BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B09

Length=240
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAN86757.1|  G-protein beta-subunit/auxin-regulated protein          102   2e-26   Nicotiana tabacum [American tobacco]
emb|CAA96528.1|  G protein beta-subunit-like protein                    104   6e-25   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009776114.1|  PREDICTED: guanine nucleotide-binding protei...    104   6e-25   Nicotiana sylvestris
ref|XP_009600162.1|  PREDICTED: guanine nucleotide-binding protei...    103   1e-24   Nicotiana tomentosiformis
gb|AJE63428.1|  transcription factor ArcA1                              103   2e-24   Capsicum annuum
ref|XP_009778426.1|  PREDICTED: guanine nucleotide-binding protei...    102   3e-24   Nicotiana sylvestris
ref|NP_001233881.1|  ArcA2 protein                                      102   3e-24   
ref|XP_006341557.1|  PREDICTED: guanine nucleotide-binding protei...    102   4e-24   
gb|ABB86277.1|  ArcA2 protein-like                                      102   4e-24   Solanum tuberosum [potatoes]
ref|XP_009624187.1|  PREDICTED: guanine nucleotide-binding protei...    102   7e-24   Nicotiana tomentosiformis
ref|NP_001233876.1|  ArcA1 protein                                      101   9e-24   
sp|P93340.1|GBLP_NICPL  RecName: Full=Guanine nucleotide-binding ...    101   1e-23   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004252271.1|  PREDICTED: guanine nucleotide-binding protei...    100   2e-23   Solanum lycopersicum
ref|XP_006353816.1|  PREDICTED: guanine nucleotide-binding protei...    100   3e-23   Solanum tuberosum [potatoes]
ref|XP_004252270.1|  PREDICTED: guanine nucleotide-binding protei...    100   3e-23   Solanum lycopersicum
ref|XP_006365404.1|  PREDICTED: guanine nucleotide-binding protei...    100   3e-23   Solanum tuberosum [potatoes]
gb|ACR77528.1|  heterotrimeric G protein beta 1 subunit               98.6    9e-23   Nicotiana benthamiana
sp|P49026.1|GBLP_TOBAC  RecName: Full=Guanine nucleotide-binding ...  98.6    1e-22   Nicotiana tabacum [American tobacco]
ref|XP_009780116.1|  PREDICTED: guanine nucleotide-binding protei...  97.8    2e-22   Nicotiana sylvestris
ref|XP_009611065.1|  PREDICTED: guanine nucleotide-binding protei...  97.8    2e-22   Nicotiana tomentosiformis
gb|EYU17645.1|  hypothetical protein MIMGU_mgv1a009858mg              95.5    1e-21   Erythranthe guttata [common monkey flower]
gb|EYU40229.1|  hypothetical protein MIMGU_mgv1a008949mg              93.6    7e-21   Erythranthe guttata [common monkey flower]
ref|XP_011084467.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  92.0    2e-20   Sesamum indicum [beniseed]
emb|CDO98381.1|  unnamed protein product                              95.1    3e-20   Coffea canephora [robusta coffee]
ref|XP_011072970.1|  PREDICTED: guanine nucleotide-binding protei...  90.5    7e-20   Sesamum indicum [beniseed]
ref|XP_011039104.1|  PREDICTED: guanine nucleotide-binding protei...  89.4    2e-19   Populus euphratica
ref|XP_011039103.1|  PREDICTED: guanine nucleotide-binding protei...  89.4    2e-19   Populus euphratica
ref|XP_011000479.1|  PREDICTED: guanine nucleotide-binding protei...  89.0    3e-19   Populus euphratica
ref|XP_002321505.1|  GTP-binding protein beta chain                   88.6    4e-19   Populus trichocarpa [western balsam poplar]
gb|KJB53022.1|  hypothetical protein B456_008G288800                  88.6    4e-19   Gossypium raimondii
gb|KHG17882.1|  Guanine nucleotide-binding protein subunit beta-l...  88.6    4e-19   Gossypium arboreum [tree cotton]
ref|XP_002318528.1|  GTP-binding protein beta chain                   88.2    5e-19   Populus trichocarpa [western balsam poplar]
emb|CDX81860.1|  BnaC08g37410D                                        86.7    1e-18   
emb|CDY26186.1|  BnaA06g12310D                                        86.3    2e-18   Brassica napus [oilseed rape]
emb|CDY60778.1|  BnaC05g50130D                                        86.3    2e-18   Brassica napus [oilseed rape]
emb|CDY21720.1|  BnaA09g44710D                                        86.3    2e-18   Brassica napus [oilseed rape]
gb|KHG00880.1|  Guanine nucleotide-binding protein subunit beta-l...  85.9    4e-18   Gossypium arboreum [tree cotton]
gb|KJB37175.1|  hypothetical protein B456_006G192600                  85.9    4e-18   Gossypium raimondii
ref|XP_009117627.1|  PREDICTED: guanine nucleotide-binding protei...  85.5    4e-18   Brassica rapa
gb|EPS70887.1|  hypothetical protein M569_03871                       85.5    5e-18   Genlisea aurea
emb|CBI15540.3|  unnamed protein product                              88.2    6e-18   Vitis vinifera
ref|XP_010097592.1|  Guanine nucleotide-binding protein subunit b...  85.1    7e-18   Morus notabilis
gb|KDP37901.1|  hypothetical protein JCGZ_05340                       85.1    8e-18   Jatropha curcas
gb|ABK26798.1|  unknown                                               83.6    2e-17   Picea sitchensis
ref|XP_002281279.1|  PREDICTED: guanine nucleotide-binding protei...  83.6    2e-17   Vitis vinifera
ref|XP_007036696.1|  Transducin/WD40 repeat-like superfamily protein  83.6    2e-17   Theobroma cacao [chocolate]
emb|CDX83869.1|  BnaC08g17760D                                        83.2    3e-17   
emb|CDX96736.1|  BnaA08g22790D                                        83.2    3e-17   
gb|KDO62873.1|  hypothetical protein CISIN_1g048118mg                 83.2    3e-17   Citrus sinensis [apfelsine]
sp|Q39336.1|GBLP_BRANA  RecName: Full=Guanine nucleotide-binding ...  83.2    3e-17   Brassica napus [oilseed rape]
