG+CILI
Sbjct  73   KVQEMYVYEINERDRSSPAYLRLSQKEHNSLGDLVPFSNKVYHGTLEKRLGITAGICILI  132

Query  503  KH  508
            +H
Sbjct  133  QH  134



>dbj|BAI58542.1| mangrin [Rhizophora apiculata]
 dbj|BAI58543.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58544.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58545.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58546.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58547.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58548.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58549.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58550.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58551.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58552.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58553.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58554.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58555.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58556.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58557.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58558.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58559.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58560.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58561.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58562.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58563.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58564.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58565.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58566.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58567.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58568.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58569.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58570.1| mangrin [Rhizophora apiculata]
 dbj|BAI58571.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58572.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58573.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58574.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58575.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58576.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58577.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58578.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58579.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58580.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58581.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58582.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58583.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58584.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58585.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58586.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58587.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58588.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58589.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58590.1| mangrin [Rhizophora apiculata]
 dbj|BAI58591.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58592.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58593.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58594.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58595.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58596.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58597.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58598.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58599.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58600.1| mangrin, partial [Rhizophora apiculata]
 dbj|BAI58601.1| mangrin, partial [Rhizophora apiculata]
Length=178

 Score =   105 bits (261),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 49/63 (78%), Positives = 57/63 (90%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK+Y+GDLQKR+GITAG+C+ I
Sbjct  36   KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNKVYSGDLQKRIGITAGICVQI  95

Query  503  KHE  511
            +H+
Sbjct  96   QHK  98



>ref|XP_004304145.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Fragaria 
vesca subsp. vesca]
Length=184

 Score =   104 bits (260),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQE  VYEINERDR SPAYL LSQK  ++LGDLVPF+NK+YTGDL+KR+GITAGLCILI
Sbjct  11   KVQEFHVYEINERDRSSPAYLSLSQKPAHSLGDLVPFTNKIYTGDLEKRLGITAGLCILI  70

Query  503  K  505
            +
Sbjct  71   E  71



>gb|AHZ21033.1| mangrin [Kandelia candel]
Length=256

 Score =   105 bits (263),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 58/68 (85%), Gaps = 1/68 (1%)
 Frame = +2

Query  308  SAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            S P G VQE+CVYEINE DR SPA LRLSQK V +LGDLVPFSNKLYTGDLQKR+GITAG
Sbjct  80   SRPTG-VQEMCVYEINEGDRESPAVLRLSQKPVLSLGDLVPFSNKLYTGDLQKRIGITAG  138

Query  488  LCILIKHE  511
            + I I+H+
Sbjct  139  IAIQIQHK  146



>ref|XP_006857130.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
 gb|ERN18597.1| hypothetical protein AMTR_s00065p00146710 [Amborella trichopoda]
Length=256

 Score =   105 bits (262),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/61 (79%), Positives = 55/61 (90%), Gaps = 0/61 (0%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQE+ VYEINE DRGSPAYL LSQK +N+LGDLVPFSNKLY G+L+KR GITAG+C+LIK
Sbjct  85   VQEMHVYEINELDRGSPAYLPLSQKPINSLGDLVPFSNKLYHGNLKKRAGITAGICVLIK  144

Query  506  H  508
            H
Sbjct  145  H  145



>ref|XP_002465087.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
 gb|EER92085.1| hypothetical protein SORBIDRAFT_01g031870 [Sorghum bicolor]
Length=274

 Score =   101 bits (252),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 55/63 (87%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYEINERDR SPAYLRLS K S N LGDLVPF+NK+Y+G L KR+GITAG+C+L
Sbjct  101  KVQELYVYEINERDRESPAYLRLSAKQSENALGDLVPFTNKVYSGSLDKRLGITAGICVL  160

Query  500  IKH  508
            I+H
Sbjct  161  IQH  163



>gb|EMS52587.1| Allene oxide cyclase 3, chloroplastic [Triticum urartu]
Length=204

 Score =   100 bits (248),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|XP_008359967.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  314  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
            P  +V Q L VYEINERDRGSP YLRLS K V++LGDLVP +NKLYTGDLQKR+GITAG+
Sbjct  81   PGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTNKLYTGDLQKRIGITAGI  140

Query  491  CILIKH  508
             ILI+H
Sbjct  141  TILIQH  146



>ref|XP_008388976.1| PREDICTED: allene oxide cyclase 1, chloroplastic-like [Malus 
domestica]
Length=260

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +2

Query  314  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
            P  +V Q L VYEINERDRGSP YLRLS K V++LGDLVP +NKLYTGDLQKR+GITAG+
Sbjct  81   PGSEVPQVLHVYEINERDRGSPVYLRLSGKEVHSLGDLVPLTNKLYTGDLQKRIGITAGI  140

Query  491  CILIKH  508
             ILI+H
Sbjct  141  TILIQH  146



>gb|AFP87550.1| allene oxide cyclase 4 [Oryza sativa Indica Group]
Length=240

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L KR+GI+AG+CIL
Sbjct  67   KVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICIL  126

Query  500  IKH  508
            I+H
Sbjct  127  IQH  129



>ref|NP_001050447.1| Os03g0438100 [Oryza sativa Japonica Group]
 emb|CAD38519.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|AAR89017.1| allene oxide cyclase [Oryza sativa Japonica Group]
 gb|ABF96821.1| Allene oxide cyclase 3, chloroplast precursor, putative, expressed 
[Oryza sativa Japonica Group]
 dbj|BAF12361.1| Os03g0438100 [Oryza sativa Japonica Group]
 gb|EAY90593.1| hypothetical protein OsI_12194 [Oryza sativa Indica Group]
 gb|ABV03555.1| AOC [Oryza sativa Japonica Group]
 gb|ABV45432.1| AOC [Oryza sativa Japonica Group]
 dbj|BAG87277.1| unnamed protein product [Oryza sativa Japonica Group]
Length=240

 Score =   100 bits (249),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L KR+GI+AG+CIL
Sbjct  67   KVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICIL  126

Query  500  IKH  508
            I+H
Sbjct  127  IQH  129



>gb|EMT08815.1| Allene oxide cyclase 3, chloroplastic [Aegilops tauschii]
Length=239

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|XP_003562362.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brachypodium 
distachyon]
Length=243

 Score =   100 bits (248),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  70   KVQELYVYELNERDRESPAYLRLSAKQSENALGDLVPFTNKVYNGSLDKRIGITAGICIL  129

Query  500  IKH  508
            I+H
Sbjct  130  IQH  132



>ref|XP_004983950.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Setaria 
italica]
Length=245

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y+G L KR+GITAG+CIL
Sbjct  72   KVQELYVYELNERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGITAGICIL  131

Query  500  IKH  508
            I+H
Sbjct  132  IQH  134



>gb|EAZ27451.1| hypothetical protein OsJ_11399 [Oryza sativa Japonica Group]
Length=241

 Score =   100 bits (248),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NKLY+G L KR+GI+AG+CIL
Sbjct  68   KVQEMFVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKLYSGSLDKRLGISAGICIL  127

Query  500  IKH  508
            I+H
Sbjct  128  IQH  130



>gb|AHA93095.1| allene oxide cyclase 1 [Triticum aestivum]
Length=239

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>gb|AFP87304.1| chloroplast allene oxide cyclase [Leymus mollis]
Length=238

 Score = 99.8 bits (247),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 48/63 (76%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|XP_010692616.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Beta vulgaris subsp. vulgaris]
Length=249

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF+NKLYT DL+ R+GI+AG+CILI
Sbjct  76   KIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTADLKTRLGISAGICILI  135

Query  503  KHE  511
            +++
Sbjct  136  QNK  138



>ref|XP_010692623.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Beta vulgaris subsp. vulgaris]
Length=248

 Score = 99.8 bits (247),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 55/63 (87%), Gaps = 0/63 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K+ E CVYEINERDR SPA L+LSQK V +LGDL+PF+NKLYT DL+ R+GI+AG+CILI
Sbjct  75   KIHEFCVYEINERDRASPAVLKLSQKPVFSLGDLIPFTNKLYTADLKTRLGISAGICILI  134

Query  503  KHE  511
            +++
Sbjct  135  QNK  137



>ref|XP_006650236.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Oryza 
brachyantha]
Length=242

 Score = 99.4 bits (246),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQE+ VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y+G L KR+GITAG+C+L
Sbjct  69   KVQEMYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYSGSLDKRLGITAGICVL  128

Query  500  IKH  508
            ++H
Sbjct  129  VQH  131



>ref|NP_001105245.1| allene oxide cyclase1 [Zea mays]
 gb|AAR33049.1| allene oxide cyclase [Zea mays]
 gb|ACF80011.1| unknown [Zea mays]
 tpg|DAA45890.1| TPA: allene oxide cyclase 4 [Zea mays]
Length=238

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+G+TAG+C+L
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGVTAGICVL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|NP_001141267.1| allene oxide cyclase 4 [Zea mays]
 gb|ACF85913.1| unknown [Zea mays]
 gb|AFW88169.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score = 99.4 bits (246),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>gb|ACG39242.1| allene oxide cyclase 4 [Zea mays]
Length=238

 Score = 99.0 bits (245),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+GITAG+C+L
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGITAGICVL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>dbj|BAJ96870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=238

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>emb|CDY59866.1| BnaC09g52550D [Brassica napus]
Length=253

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  135  GLCVLIQH  142



>gb|ACY74378.1| allene oxidase cyclase [Brassica napus]
Length=253

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  135  GLCVLIQH  142



>gb|ACG32920.1| allene oxide cyclase 4 [Zea mays]
Length=240

 Score = 99.0 bits (245),  Expect = 7e-22, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+Y G L KR+G+TAG+C+L
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKVYNGSLDKRLGVTAGICVL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|XP_009114114.1| PREDICTED: allene oxide cyclase 3, chloroplastic [Brassica rapa]
 gb|ACY74379.1| allene oxidase cyclase [Brassica napus]
 emb|CDY04179.1| BnaA09g19570D [Brassica napus]
Length=253

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  75   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  134

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  135  GLCVLIQH  142



>gb|ACY74377.1| allene oxidase cyclase [Brassica napus]
Length=247

 Score = 99.0 bits (245),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 56/68 (82%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            ++A   KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   ENARPSKVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITA  128

Query  485  GLCILIKH  508
            GLC+LI+H
Sbjct  129  GLCVLIQH  136



>emb|CAC83766.1| allene oxide cyclase [Hordeum vulgare subsp. vulgare]
Length=238

 Score = 98.6 bits (244),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLS-QKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NERDR SPAYLRLS  +S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNERDRESPAYLRLSANQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>gb|KFK35078.1| hypothetical protein AALP_AA5G232400 [Arabis alpina]
Length=254

 Score = 98.6 bits (244),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/62 (74%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITAGLC+LI
Sbjct  82   KVQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLCVLI  141

Query  503  KH  508
            +H
Sbjct  142  QH  143



>ref|XP_006395626.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
 gb|ESQ32912.1| hypothetical protein EUTSA_v10004810mg [Eutrema salsugineum]
Length=252

 Score = 97.8 bits (242),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 53/62 (85%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K+QEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITAGLC+LI
Sbjct  80   KIQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLCVLI  139