ref|XP_009149259.1|  PREDICTED: guanine nucleotide-binding protei...  83.2    3e-17   Brassica rapa
gb|KHG29145.1|  Guanine nucleotide-binding protein subunit beta-l...  83.2    4e-17   Gossypium arboreum [tree cotton]
gb|KJB08186.1|  hypothetical protein B456_001G069800                  83.2    4e-17   Gossypium raimondii
ref|XP_006451669.1|  hypothetical protein CICLE_v10008909mg           83.2    4e-17   Citrus clementina [clementine]
gb|AFV60006.1|  heterotrimeric guanine nucleotide-binding protein...  82.4    6e-17   Eschscholzia californica
emb|CDX92200.1|  BnaA05g22070D                                        82.4    7e-17   
ref|XP_009145932.1|  PREDICTED: guanine nucleotide-binding protei...  82.4    7e-17   Brassica rapa
emb|CDX95784.1|  BnaC05g35350D                                        82.4    7e-17   
ref|XP_009110365.1|  PREDICTED: guanine nucleotide-binding protei...  82.4    8e-17   Brassica rapa
emb|CDX95554.1|  BnaC01g34460D                                        82.0    8e-17   
ref|XP_009113515.1|  PREDICTED: guanine nucleotide-binding protei...  82.0    8e-17   Brassica rapa
emb|CDY18497.1|  BnaA01g26980D                                        82.0    8e-17   Brassica napus [oilseed rape]
ref|XP_006297909.1|  hypothetical protein CARUB_v10013951mg           82.8    8e-17   
ref|XP_008240184.1|  PREDICTED: guanine nucleotide-binding protei...  82.0    1e-16   Prunus mume [ume]
ref|XP_001780288.1|  predicted protein                                81.3    1e-16   
ref|XP_010540016.1|  PREDICTED: guanine nucleotide-binding protei...  81.6    1e-16   Tarenaya hassleriana [spider flower]
ref|XP_001779496.1|  predicted protein                                81.3    1e-16   
dbj|BAH56896.1|  AT1G18080                                            80.9    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002885240.1|  guanine nucleotide-binding family protein        81.3    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_010506450.1|  PREDICTED: guanine nucleotide-binding protei...  81.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010498185.1|  PREDICTED: guanine nucleotide-binding protei...  81.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010487724.1|  PREDICTED: guanine nucleotide-binding protei...  81.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010476972.1|  PREDICTED: guanine nucleotide-binding protei...  81.3    2e-16   Camelina sativa [gold-of-pleasure]
ref|XP_010465892.1|  PREDICTED: guanine nucleotide-binding protei...  81.3    2e-16   Camelina sativa [gold-of-pleasure]
gb|AAB82647.1|  WD-40 repeat protein                                  81.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|NP_173248.1|  guanine nucleotide-binding protein subunit beta...  81.3    2e-16   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243791.1|  PREDICTED: guanine nucleotide-binding protei...  80.9    2e-16   Nelumbo nucifera [Indian lotus]
ref|XP_006305339.1|  hypothetical protein CARUB_v10009720mg           80.9    2e-16   Capsella rubella
ref|XP_002890259.1|  hypothetical protein ARALYDRAFT_889221           80.9    2e-16   Arabidopsis lyrata subsp. lyrata
ref|XP_006837182.1|  hypothetical protein AMTR_s00105p00058690        80.9    2e-16   Amborella trichopoda
gb|KFK43977.1|  guanine nucleotide-binding protein subunit beta-l...  80.9    3e-16   Arabis alpina [alpine rockcress]
ref|XP_001754916.1|  predicted protein                                80.5    3e-16   
ref|XP_006416642.1|  hypothetical protein EUTSA_v10008183mg           80.5    3e-16   Eutrema salsugineum [saltwater cress]
ref|XP_008803271.1|  PREDICTED: guanine nucleotide-binding protei...  80.5    3e-16   Phoenix dactylifera
ref|XP_009380503.1|  PREDICTED: guanine nucleotide-binding protei...  80.5    3e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004299548.1|  PREDICTED: guanine nucleotide-binding protei...  80.5    3e-16   Fragaria vesca subsp. vesca
gb|ACJ85349.1|  unknown                                               80.1    4e-16   Medicago truncatula
ref|XP_007209348.1|  hypothetical protein PRUPE_ppa008536mg           80.1    4e-16   Prunus persica
ref|XP_003631071.1|  Guanine nucleotide-binding protein subunit b...  80.1    5e-16   Medicago truncatula
gb|AFK36580.1|  unknown                                               80.1    5e-16   Medicago truncatula
sp|O24076.1|GBLP_MEDSA  RecName: Full=Guanine nucleotide-binding ...  80.1    5e-16   Medicago sativa [alfalfa]
ref|XP_009360100.1|  PREDICTED: guanine nucleotide-binding protei...  79.7    6e-16   Pyrus x bretschneideri [bai li]
ref|XP_008393404.1|  PREDICTED: guanine nucleotide-binding protei...  79.7    6e-16   Malus domestica [apple tree]
ref|XP_008374821.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  79.7    6e-16   Malus domestica [apple tree]
ref|XP_004503304.1|  PREDICTED: guanine nucleotide-binding protei...  79.7    7e-16   Cicer arietinum [garbanzo]
ref|XP_006406649.1|  hypothetical protein EUTSA_v10021128mg           79.7    7e-16   Eutrema salsugineum [saltwater cress]
ref|XP_010256121.1|  PREDICTED: guanine nucleotide-binding protei...  79.3    7e-16   Nelumbo nucifera [Indian lotus]
ref|XP_007160506.1|  hypothetical protein PHAVU_002G327500g           79.3    7e-16   Phaseolus vulgaris [French bean]
ref|XP_010923802.1|  PREDICTED: guanine nucleotide-binding protei...  79.3    7e-16   Elaeis guineensis
gb|AGV54321.1|  RACK1                                                 79.3    8e-16   Phaseolus vulgaris [French bean]