Query  503  KH  508
            +H
Sbjct  140  QH  141



>gb|ABO61151.1| allene oxide cyclase, partial [Nicotiana attenuata]
Length=86

 Score = 93.6 bits (231),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 42/46 (91%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  374  PAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  511
            PAYLRLSQK+VN+LGDLVPFSNKLYTGDL+KR+GITAGLCILIKHE
Sbjct  1    PAYLRLSQKTVNSLGDLVPFSNKLYTGDLKKRIGITAGLCILIKHE  46



>ref|XP_009152186.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Brassica 
rapa]
Length=205

 Score = 96.7 bits (239),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 54/64 (84%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            +GK QEL VYE+NERDR SPA L+L +K    LGDLVPF+NKLYTGDL+KRVGITAGL +
Sbjct  31   SGKTQELNVYELNERDRNSPAVLKLGKKPELCLGDLVPFTNKLYTGDLKKRVGITAGLYV  90

Query  497  LIKH  508
            LI+H
Sbjct  91   LIQH  94



>gb|AGU41846.1| allene oxide cyclase [Triticum aestivum]
Length=238

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 47/63 (75%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE+NE DR SPAYLRLS K S N LGDLVPF+NK+Y G L KR+GITAG+CIL
Sbjct  65   KVQELHVYELNEHDRESPAYLRLSAKQSQNALGDLVPFTNKVYNGSLDKRIGITAGICIL  124

Query  500  IKH  508
            I+H
Sbjct  125  IQH  127



>ref|XP_010556382.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=250

 Score = 96.7 bits (239),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 45/62 (73%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL +YE+NE DR SPA L+L  K    LGDLVPF+NKLYTGDL KRVGITAGLC+LI
Sbjct  78   KVQELHIYELNEGDRNSPAVLKLGNKQELCLGDLVPFTNKLYTGDLTKRVGITAGLCVLI  137

Query  503  KH  508
            +H
Sbjct  138  QH  139



>ref|NP_001267900.1| allene oxide cyclase [Vitis vinifera]
 gb|ABD64688.1| allene oxide cyclase [Vitis vinifera]
Length=254

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 41/50 (82%), Positives = 50/50 (100%), Gaps = 0/50 (0%)
 Frame = +2

Query  359  RDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKH  508
            RDRGSPAYLRLSQKSVN+LGDLVPFSNK+YTGDL+KR+G+TAG+C+LI++
Sbjct  94   RDRGSPAYLRLSQKSVNSLGDLVPFSNKIYTGDLEKRLGVTAGICVLIQN  143



>ref|XP_010502459.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X2 [Camelina 
sativa]
Length=257

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  500  IKH  508
            I+H
Sbjct  143  IQH  145



>ref|XP_002875279.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51538.1| hypothetical protein ARALYDRAFT_484340 [Arabidopsis lyrata subsp. 
lyrata]
Length=258

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  500  IKH  508
            I+H
Sbjct  144  IQH  146



>ref|XP_006292768.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
 gb|EOA25666.1| hypothetical protein CARUB_v10019017mg [Capsella rubella]
Length=257

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  500  IKH  508
            I+H
Sbjct  143  IQH  145



>ref|NP_566777.1| allene oxide cyclase 3 [Arabidopsis thaliana]
 sp|Q9LS01.1|AOC3_ARATH RecName: Full=Allene oxide cyclase 3, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95765.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAM64909.1| allene oxide cyclase, putative [Arabidopsis thaliana]
 emb|CAC83763.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAF01112.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE77067.1| allene oxide cyclase 3 [Arabidopsis thaliana]
Length=258

 Score = 95.9 bits (237),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  500  IKH  508
            I+H
Sbjct  144  IQH  146



>ref|XP_010528046.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Tarenaya 
hassleriana]
Length=249

 Score = 95.5 bits (236),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SPA L+L +K    LGDL+PF+NKLY+GDL KRVGITAGLC+LI
Sbjct  77   KVQELHVYELNEGDRNSPAVLKLGKKQELCLGDLIPFTNKLYSGDLTKRVGITAGLCVLI  136

Query  503  KH  508
            +H
Sbjct  137  QH  138



>ref|XP_010514199.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like [Camelina 
sativa]
Length=257

 Score = 95.5 bits (236),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  142

Query  500  IKH  508
            I+H
Sbjct  143  IQH  145



>ref|XP_002524412.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
 gb|EEF38023.1| Allene oxide cyclase 3, chloroplast precursor, putative [Ricinus 
communis]
Length=259

 Score = 95.1 bits (235),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 54/63 (86%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYEINERDR SPA L+LS+K     LGDLVPF+NKLY+GDL+KR+GITAGL +L
Sbjct  86   KIQELNVYEINERDRESPAILKLSKKPDQLALGDLVPFTNKLYSGDLKKRLGITAGLSVL  145

Query  500  IKH  508
            IKH
Sbjct  146  IKH  148



>ref|XP_010554241.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X1 [Tarenaya hassleriana]
Length=254

 Score = 94.4 bits (233),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 44/62 (71%), Positives = 52/62 (84%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLY+GDL KR+GITAGLC+LI
Sbjct  82   KVQELHVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKRLGITAGLCVLI  141

Query  503  KH  508
            +H
Sbjct  142  QH  143



>ref|XP_010425230.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like, partial 
[Camelina sativa]
Length=250

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 53/63 (84%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL V+E+NE DR SPA L+L +K     LGDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  84   KIQELNVHELNEGDRNSPAVLKLGKKPTELCLGDLVPFTNKLYTGDLKKRVGITAGLCVL  143

Query  500  IKH  508
            I+H
Sbjct  144  IQH  146



>ref|XP_010476324.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=254

 Score = 92.8 bits (229),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            KVQEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  80   KVQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  139

Query  500  IKH  508
            I+H
Sbjct  140  IQH  142



>ref|XP_001783824.1| predicted protein [Physcomitrella patens]
 emb|CAD48752.1| allene oxide cyclase [Physcomitrella patens]
 gb|AAN39877.1| allene oxide cyclase [Physcomitrella patens]
 gb|EDQ51364.1| predicted protein [Physcomitrella patens]
Length=189