ref|XP_010678120.1|  PREDICTED: guanine nucleotide-binding protei...  79.3    8e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK39137.1|  guanine nucleotide-binding protein subunit beta-l...  79.3    8e-16   Arabis alpina [alpine rockcress]
ref|XP_008453452.1|  PREDICTED: guanine nucleotide-binding protei...  79.3    9e-16   Cucumis melo [Oriental melon]
ref|XP_004137327.1|  PREDICTED: guanine nucleotide-binding protei...  79.3    9e-16   Cucumis sativus [cucumbers]
ref|XP_006393380.1|  hypothetical protein EUTSA_v10011646mg           79.0    1e-15   Eutrema salsugineum [saltwater cress]
ref|XP_009400497.1|  PREDICTED: guanine nucleotide-binding protei...  79.0    1e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010537487.1|  PREDICTED: guanine nucleotide-binding protei...  79.0    1e-15   Tarenaya hassleriana [spider flower]
ref|XP_010036939.1|  PREDICTED: guanine nucleotide-binding protei...  78.6    2e-15   Eucalyptus grandis [rose gum]
ref|NP_188441.1|  receptor for activated C kinase 1C                  78.6    2e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001241455.1|  uncharacterized protein LOC100778205             78.6    2e-15   Glycine max [soybeans]
ref|XP_010479287.1|  PREDICTED: guanine nucleotide-binding protei...  78.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010500401.1|  PREDICTED: guanine nucleotide-binding protei...  78.6    2e-15   Camelina sativa [gold-of-pleasure]
ref|XP_010461692.1|  PREDICTED: guanine nucleotide-binding protei...  78.6    2e-15   Camelina sativa [gold-of-pleasure]
gb|ACJ24167.1|  Rack                                                  78.2    2e-15   Phaseolus vulgaris [French bean]
ref|XP_009405003.1|  PREDICTED: guanine nucleotide-binding protei...  78.2    2e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010549078.1|  PREDICTED: guanine nucleotide-binding protei...  78.2    2e-15   Tarenaya hassleriana [spider flower]
gb|AAM65407.1|  guanine nucleotide-binding protein, putative          78.2    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002894122.1|  hypothetical protein ARALYDRAFT_474002           77.8    3e-15   
ref|XP_010032559.1|  PREDICTED: guanine nucleotide-binding protei...  77.8    3e-15   Eucalyptus grandis [rose gum]
ref|NP_175296.1|  receptor for activated C kinase 1B                  77.8    3e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006305354.1|  hypothetical protein CARUB_v10009733mg           77.8    3e-15   Capsella rubella
ref|NP_001235369.1|  guanine nucleotide-binding protein subunit b...  77.8    3e-15   Glycine max [soybeans]
pdb|3DM0|A  Chain A, Maltose Binding Protein Fusion With Rack1 Fr...  79.7    4e-15   Escherichia coli K-12
ref|XP_010924141.1|  PREDICTED: guanine nucleotide-binding protei...  77.4    5e-15   Elaeis guineensis
gb|ACJ85009.1|  unknown                                               76.3    5e-15   Medicago truncatula
ref|XP_010549077.1|  PREDICTED: guanine nucleotide-binding protei...  76.6    1e-14   Tarenaya hassleriana [spider flower]
ref|XP_009145001.1|  PREDICTED: guanine nucleotide-binding protei...  76.3    1e-14   Brassica rapa
ref|XP_009147950.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  75.9    2e-14   Brassica rapa
ref|XP_008812615.1|  PREDICTED: guanine nucleotide-binding protei...  75.9    2e-14   
ref|XP_002529557.1|  receptor for activated protein kinase C, put...  75.5    2e-14   Ricinus communis
ref|XP_010551145.1|  PREDICTED: guanine nucleotide-binding protei...  75.1    3e-14   Tarenaya hassleriana [spider flower]
gb|ACN41093.1|  unknown                                               74.3    6e-14   Picea sitchensis
gb|ABK25010.1|  unknown                                               74.3    6e-14   Picea sitchensis
ref|XP_010916329.1|  PREDICTED: guanine nucleotide-binding protei...  73.6    1e-13   Elaeis guineensis
ref|XP_010926201.1|  PREDICTED: guanine nucleotide-binding protei...  70.9    9e-13   Elaeis guineensis
ref|XP_003567944.1|  PREDICTED: guanine nucleotide-binding protei...  69.3    5e-12   Brachypodium distachyon [annual false brome]
ref|XP_007508318.1|  predicted protein                                68.9    6e-12   Bathycoccus prasinos
emb|CDY71917.1|  BnaCnng75080D                                        67.8    6e-12   Brassica napus [oilseed rape]
emb|CEG00110.1|  G-protein beta WD-40 repeat                          68.6    7e-12   Ostreococcus tauri
ref|XP_001421096.1|  Receptor of activated protein kinase C 1A, c...  68.6    8e-12   Ostreococcus lucimarinus CCE9901
ref|XP_008811978.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  68.2    1e-11   Phoenix dactylifera
ref|XP_006679085.1|  hypothetical protein BATDEDRAFT_33248            67.0    3e-11   Batrachochytrium dendrobatidis JAM81
gb|EPZ34131.1|  Guanine nucleotide-binding protein subunit beta-2...  66.2    5e-11   Rozella allomycis CSF55
ref|XP_004969582.1|  PREDICTED: guanine nucleotide-binding protei...  66.2    6e-11   Setaria italica
ref|XP_006644561.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  66.2    6e-11   Oryza brachyantha
gb|EER45453.1|  G-protein complex beta subunit CpcB                   62.8    7e-11   Histoplasma capsulatum H143
ref|XP_005703361.1|  hypothetical protein Gasu_55280                  65.9    9e-11   Galdieria sulphuraria
gb|EEC79656.1|  hypothetical protein OsI_20897                        65.5    1e-10   Oryza sativa Indica Group [Indian rice]
gb|EFX03206.1|  g-protein beta subunit                                65.5    1e-10   Grosmannia clavigera kw1407
ref|XP_003664641.1|  hypothetical protein MYCTH_2307651               65.5    1e-10   Thermothelomyces thermophila ATCC 42464