 Score = 91.7 bits (226),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 7/75 (9%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKS-------VNTLGDLVPFSNKLYTGDLQ  463
            + A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPFSNK+Y G L+
Sbjct  4    RGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYDGSLK  63

Query  464  KRVGITAGLCILIKH  508
             R+GITAGLC LI H
Sbjct  64   TRLGITAGLCTLISH  78



>pdb|4H6B|A Chain A, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|D Chain D, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|C Chain C, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|B Chain B, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|E Chain E, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|F Chain F, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|G Chain G, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|H Chain H, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|I Chain I, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|J Chain J, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|K Chain K, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6B|L Chain L, Structural Basis For Allene Oxide Cyclization In Moss
 pdb|4H6C|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|G Chain G, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|H Chain H, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|I Chain I, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|J Chain J, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|K Chain K, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
 pdb|4H6C|L Chain L, Crystal Structure Of The Allene Oxide Cyclase 1 From 
Physcomitrella Patens
Length=195

 Score = 91.7 bits (226),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/75 (61%), Positives = 52/75 (69%), Gaps = 7/75 (9%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKS-------VNTLGDLVPFSNKLYTGDLQ  463
            + A  G VQEL VYEINERDRGSP +L    K        VN+LGDLVPFSNK+Y G L+
Sbjct  10   RGASPGHVQELFVYEINERDRGSPVFLPFGGKKQPGTDAHVNSLGDLVPFSNKIYDGSLK  69

Query  464  KRVGITAGLCILIKH  508
             R+GITAGLC LI H
Sbjct  70   TRLGITAGLCTLISH  84



>ref|NP_172786.1| allene oxide cyclase 4 [Arabidopsis thaliana]
 sp|Q93ZC5.1|AOC4_ARATH RecName: Full=Allene oxide cyclase 4, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAL15267.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 gb|AAM98257.1| At1g13280/T6J4_23 [Arabidopsis thaliana]
 emb|CAC83764.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE28994.1| allene oxide cyclase 4 [Arabidopsis thaliana]
Length=254

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  80   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  139

Query  500  IKH  508
            I+H
Sbjct  140  IQH  142



>gb|AAG09557.1|AC011810_16 Unknown Protein [Arabidopsis thaliana]
Length=180

 Score = 90.9 bits (224),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            ++QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  6    QIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  65

Query  500  IKH  508
            I+H
Sbjct  66   IQH  68



>ref|XP_002889998.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66257.1| hypothetical protein ARALYDRAFT_334627 [Arabidopsis lyrata subsp. 
lyrata]
Length=252

 Score = 92.0 bits (227),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  78   KIQELNVYEFNEGDRNSPAVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  137

Query  500  IKH  508
            I+H
Sbjct  138  IQH  140



>ref|XP_010514196.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X2 [Camelina sativa]
Length=248

 Score = 91.7 bits (226),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 44/68 (65%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q A   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   QDARPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  129  GLCVVIEH  136



>pdb|4CQ6|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ6|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Inhibitor - Vernolic Acid
 pdb|4CQ7|A Chain A, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|B Chain B, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
 pdb|4CQ7|C Chain C, The Crystal Structure Of The Allene Oxide Cyclase 2 
From Arabidopsis Thaliana With Bound Product - Opda
Length=188

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  503  KH  508
            +H
Sbjct  75   EH  76



>pdb|2GIN|A Chain A, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|B Chain B, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|C Chain C, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|D Chain D, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|E Chain E, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
 pdb|2GIN|F Chain F, X-Ray Structure Of The Wt Allene Oxide Cyclase 2 From 
Arabidopsis Thaliana
Length=188

 Score = 90.5 bits (223),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  503  KH  508
            +H
Sbjct  75   EH  76



>ref|XP_010425228.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=246

 Score = 90.9 bits (224),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   KVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  503  KH  508
            +H
Sbjct  139  EH  140



>ref|XP_010495179.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Camelina sativa]
Length=252

 Score = 91.3 bits (225),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA ++L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  78   KIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  137

Query  500  IKH  508
            I+H
Sbjct  138  IQH  140



>gb|KFK35075.1| hypothetical protein AALP_AA5G232000 [Arabis alpina]
Length=732

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 0/64 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            +GKVQEL VYE+NE DR SP  L+     + +LGDLVPF+NKLYTGDL+KRVGITAGLC+
Sbjct  73   SGKVQELSVYELNEGDRESPKILKHGLSLMFSLGDLVPFTNKLYTGDLKKRVGITAGLCV  132

Query  497  LIKH  508
            +I+H
Sbjct  133  VIEH  136



>ref|NP_566776.1| allene oxide cyclase 2 [Arabidopsis thaliana]
 sp|Q9LS02.1|AOC2_ARATH RecName: Full=Allene oxide cyclase 2, chloroplastic; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAK55711.1|AF380630_1 AT3g25770/K13N2_9 [Arabidopsis thaliana]
 dbj|BAA95764.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAL06792.1| AT3g25770/K13N2_9 [Arabidopsis thaliana]
 emb|CAC83762.1| allene oxide cyclase [Arabidopsis thaliana]
 gb|AEE77066.1| allene oxide cyclase 2 [Arabidopsis thaliana]
Length=253

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  80   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  139

Query  503  KH  508
            +H
Sbjct  140  EH  141



>ref|XP_006291721.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
 gb|EOA24619.1| hypothetical protein CARUB_v10017888mg [Capsella rubella]
Length=254

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYELNELDRHSPKILKNAMSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  503  KH  508
            +H
Sbjct  141  EH  142



>ref|XP_010458779.1| PREDICTED: allene oxide cyclase 4, chloroplastic-like [Camelina 
sativa]
Length=255

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA ++L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  81   KIQELNVYEFNEGDRNSPALIKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  140

Query  500  IKH  508
            I+H
Sbjct  141  IQH  143



>ref|XP_008370524.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Malus 
domestica]
Length=258

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 45/66 (68%), Positives = 53/66 (80%), Gaps = 1/66 (2%)
 Frame = +2

Query  314  PAGKV-QELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGL  490
            PA +V Q L VYE+NE DRGSPAYL LS K V++LGD+V F NKLYTGDLQKR GIT G+
Sbjct  80   PASEVPQVLHVYELNELDRGSPAYLXLSGKEVHSLGDVVXFXNKLYTGDLQKRXGITTGI  139

Query  491  CILIKH  508
             +LI+H
Sbjct  140  TLLIQH  145



>gb|KFK43593.1| hypothetical protein AALP_AA1G146300 [Arabis alpina]
Length=253

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +      LGD VPF+NKLYTGDL KRVGITAGLC+L
Sbjct  79   KIQELNVYEFNEGDRNSPAVLKLGKNPTQLCLGDFVPFTNKLYTGDLTKRVGITAGLCVL  138

Query  500  IKH  508
            I+H
Sbjct  139  IQH  141



>ref|XP_002875278.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51537.1| hypothetical protein ARALYDRAFT_484339 [Arabidopsis lyrata subsp. 
lyrata]
Length=254

 Score = 90.9 bits (224),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  503  KH  508
            +H
Sbjct  141  EH  142



>pdb|2DIO|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
 pdb|2DIO|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 With 
Bound Inhibitor Vernolic Acid
Length=188

 Score = 89.7 bits (221),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  503  KH  508
            +H
Sbjct  75   EH  76



>ref|XP_010514195.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like isoform 
X1 [Camelina sativa]
Length=248

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q A   +VQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   QDARPSRVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  129  GLCVVIEH  136



>gb|ACN27052.1| unknown [Zea mays]
 gb|AFW88170.1| hypothetical protein ZEAMMB73_091885 [Zea mays]
Length=249

 Score = 90.5 bits (223),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/74 (62%), Positives = 53/74 (72%), Gaps = 12/74 (16%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNK-----------LYTGDLQK  466
            KVQEL VYE+NERDR SPAYLRLS K   N LGDLVPF+NK           +Y G L K
Sbjct  65   KVQELYVYEMNERDRESPAYLRLSAKQTENALGDLVPFTNKPLFLPTHPCTQVYNGSLDK  124

Query  467  RVGITAGLCILIKH  508
            R+GITAG+C+LI+H
Sbjct  125  RLGITAGICVLIQH  138



>pdb|1Z8K|A Chain A, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|B Chain B, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|1Z8K|C Chain C, X-ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25770
 pdb|2Q4I|A Chain A, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|B Chain B, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
 pdb|2Q4I|C Chain C, Ensemble Refinement Of The Protein Crystal Structure 
Of Allene Oxide Cyclase From Arabidopsis Thaliana At3g25770
Length=193

 Score = 89.7 bits (221),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  20   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  79

Query  503  KH  508
            +H
Sbjct  80   EH  81



>pdb|2BRJ|A Chain A, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|B Chain B, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
 pdb|2BRJ|C Chain C, X-Ray Structure Of The Allene Oxide Cyclase From Arabidopsis 
Thaliana
Length=188

 Score = 89.4 bits (220),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 43/62 (69%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  15   KVQELSVYEINELDRHSPKILKNAFSLXFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  74

Query  503  KH  508
            +H
Sbjct  75   EH  76



>ref|XP_010502447.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=248

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  129  GLCVVIEH  136



>ref|XP_010502446.1| PREDICTED: allene oxide cyclase 2, chloroplastic [Camelina sativa]
Length=248

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  75   KVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  134

Query  503  KH  508
            +H
Sbjct  135  EH  136



>ref|XP_006304140.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
 gb|EOA37038.1| hypothetical protein CARUB_v10010123mg [Capsella rubella]
Length=245

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SP  L+L +K     LGDLVPF+NKLYTGDL KR+GITAGLC+L
Sbjct  71   KIQELNVYEFNEGDRNSPTVLKLGKKPDQLCLGDLVPFTNKLYTGDLTKRIGITAGLCVL  130

Query  500  IKH  508
            I+H
Sbjct  131  IQH  133



>ref|XP_010425227.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=249

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q +   KVQEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  70   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  129

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  130  GLCVVIEH  137



>ref|XP_002875277.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH51536.1| ERD12 protein [Arabidopsis lyrata subsp. lyrata]
Length=253

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 51/62 (82%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEIN+ DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  503  KH  508
            +H
Sbjct  141  EH  142



>ref|XP_006291745.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
 gb|EOA24643.1| hypothetical protein CARUB_v10017913mg [Capsella rubella]
Length=248

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 53/68 (78%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q +   K+QEL VYE+NE DR SP  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  69   QDSRPSKIQELSVYELNELDRHSPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  128

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  129  GLCVVIEH  136



>emb|CDY50180.1| BnaC08g15790D [Brassica napus]
Length=250

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  76   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  135

Query  500  IKH  508
            I+H
Sbjct  136  IQH  138



>ref|XP_010430726.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=296

 Score = 90.1 bits (222),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/68 (63%), Positives = 52/68 (76%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q +   KVQEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  68   QDSRPSKVQELSVYELNELDRHSPKILKNAFSLTFGLGDLVPFTNKLYTGDLKKRVGITA  127

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  128  GLCVVIEH  135



>ref|XP_009110591.1| PREDICTED: allene oxide cyclase 4, chloroplastic [Brassica rapa]
 emb|CDY21090.1| BnaA08g24350D [Brassica napus]
Length=249

 Score = 89.4 bits (220),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  75   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  134