ref|XP_004343796.1|  guanine nucleotide-binding protein               65.1    1e-10   Capsaspora owczarzaki ATCC 30864
ref|XP_006695086.1|  putative guanine nucleotide-binding protein      65.1    1e-10   Chaetomium thermophilum var. thermophilum DSM 1495
ref|XP_005652002.1|  WD40 repeat-like protein                         65.1    2e-10   Coccomyxa subellipsoidea C-169
ref|XP_003060952.1|  predicted protein                                65.1    2e-10   Micromonas pusilla CCMP1545
ref|NP_001056254.1|  Os05g0552300                                     65.1    2e-10   
ref|XP_003852899.1|  guanine nucleotide-binding protein subunit b...  64.7    2e-10   Zymoseptoria tritici IPO323
gb|KFY05425.1|  hypothetical protein V491_09140                       62.0    2e-10   Pseudogymnoascus sp. VKM F-3775
gb|EMS51011.1|  Guanine nucleotide-binding protein subunit beta-l...  63.5    2e-10   Triticum urartu
ref|XP_003002475.1|  G-protein beta subunit                           64.7    2e-10   Verticillium alfalfae VaMs.102
gb|EXX68230.1|  Asc1p                                                 64.3    2e-10   Rhizophagus irregularis DAOM 197198w
gb|EHK42326.1|  cross-pathway control WD-repeat protein cpc2          64.3    3e-10   Trichoderma atroviride IMI 206040
gb|ABA01155.1|  G protein beta subunit-like polypeptide               63.5    3e-10   Chlamydomonas incerta
ref|XP_002176069.1|  RACK1 Cpc2                                       64.3    3e-10   Schizosaccharomyces japonicus yFS275
ref|XP_001796854.1|  hypothetical protein SNOG_06484                  63.2    3e-10   Parastagonospora nodorum SN15
sp|Q01369.1|GBLP_NEUCR  RecName: Full=Guanine nucleotide-binding ...  64.3    3e-10   Neurospora crassa OR74A
ref|NP_001043910.1|  Os01g0686800                                     64.3    3e-10   
gb|ESA03866.1|  hypothetical protein GLOINDRAFT_336518                64.3    3e-10   
gb|AGH70127.1|  guanine nucleotide-binding protein subunit beta-2...  62.8    3e-10   Placozoa sp. H4
ref|XP_960070.1|  guanine nucleotide-binding protein subunit beta...  64.3    3e-10   Neurospora crassa OR74A
ref|XP_007783846.1|  guanine nucleotide-binding protein subunit b...  63.9    4e-10   Coniosporium apollinis CBS 100218
ref|XP_007799385.1|  putative guanine nucleotide-binding protein ...  63.9    4e-10   
gb|EMT31237.1|  hypothetical protein F775_29537                       63.9    4e-10   
gb|KEY66722.1|  hypothetical protein S7711_06770                      63.9    4e-10   Stachybotrys chartarum IBT 7711
ref|XP_007925889.1|  G protein beta subunit                           63.9    4e-10   Pseudocercospora fijiensis CIRAD86
gb|KEZ40620.1|  hypothetical protein SAPIO_CDS8541                    63.9    4e-10   Scedosporium apiospermum
gb|ABA01128.1|  G protein beta subunit-like polypeptide               63.2    4e-10   Chlamydomonas incerta
gb|EME46889.1|  hypothetical protein DOTSEDRAFT_70743                 63.9    4e-10   Dothistroma septosporum NZE10
ref|XP_002777402.1|  receptor for activated protein kinase C, put...  62.0    5e-10   Perkinsus marinus ATCC 50983
ref|XP_007807134.1|  G-protein beta subunit                           63.2    5e-10   Metarhizium acridum CQMa 102
ref|XP_002967499.1|  hypothetical protein SELMODRAFT_144795           63.5    5e-10   Selaginella moellendorffii
emb|CDM83867.1|  unnamed protein product                              63.9    5e-10   Triticum aestivum [Canadian hard winter wheat]
ref|XP_002960209.1|  hypothetical protein SELMODRAFT_266532           63.5    5e-10   
ref|XP_007839961.1|  Guanine nucleotide-binding protein subunit b...  63.5    5e-10   Pestalotiopsis fici W106-1
gb|ENH83707.1|  g-protein beta subunit                                63.5    6e-10   
ref|XP_001239490.1|  hypothetical protein CIMG_09111                  63.5    6e-10   Coccidioides immitis RS
ref|NP_593770.1|  40S ribosomal protein cpc2/RACK1                    63.5    6e-10   Schizosaccharomyces pombe
ref|XP_001698065.1|  receptor of activated protein kinase C 1         63.5    6e-10   Chlamydomonas reinhardtii
ref|XP_007602725.1|  guanine nucleotide-binding protein subunit b...  63.5    6e-10   
gb|KID66925.1|  G-protein beta subunit                                63.5    6e-10   Metarhizium brunneum ARSEF 3297
emb|CCT69414.1|  probable CPC2 protein                                63.5    6e-10   Fusarium fujikuroi IMI 58289
gb|EQB48545.1|  hypothetical protein CGLO_12231                       63.5    6e-10   Colletotrichum gloeosporioides Cg-14
gb|EYE92822.1|  GBLP_NEUCR guanine nucleotide-binding protein bet...  63.5    6e-10   Aspergillus ruber CBS 135680
gb|KGK37600.1|  hypothetical protein JL09_g3231                       62.0    6e-10   Pichia kudriavzevii
gb|ABD49712.1|  G-protein beta subunit                                63.5    6e-10   Metarhizium anisopliae
gb|EXU98607.1|  WD40 domain protein                                   63.2    7e-10   Metarhizium robertsii
ref|XP_001631784.1|  predicted protein                                63.2    7e-10   Nematostella vectensis
gb|KIL96127.1|  guanine nucleotide-binding protein subunit beta-l...  63.2    7e-10   Fusarium avenaceum
gb|KFH46842.1|  Guanine nucleotide-binding protein subunit beta-l...  63.2    7e-10   Acremonium chrysogenum ATCC 11550
emb|CEJ92213.1|  Putative Pc22g03140 protein                          63.2    7e-10   Torrubiella hemipterigena
ref|XP_009261603.1|  FGB1                                             63.2    7e-10   Fusarium pseudograminearum CS3096
dbj|BAD44728.1|  G-protein beta like WD repeat protein                63.2    7e-10   Fusarium oxysporum