Query  500  IKH  508
            I+H
Sbjct  135  IQH  137



>ref|XP_001751254.1| predicted protein [Physcomitrella patens]
 gb|EDQ83571.1| predicted protein [Physcomitrella patens]
Length=188

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 6/67 (9%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  488  LCILIKH  508
            +C LI H
Sbjct  71   ICTLISH  77



>gb|ABV89668.1| ERD12 protein [Brassica rapa]
Length=264

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVN-TLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            K+QEL VYE NE DR SPA L+L +      +GDLVPF+NKLYTGDL+KRVGITAGLC+L
Sbjct  75   KIQELNVYEFNEGDRHSPAVLKLGKNPQQLCIGDLVPFTNKLYTGDLKKRVGITAGLCVL  134

Query  500  IKH  508
            I+H
Sbjct  135  IQH  137



>pdb|4H69|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H69|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens Complexed With Substrate Analog
 pdb|4H6A|A Chain A, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|B Chain B, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|C Chain C, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|D Chain D, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|E Chain E, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
 pdb|4H6A|F Chain F, Crystal Structure Of The Allene Oxide Cyclase 2 From 
Physcomitrella Patens
Length=194

 Score = 88.2 bits (217),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 6/67 (9%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  17   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  76

Query  488  LCILIKH  508
            +C LI H
Sbjct  77   ICTLISH  83



>ref|XP_002969526.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
 ref|XP_002986761.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ12091.1| hypothetical protein SELMODRAFT_124720, partial [Selaginella 
moellendorffii]
 gb|EFJ29614.1| hypothetical protein SELMODRAFT_91887, partial [Selaginella moellendorffii]
Length=176

 Score = 87.4 bits (215),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 1/63 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQ-KSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            +VQ L VYEINE DRGSP  L+  + K  N LGDLVPFSNKLY G L+ R+GITAGLC+L
Sbjct  6    EVQTLSVYEINELDRGSPVLLKGDKAKPTNALGDLVPFSNKLYDGCLETRLGITAGLCVL  65

Query  500  IKH  508
            IKH
Sbjct  66   IKH  68



>pdb|1ZVC|A Chain A, X-Ray Structure Of Allene Oxide Cyclase From Arabidopsis 
Thaliana At3g25760
Length=189

 Score = 87.8 bits (216),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  16   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  75

Query  503  KH  508
            +H
Sbjct  76   EH  77



>emb|CAD48753.1| allene oxide cyclase [Physcomitrella patens]
Length=188

 Score = 87.4 bits (215),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 48/67 (72%), Gaps = 6/67 (9%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKS------VNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            VQEL VYEINERDRGSP  L    K        N+LGDLVPFSNK+Y G LQ+R+GITAG
Sbjct  11   VQELSVYEINERDRGSPVILPFGGKKDENGAHANSLGDLVPFSNKVYDGSLQRRLGITAG  70

Query  488  LCILIKH  508
            +C LI H
Sbjct  71   ICTLISH  77



>ref|NP_189204.1| allene oxide cyclase 1 [Arabidopsis thaliana]
 sp|Q9LS03.1|AOC1_ARATH RecName: Full=Allene oxide cyclase 1, chloroplastic; AltName: 
Full=Early-responsive to dehydration 12 protein; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA95763.1| unnamed protein product [Arabidopsis thaliana]
 emb|CAC83761.1| allene oxide cyclase [Arabidopsis thaliana]
 dbj|BAD43155.1| ERD12 protein [Arabidopsis thaliana]
 dbj|BAD44540.1| ERD12 protein [Arabidopsis thaliana]
 gb|ABD19660.1| At3g25760 [Arabidopsis thaliana]
 gb|AEE77065.1| allene oxide cyclase 1 [Arabidopsis thaliana]
Length=254

 Score = 88.6 bits (218),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  81   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  140

Query  503  KH  508
            +H
Sbjct  141  EH  142



>dbj|BAB63918.1| ERD12 protein [Arabidopsis thaliana]
Length=252

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEIN+ DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   KVQELSVYEINDLDRHSPKILKNAFSFRFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  503  KH  508
            +H
Sbjct  139  EH  140



>ref|XP_010514198.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=252

 Score = 87.8 bits (216),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 50/62 (81%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL +YE+NE DR SP  L+ +   +  LGDLVPF+NKLY GDL+KRVGITAGLC++I
Sbjct  79   KVQELSMYELNELDRHSPKILKNAMSLIFGLGDLVPFTNKLYIGDLKKRVGITAGLCVVI  138

Query  503  KH  508
            +H
Sbjct  139  EH  140



>emb|CDX83551.1| BnaC07g22910D [Brassica napus]
Length=247

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  74   RIQELSVYELNELDRHSPKILKNAISLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  133

Query  503  KH  508
             H
Sbjct  134  AH  135



>emb|CDY13583.1| BnaA06g33400D [Brassica napus]
Length=181

 Score = 86.3 bits (212),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            K QEL VYE+NE DR SPA L+L +K    LGDLVPF+NKLY  DL+KRVGITAGL +LI
Sbjct  9    KTQELNVYELNEGDRNSPAVLKLGKKPELCLGDLVPFTNKLYPDDLKKRVGITAGLYVLI  68

Query  503  KH  508
            +H
Sbjct  69   QH  70



>ref|XP_006395628.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
 gb|ESQ32914.1| hypothetical protein EUTSA_v10004824mg [Eutrema salsugineum]
Length=249

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/62 (66%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+K VGITAGLC++I
Sbjct  76   KVQELNVYELNELDRDSPKILKNAMSLTFGLGDLVPFTNKLYTGDLKKCVGITAGLCVVI  135

Query  503  KH  508
            +H
Sbjct  136  EH  137



>emb|CDY13582.1| BnaA06g33410D [Brassica napus]
Length=252

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  503  KH  508
             H
Sbjct  139  AH  140