ref|XP_001226350.1|  guanine nucleotide-binding protein beta subu...  63.2    7e-10   Chaetomium globosum CBS 148.51
gb|KEQ62286.1|  WD40 repeat-like protein                              63.2    7e-10   Aureobasidium melanogenum CBS 110374
ref|XP_007582921.1|  putative g-protein comlpex beta subunit protein  63.2    7e-10   
gb|EMF14147.1|  WD repeat-containing protein 51A                      63.2    7e-10   Sphaerulina musiva SO2202
dbj|BAJ98167.1|  predicted protein                                    63.5    7e-10   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007824428.1|  WD40 repeat 2                                    63.2    7e-10   Metarhizium robertsii ARSEF 23
ref|XP_001903663.1|  hypothetical protein                             63.2    8e-10   Podospora anserina S mat+
ref|XP_008600266.1|  WD domain-containing protein                     63.2    8e-10   Beauveria bassiana ARSEF 2860
gb|EPX70722.1|  RACK1 Cpc2                                            63.2    8e-10   Schizosaccharomyces octosporus yFS286
ref|XP_002779700.1|  receptor for activated protein kinase C, put...  61.6    8e-10   Perkinsus marinus ATCC 50983
ref|XP_008202084.1|  PREDICTED: guanine nucleotide-binding protei...  60.8    9e-10   
emb|CEP13972.1|  hypothetical protein                                 63.2    9e-10   Parasitella parasitica
gb|EQK99976.1|  cross-pathway control WD-repeat protein cpc2          63.2    9e-10   Ophiocordyceps sinensis CO18
ref|XP_003176836.1|  G-protein comlpex beta subunit CpcB              62.8    9e-10   Nannizzia gypsea CBS 118893
ref|XP_006665983.1|  guanine nucleotide-binding protein beta subu...  62.8    9e-10   Cordyceps militaris CM01
ref|XP_002850965.1|  G-protein complex beta subunit CpcB              62.8    9e-10   Microsporum canis CBS 113480
gb|EHK21487.1|  cross-pathway control WD-repeat protein cpc2          62.8    9e-10   Trichoderma virens Gv29-8
ref|XP_001932022.1|  WD repeat containing protein 51A                 62.8    1e-09   Pyrenophora tritici-repentis Pt-1C-BFP
gb|KHJ35931.1|  putative guanine nucleotide-binding protein subun...  62.8    1e-09   Erysiphe necator
ref|XP_008020415.1|  hypothetical protein SETTUDRAFT_85587            62.8    1e-09   Exserohilum turcica Et28A
ref|XP_003301795.1|  hypothetical protein PTT_13386                   62.8    1e-09   
ref|XP_002481861.1|  G-protein complex beta subunit CpcB              62.8    1e-09   Talaromyces stipitatus ATCC 10500
ref|XP_006962578.1|  cross-pathway control WD-repeat-containing p...  62.8    1e-09   Trichoderma reesei QM6a
ref|XP_007915760.1|  putative guanine nucleotide-binding protein ...  62.8    1e-09   Phaeoacremonium minimum UCRPA7
ref|XP_003651077.1|  hypothetical protein THITE_2169762               62.8    1e-09   Thielavia terrestris NRRL 8126
ref|XP_003051079.1|  predicted protein                                62.8    1e-09   [Nectria] haematococca mpVI 77-13-4
emb|CBN79872.2|  guanine nucleotide binding protein beta polypept...  61.2    1e-09   Ectocarpus siliculosus
ref|XP_003014052.1|  vegetative incompatibility WD repeat protein...  62.8    1e-09   Trichophyton benhamiae CBS 112371
dbj|GAM85656.1|  hypothetical protein ANO11243_036630                 62.8    1e-09   fungal sp. No.11243
emb|CDM37037.1|  Guanine nucleotide-binding protein subunit beta-...  62.8    1e-09   Penicillium roqueforti FM164
ref|XP_002456166.1|  hypothetical protein SORBIDRAFT_03g031520        62.8    1e-09   Sorghum bicolor [broomcorn]
gb|AAK38633.1|AF320333_1  G protein beta subunit-like protein Rkp1    62.8    1e-09   Schizosaccharomyces pombe
ref|XP_002564357.1|  Pc22g03140                                       62.8    1e-09   Penicillium rubens Wisconsin 54-1255
ref|XP_009065209.1|  hypothetical protein LOTGIDRAFT_184120           62.8    1e-09   Lottia gigantea
ref|XP_011334835.1|  PREDICTED: guanine nucleotide-binding protei...  60.1    1e-09   
ref|XP_002147691.1|  G-protein comlpex beta subunit CpcB              62.8    1e-09   Talaromyces marneffei ATCC 18224
gb|ERS97367.1|  guanine nucleotide-binding protein subunit beta-l...  62.4    1e-09   Sporothrix schenckii ATCC 58251
gb|KIV99542.1|  guanine nucleotide-binding protein subunit beta-l...  62.4    1e-09   Verruconis gallopava
ref|XP_006620959.1|  PREDICTED: guanine nucleotide-binding protei...  60.1    1e-09   Apis dorsata [rock honeybee]
ref|XP_011259053.1|  PREDICTED: guanine nucleotide-binding protei...  60.1    1e-09   
emb|CEP08121.1|  hypothetical protein                                 62.4    1e-09   Parasitella parasitica
ref|XP_661767.1|  GBLP_NEUCR Guanine nucleotide-binding protein b...  62.4    1e-09   Aspergillus nidulans FGSC A4
gb|ABS18779.1|  putative WD40 protein                                 62.4    1e-09   Rusavskia elegans
ref|XP_001816748.1|  guanine nucleotide-binding protein subunit b...  62.4    2e-09   Aspergillus oryzae RIB40
ref|XP_001551314.1|  guanine nucleotide-binding protein beta subunit  62.4    2e-09   Botrytis cinerea B05.10
gb|EPS33376.1|  hypothetical protein PDE_08338                        62.0    2e-09   Penicillium oxalicum 114-2
gb|EKG14448.1|  hypothetical protein MPH_08297                        62.0    2e-09   Macrophomina phaseolina MS6
ref|XP_003710816.1|  guanine nucleotide-binding protein subunit b...  62.0    2e-09   Magnaporthe oryzae 70-15
gb|ESZ90478.1|  g-protein beta subunit                                62.8    2e-09   Sclerotinia borealis F-4128
ref|NP_001040272.1|  receptor for activated protein kinase C RACK...  59.7    2e-09   Bombyx mori [silk moth]