>emb|CDX83550.1| BnaC07g22900D [Brassica napus]
Length=252

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 49/62 (79%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNAACLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  503  KH  508
             H
Sbjct  139  AH  140



>emb|CDY72244.1| BnaCnng76690D [Brassica napus]
Length=252

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 40/62 (65%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            ++QEL VYE+NE DR SP  L+        LGDLVPF+NKLYTGDL+KRVGITAGLC++I
Sbjct  79   RIQELSVYELNELDRHSPKILKNVISLTFGLGDLVPFTNKLYTGDLKKRVGITAGLCVVI  138

Query  503  KH  508
             H
Sbjct  139  AH  140



>ref|XP_009114115.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
 emb|CDY04177.1| BnaA09g19550D [Brassica napus]
Length=253

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+        LGDLVPF+NKLYT DL+KRVGITAGLC++I
Sbjct  80   KVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVVI  139

Query  503  KH  508
            +H
Sbjct  140  QH  141



>emb|CDY59869.1| BnaC09g52570D [Brassica napus]
Length=253

 Score = 86.3 bits (212),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/62 (68%), Positives = 48/62 (77%), Gaps = 0/62 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILI  502
            KVQEL VYEINE DR SP  L+        LGDLVPF+NKLYT DL+KRVGITAGLC++I
Sbjct  80   KVQELNVYEINELDRHSPKILKNVMSLKFRLGDLVPFTNKLYTADLKKRVGITAGLCVVI  139

Query  503  KH  508
            +H
Sbjct  140  QH  141



>ref|XP_010502458.1| PREDICTED: allene oxide cyclase 3, chloroplastic isoform X1 [Camelina 
sativa]
Length=263

 Score = 84.0 bits (206),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/69 (59%), Positives = 49/69 (71%), Gaps = 7/69 (10%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDL-------VPFSNKLYTGDLQKRVGIT  481
            K+QEL VYE+NE DR SPA L+L +K               VPF+NKLYTGDL+KRVGIT
Sbjct  83   KIQELNVYELNEGDRNSPAVLKLGKKPTELCLGDLLCLGDLVPFTNKLYTGDLKKRVGIT  142

Query  482  AGLCILIKH  508
            AGLC+LI+H
Sbjct  143  AGLCVLIQH  151



>ref|XP_010425226.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Camelina 
sativa]
Length=243

 Score = 82.8 bits (203),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 39/68 (57%), Positives = 51/68 (75%), Gaps = 0/68 (0%)
 Frame = +2

Query  305  QSAPAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITA  484
            Q +   K+ +L VYE+NE DR  P  L+ +   +  LGDLVPF+NKLYTGDL+KRVGITA
Sbjct  64   QDSRPSKLSKLSVYELNELDRHRPKILKNAFSLMFGLGDLVPFTNKLYTGDLKKRVGITA  123

Query  485  GLCILIKH  508
            GLC++I+H
Sbjct  124  GLCVVIEH  131



>ref|XP_009394152.1| PREDICTED: uncharacterized protein LOC103979699 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=307

 Score = 82.4 bits (202),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/42 (90%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  317  AGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  442
            + KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNK
Sbjct  87   SAKVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  128



>ref|XP_009152113.1| PREDICTED: allene oxide cyclase 2, chloroplastic-like [Brassica 
rapa]
Length=252

 Score = 82.0 bits (201),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/58 (64%), Positives = 46/58 (79%), Gaps = 0/58 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCI  496
            ++QEL VYE+NE DR SP  L+ +      LGDLVPF+NK+YTGDL+KRVGITAGLC+
Sbjct  79   RIQELSVYELNELDRHSPKILKNAASLTFGLGDLVPFTNKIYTGDLKKRVGITAGLCV  136



>ref|XP_009394153.1| PREDICTED: uncharacterized protein LOC103979699 isoform X2 [Musa 
acuminata subsp. malaccensis]
Length=305

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 38/40 (95%), Positives = 38/40 (95%), Gaps = 0/40 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  442
            KVQELCVYEINERDRGSPAYLRLSQK VN LGDLVPFSNK
Sbjct  87   KVQELCVYEINERDRGSPAYLRLSQKQVNFLGDLVPFSNK  126



>emb|CAN68566.1| hypothetical protein VITISV_032173 [Vitis vinifera]
Length=244

 Score = 77.8 bits (190),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 45/61 (74%), Gaps = 10/61 (16%)
 Frame = +2

Query  326  VQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIK  505
            VQEL VYEINERDR SPA+L+LSQK  N+LGDL            +KR+G+TAG+C+LI+
Sbjct  83   VQELYVYEINERDRDSPAFLKLSQKPANSLGDLT----------WEKRLGVTAGICVLIQ  132

Query  506  H  508
            H
Sbjct  133  H  133



>ref|XP_010554242.1| PREDICTED: allene oxide cyclase 3, chloroplastic-like isoform 
X2 [Tarenaya hassleriana]
Length=241

 Score = 77.4 bits (189),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 35/50 (70%), Positives = 42/50 (84%), Gaps = 0/50 (0%)
 Frame = +2

Query  359  RDRGSPAYLRLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKH  508
            RDR SPA L+L +K    LGDLVPF+NKLY+GDL KR+GITAGLC+LI+H
Sbjct  81   RDRNSPAVLKLGKKPELCLGDLVPFTNKLYSGDLTKRLGITAGLCVLIQH  130



>ref|XP_001760307.1| predicted protein [Physcomitrella patens]
 gb|EDQ75063.1| predicted protein, partial [Physcomitrella patens]
Length=184