emb|CEG67117.1|  Putative Guanine nucleotide-binding protein subu...  62.0    2e-09   Rhizopus microsporus
gb|EIE76651.1|  guanine nucleotide-binding protein subunit beta-2...  62.0    2e-09   Rhizopus delemar RA 99-880
ref|XP_001537609.1|  hypothetical protein HCAG_07031                  62.0    2e-09   Histoplasma capsulatum NAm1
dbj|BAJ90663.1|  predicted protein                                    62.0    2e-09   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDJ53401.1|  receptor for activated C kinase, RACK protein, p...  62.0    2e-09   Eimeria brunetti
emb|CDI73736.1|  receptor for activated C kinase, RACK protein, p...  62.0    2e-09   Eimeria praecox
ref|XP_001389307.1|  guanine nucleotide-binding protein subunit b...  62.0    2e-09   Aspergillus niger CBS 513.88
ref|XP_002776949.1|  receptor for activated C kinase 1, putative      62.0    2e-09   Perkinsus marinus ATCC 50983
ref|XP_002838384.1|  hypothetical protein                             61.6    3e-09   Tuber melanosporum Mel28
ref|XP_007292588.1|  putative Guanine nucleotide-binding protein ...  61.6    3e-09   Marssonina brunnea f. sp. 'multigermtubi' MB_m1
ref|XP_011397272.1|  Guanine nucleotide-binding protein subunit b...  61.6    3e-09   Auxenochlorella protothecoides
gb|AAT01086.1|  putative activated protein kinase C receptor          61.6    3e-09   Homalodisca vitripennis
gb|KIV82161.1|  guanine nucleotide-binding protein subunit beta-l...  61.6    3e-09   Exophiala sideris
gb|KIW62858.1|  guanine nucleotide-binding protein subunit beta-l...  61.6    3e-09   Phialophora americana
ref|XP_001266728.1|  G-protein comlpex beta subunit CpcB              61.6    3e-09   Aspergillus fischeri NRRL 181
ref|XP_504170.2|  YALI0E20031p                                        61.6    3e-09   Yarrowia lipolytica CLIB122
ref|XP_006654750.1|  PREDICTED: guanine nucleotide-binding protei...  61.6    3e-09   Oryza brachyantha
ref|XP_751514.1|  G-protein complex beta subunit CpcB                 61.6    3e-09   Aspergillus fumigatus Af293
ref|XP_007761319.1|  guanine nucleotide-binding protein subunit b...  61.6    3e-09   Cladophialophora yegresii CBS 114405
emb|CDJ64680.1|  receptor for activated C kinase, RACK protein, p...  61.6    3e-09   Eimeria necatrix
gb|KIW59315.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    3e-09   Exophiala xenobiotica
gb|KIW30011.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    3e-09   Cladophialophora immunda
gb|KIW40911.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    3e-09   Exophiala oligosperma
gb|KIW10778.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    3e-09   Exophiala spinifera
ref|XP_007739518.1|  guanine nucleotide-binding protein subunit b...  61.2    4e-09   Cladophialophora psammophila CBS 110553
gb|KIW99040.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    4e-09   Cladophialophora bantiana CBS 173.52
emb|CDJ26965.1|  receptor for activated C kinase, RACK protein, p...  61.6    4e-09   Eimeria mitis
ref|XP_001746605.1|  hypothetical protein                             61.2    4e-09   Monosiga brevicollis MX1
gb|KFZ02418.1|  hypothetical protein V501_09567                       61.6    4e-09   
ref|XP_007680411.1|  hypothetical protein BAUCODRAFT_38509            61.2    4e-09   
ref|XP_008082093.1|  WD40 repeat-like protein                         61.2    4e-09   
gb|EGU80238.1|  hypothetical protein FOXB_09165                       62.4    4e-09   
gb|ELR02852.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    4e-09   
ref|XP_002945887.1|  hypothetical protein VOLCADRAFT_78914            61.2    4e-09   
gb|KFX99177.1|  hypothetical protein O988_04003                       61.6    4e-09   
gb|KFY27537.1|  hypothetical protein V493_03433                       61.2    4e-09   
gb|KFY13649.1|  hypothetical protein V492_03124                       61.2    4e-09   
gb|AAM88902.1|  guanine nucleotide-binding protein                    60.5    4e-09   
gb|KFX90325.1|  hypothetical protein V490_06514                       61.2    4e-09   
gb|KIV92993.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    4e-09   
gb|KFY55396.1|  hypothetical protein V496_07016                       61.2    4e-09   
dbj|BAK03551.1|  predicted protein                                    61.2    4e-09   
ref|XP_011301857.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    4e-09   
gb|KEF54434.1|  guanine nucleotide-binding protein subunit beta-l...  61.2    4e-09   
gb|KFY70489.1|  hypothetical protein V499_09126                       61.6    4e-09   
ref|XP_009134040.1|  PREDICTED: guanine nucleotide-binding protei...  61.6    4e-09   
ref|XP_667443.1|  guanine nucleotide-binding protein                  60.8    5e-09   
ref|XP_001272169.1|  G-protein comlpex beta subunit CpcB              60.8    5e-09   
gb|KIN05611.1|  hypothetical protein OIDMADRAFT_153920                60.8    5e-09   
ref|XP_007800891.1|  Guanine nucleotide-binding protein subunit b...  60.8    5e-09   
gb|EEH07310.1|  G-protein comlpex beta subunit CpcB                   62.4    5e-09   
gb|EGC41401.1|  G-protein comlpex beta subunit CpcB                   62.4    5e-09   
emb|CDS03837.1|  Putative Guanine nucleotide-binding proteinFT su...  60.8    5e-09   
emb|CDH49357.1|  guanine nucleotide binding protein beta subunit      60.8    5e-09   
emb|CDH49812.1|  guanine nucleotide binding protein beta subunit      60.8    6e-09   
ref|XP_002502835.1|  predicted protein                                60.8    6e-09   
gb|EWC48866.1|  guanine nucleotide-binding protein subunit beta-l...  60.8    6e-09   
ref|XP_004195509.1|  Piso0_004901                                     60.5    6e-09   
ref|XP_004194409.1|  Piso0_004901                                     60.5    6e-09   
emb|CCX15458.1|  Similar to Guanine nucleotide-binding protein su...  60.8    6e-09   
ref|XP_009225866.1|  guanine nucleotide-binding protein subunit b...  60.5    7e-09   
gb|AAX54700.1|  receptor of activated protein kinase C 1              60.5    7e-09   
dbj|GAN10996.1|  guanine nucleotide-binding protein                   59.7    7e-09   
ref|XP_002613759.1|  hypothetical protein BRAFLDRAFT_84515            60.5    8e-09   
ref|XP_005094913.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  60.5    8e-09   
ref|XP_007730120.1|  guanine nucleotide-binding protein subunit b...  60.5    8e-09   
gb|ABA33785.1|  RACK1-like protein                                    60.5    8e-09   
ref|XP_007723621.1|  guanine nucleotide-binding protein subunit b...  60.5    8e-09   
ref|XP_002791085.1|  G-protein comlpex beta subunit CpcB              60.5    8e-09   
ref|XP_010756949.1|  guanine nucleotide-binding protein subunit b...  60.5    8e-09   
ref|NP_001136800.1|  guanine nucleotide-binding protein beta subu...  60.5    9e-09   
ref|XP_006958593.1|  WD40 repeat-like protein                         60.1    9e-09   
gb|KIW80333.1|  guanine nucleotide-binding protein subunit beta-l...  60.1    9e-09   
ref|XP_003569582.1|  PREDICTED: guanine nucleotide-binding protei...  60.5    9e-09   
ref|XP_008718711.1|  guanine nucleotide-binding protein subunit b...  60.1    9e-09   
gb|ESW97398.1|  Guanine nucleotide-binding protein subunit beta-l...  60.1    1e-08   
gb|AET50474.1|  hypothetical protein                                  60.1    1e-08   
ref|XP_009160336.1|  guanine nucleotide-binding protein subunit b...  60.5    1e-08   
ref|NP_001146976.1|  LOC100280585                                     60.1    1e-08   
emb|CDJ38367.1|  activated protein kinase c receptor                  60.1    1e-08   
gb|AFO84705.1|  activated protein kinase C receptor                   60.1    1e-08   
ref|NP_001279371.1|  uncharacterized protein LOC103175775             60.1    1e-08   
gb|KIX03579.1|  guanine nucleotide-binding protein subunit beta-l...  60.1    1e-08   
dbj|GAE00026.1|  hypothetical protein PVAR5_8757                      59.7    1e-08   
ref|XP_011126276.1|  hypothetical protein AOL_s00173g232              60.1    1e-08   
ref|XP_001600152.1|  PREDICTED: guanine nucleotide-binding protei...  59.7    1e-08   
dbj|BAA13908.1|  unnamed protein product                              59.7    1e-08   
ref|XP_003082627.1|  GTP-binding regulatory protein beta chain ho...  60.5    1e-08   
ref|XP_004825267.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    1e-08   
gb|KDR18184.1|  Guanine nucleotide-binding protein subunit beta-l...  59.7    1e-08   
gb|ABC75581.1|  guanine nucleotide binding protein beta 2             58.5    1e-08   
gb|EPQ64052.1|  G-protein beta subunit                                59.7    1e-08   
gb|AIN39758.1|  RACK1                                                 59.7    1e-08   
emb|CCU77208.1|  putative guanine nucleotide-binding protein subu...  59.7    1e-08   
gb|EPQ05297.1|  Guanine nucleotide-binding protein subunit beta-2...  57.4    2e-08   
emb|CDS05125.1|  Putative Guanine nucleotide-binding proteinFT su...  58.2    2e-08   
gb|AEF79971.1|  receptor of activated protein kinase C 1              59.3    2e-08   
gb|AEE61583.1|  unknown                                               59.3    2e-08   
ref|XP_003701723.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
gb|ABX75500.1|  guanine nucleotide-binding protein subunit beta-2...  57.4    2e-08   
ref|XP_461293.1|  DEHA2F21890p                                        59.3    2e-08   
ref|XP_003394799.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
ref|XP_003686556.1|  hypothetical protein TPHA_0G02840                57.4    2e-08   
ref|XP_003382489.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
gb|KIY44498.1|  guanine nucleotide binding protein beta subunit       59.3    2e-08   
ref|XP_011145304.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
ref|XP_011049912.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
ref|XP_011334834.1|  PREDICTED: guanine nucleotide-binding protei...  59.3    2e-08   
ref|XP_011112534.1|  hypothetical protein H072_6755                   59.3    2e-08   
ref|NP_001291517.1|  guanine nucleotide-binding protein subunit b...  59.3    2e-08   
ref|XP_392962.1|  PREDICTED: receptor of activated protein kinase...  58.9    2e-08   
ref|XP_011259045.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    2e-08   
emb|CEG70023.1|  Putative Guanine nucleotide-binding protein subu...  58.9    2e-08   
gb|AEN80883.1|  AT1G18080-like protein                                57.4    2e-08   
dbj|BAG64385.1|  unnamed protein product                              57.4    2e-08   
gb|EFX70343.1|  hypothetical protein DAPPUDRAFT_231635                58.9    3e-08   
ref|XP_002123107.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    3e-08   
emb|CDJ61125.1|  receptor for activated C kinase, RACK protein, p...  58.2    3e-08   
ref|XP_004961307.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    3e-08   
emb|CDR40788.1|  CYFA0S05e04500g1_1                                   58.9    3e-08   
ref|XP_008475521.1|  PREDICTED: guanine nucleotide-binding protei...  58.9    3e-08   
gb|KIY98327.1|  Guanine nucleotide-binding protein subunit beta-l...  58.9    3e-08   