 Score = 75.9 bits (185),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 37/62 (60%), Positives = 46/62 (74%), Gaps = 1/62 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYL-RLSQKSVNTLGDLVPFSNKLYTGDLQKRVGITAGLCIL  499
            +VQ   VYEINERDR SPA+L  LS    + LGDLVPFSNKLY   LQ R+G+TAG+ ++
Sbjct  1    EVQLFSVYEINERDRNSPAFLPTLSGDHEHGLGDLVPFSNKLYDSSLQVRLGVTAGMAMV  60

Query  500  IK  505
            +K
Sbjct  61   VK  62



>ref|XP_006373455.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
 gb|ERP51252.1| hypothetical protein POPTR_0017s13940g, partial [Populus trichocarpa]
Length=135

 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 32/36 (89%), Positives = 36/36 (100%), Gaps = 0/36 (0%)
 Frame = +2

Query  404  VNTLGDLVPFSNKLYTGDLQKRVGITAGLCILIKHE  511
            VNTLGDLVPFSNKLYTGDLQKR+GITAG+CILI+H+
Sbjct  2    VNTLGDLVPFSNKLYTGDLQKRIGITAGICILIQHK  37



>gb|AGL75607.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75608.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75609.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75610.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75611.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75612.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75613.1| mangrin, partial [Rhizophora mucronata]
 gb|AGL75614.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75615.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75616.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75617.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75618.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75619.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75620.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75621.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75622.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75623.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75624.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75625.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75626.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75627.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75628.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75629.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75630.1| mangrin, partial [Rhizophora apiculata]
 gb|AGL75631.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75632.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75633.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75634.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75635.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75636.1| mangrin, partial [Rhizophora mucronata x Rhizophora stylosa]
 gb|AGL75637.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75638.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75639.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75640.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75641.1| mangrin, partial [Rhizophora stylosa]
 gb|AGL75642.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75643.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75644.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75645.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75646.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75647.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75648.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75649.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75650.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75651.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75652.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75653.1| mangrin, partial [Rhizophora x lamarckii]
 gb|AGL75654.1| mangrin, partial [Rhizophora x lamarckii]
Length=40

 Score = 68.6 bits (166),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/40 (85%), Positives = 35/40 (88%), Gaps = 0/40 (0%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPFSNK  442
            KVQEL VYEINERDR SPA LRLSQK V +LGDLVPFSNK
Sbjct  1    KVQELFVYEINERDRESPAILRLSQKPVLSLGDLVPFSNK  40



>ref|XP_001779767.1| predicted protein [Physcomitrella patens]
 gb|EDQ55451.1| predicted protein [Physcomitrella patens]
Length=200

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 11/71 (15%)
 Frame = +2

Query  329  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFSNKLYTGDLQKRVG  475
            Q   VYE+NE DR SPA+L LS+++VN            LGD VPF+NKLY   L+ R+G
Sbjct  9    QTFTVYELNEFDRDSPAFLELSRQTVNRVDPNTGDHIKALGDQVPFTNKLYNSALEMRLG  68

Query  476  ITAGLCILIKH  508
            IT G+C+ +K+
Sbjct  69   ITTGICLHMKN  79



>ref|XP_001771240.1| predicted protein [Physcomitrella patens]
 gb|EDQ63951.1| predicted protein [Physcomitrella patens]
Length=254

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 45/70 (64%), Gaps = 11/70 (16%)
 Frame = +2

Query  329  QELCVYEINERDRGSPAYLRLSQKSVN-----------TLGDLVPFSNKLYTGDLQKRVG  475
            Q   VYE+NE DR SPA+L LS++SVN            LGD VPF+NKLY   L+ R+G
Sbjct  63   QTFTVYELNEFDRDSPAFLELSRQSVNRTDPVTGEHVKALGDQVPFTNKLYDSSLRTRLG  122

Query  476  ITAGLCILIK  505
            IT G+C+ +K
Sbjct  123  ITTGICLHMK  132



>tpg|DAA45889.1| TPA: hypothetical protein ZEAMMB73_165754 [Zea mays]
Length=117

 Score = 67.4 bits (163),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/42 (79%), Positives = 35/42 (83%), Gaps = 1/42 (2%)
 Frame = +2

Query  323  KVQELCVYEINERDRGSPAYLRLSQKSV-NTLGDLVPFSNKL  445
            KVQEL VYEINERDR SPAYLRLS K   N LGDLVPF+NK+
Sbjct  65   KVQELYVYEINERDRESPAYLRLSAKQTENALGDLVPFTNKV  106



>ref|XP_003628626.1| Allene-oxide cyclase [Medicago truncatula]
 gb|AET03102.1| allene oxide cyclase [Medicago truncatula]
Length=119

 Score = 64.7 bits (156),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/41 (73%), Positives = 32/41 (78%), Gaps = 0/41 (0%)
 Frame = +2

Query  311  APAGKVQELCVYEINERDRGSPAYLRLSQKSVNTLGDLVPF  433
            A   KVQE+ VYE NE DRGSPAY RLS KSVN+LGDLV F
Sbjct  68   ADTEKVQEMHVYEFNESDRGSPAYSRLSNKSVNSLGDLVSF  108



>dbj|BAO93687.1| allene oxide cyclase [Marchantia polymorpha]
Length=257

 Score = 57.8 bits (138),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 44/67 (66%), Gaps = 1/67 (1%)
 Frame = +2

Query  311  APAGKVQELCVYEINERDRGSPAYLRLSQK-SVNTLGDLVPFSNKLYTGDLQKRVGITAG  487
            AP  + Q + V+E NE DR SP  ++ + K  V  +GD VP+SNK+Y    +K +GI++G
Sbjct  86   APEDQEQVMGVFEFNEGDRNSPFVVKNNAKLPVLCIGDFVPYSNKVYDCTGKKYLGISSG  145

Query  488  LCILIKH  508
            LC +++H
Sbjct  146  LCTVVEH  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 554939364720