ref|NP_001041703.1|  receptor for activated protein kinase C RACK...  58.9    3e-08   
ref|NP_001086465.1|  uncharacterized protein LOC446289                58.5    3e-08   
emb|CCM01124.1|  predicted protein                                    58.5    3e-08   
emb|CAG01204.1|  unnamed protein product                              58.5    3e-08   
ref|XP_003970442.1|  PREDICTED: guanine nucleotide-binding protei...  58.5    3e-08   
ref|XP_002426725.1|  receptor for activated protein kinase C, put...  58.5    3e-08   
dbj|BAG62988.1|  unnamed protein product                              57.0    3e-08   
ref|NP_001187435.1|  guanine nucleotide-binding protein subunit b...  58.5    4e-08   
ref|XP_005711409.1|  receptor for activated protein kinase C          58.5    4e-08   
ref|XP_002412736.1|  guanine nucleotide-binding protein, putative     57.4    4e-08   
gb|ADO27998.1|  guanine nucleotide-binding protein subunit beta-2...  58.5    4e-08   
ref|XP_005072032.1|  PREDICTED: guanine nucleotide-binding protei...  57.0    4e-08   
gb|EJT47727.1|  G protein beta subunit-like protein Rkp1              58.5    4e-08   
gb|ACL54313.1|  unknown                                               58.5    4e-08   
emb|CBQ71151.1|  probable CPC2 protein, guanine nucleotide-bindin...  58.2    5e-08   
emb|CDH52095.1|  guanine nucleotide-binding protein subunit beta-...  58.2    5e-08   
ref|XP_002111630.1|  expressed hypothetical protein                   58.2    5e-08   
gb|EAW53693.1|  guanine nucleotide binding protein (G protein), b...  57.0    5e-08   
ref|XP_002440202.1|  hypothetical protein SORBIDRAFT_09g027690        58.2    5e-08   
pdb|4AOW|A  Chain A, Crystal Structure Of The Human Rack1 Protein...  58.2    5e-08   
gb|AGM32571.1|  WD40 domain containing protein                        57.8    5e-08   
emb|CDH52094.1|  guanine nucleotide-binding protein subunit beta-...  58.2    5e-08   
ref|XP_003686507.1|  hypothetical protein TPHA_0G02380                58.2    6e-08   
ref|XP_011276978.1|  Guanine nucleotide-binding protein subunit b...  58.2    6e-08   
gb|AAF22119.1|AF124742_1  guanine nucleotide-binding protein          57.8    6e-08   
emb|CCJ31306.1|  unnamed protein product                              56.2    6e-08   
ref|XP_011301856.1|  PREDICTED: guanine nucleotide-binding protei...  57.8    7e-08   
gb|EAW53701.1|  guanine nucleotide binding protein (G protein), b...  56.6    7e-08   
ref|XP_011506058.1|  PREDICTED: guanine nucleotide-binding protei...  57.8    7e-08   
gb|ABI63548.1|  receptor for activated protein kinase C-like          57.8    7e-08   
ref|XP_003367508.1|  WD domain, G-beta repeat-containing domain p...  56.2    7e-08   
ref|XP_004341795.1|  guanine nucleotide-binding protein beta subu...  57.8    7e-08   
gb|AEO44580.1|  receptor for activated C kinase 1                     57.8    7e-08   
gb|ADO33039.1|  receptor for activated protein kinase C RACK isof...  57.8    7e-08   
ref|NP_001280259.1|  guanine nucleotide-binding protein subunit b...  57.8    7e-08   
gb|KDR18185.1|  Guanine nucleotide-binding protein subunit beta-2...  57.8    8e-08   
gb|AAZ29606.1|  activated C kinase 1 receptor                         57.8    8e-08   
ref|NP_001004946.1|  guanine nucleotide binding protein (G protei...  57.8    8e-08   
gb|AAZ29605.1|  activated C kinase 1 receptor                         57.8    8e-08   
dbj|BAC56715.1|  receptor for activated protein kinase C homolog      57.8    8e-08   
gb|AEB26318.1|  receptor for activated protein kinase C               57.8    8e-08   
gb|ACR19030.1|  receptor for activated protein kinase C               57.8    8e-08   
gb|AAU84924.1|  putative activated protein kinase C receptor          57.8    8e-08   
dbj|BAM17717.1|  receptor of activated protein kinase C 1             57.8    8e-08   
gb|AAK51552.1|AF368031_1  receptor for activated protein kinase C...  57.8    8e-08   
gb|ABX55886.1|  activated C kinase 1 receptor                         57.8    8e-08   
ref|XP_005989393.1|  PREDICTED: guanine nucleotide-binding protei...  57.8    8e-08   
ref|XP_004697224.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    8e-08   
ref|XP_008282647.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    8e-08   
gb|ACO09909.1|  Guanine nucleotide-binding protein subunit beta 2...  57.4    8e-08   
ref|XP_003530054.1|  PREDICTED: guanine nucleotide-binding protei...  57.8    8e-08   
ref|XP_009448631.1|  PREDICTED: guanine nucleotide-binding protei...  57.0    9e-08   
emb|CDO70596.1|  hypothetical protein BN946_scf184656.g11             57.4    9e-08   
ref|XP_007548404.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    9e-08   
ref|XP_005795376.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    9e-08   
gb|ABI26262.1|  receptor for activated protein kinase c               57.4    9e-08   
ref|XP_004540947.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    9e-08   
gb|AAT35603.1|  receptor for activated protein kinase C               57.4    9e-08   
ref|XP_004073369.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    9e-08   
ref|XP_002392156.1|  hypothetical protein MPER_08308                  55.5    9e-08   
ref|XP_008325350.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    1e-07   
emb|CDK29592.1|  unnamed protein product                              55.8    1e-07   
ref|XP_010780163.1|  PREDICTED: guanine nucleotide-binding protei...  57.4    1e-07   
gb|AAP20196.1|  activated protein kinase C receptor                   56.6    1e-07   
ref|XP_008034536.1|  guanine nucleotide binding protein beta subunit  57.4    1e-07   
gb|ACT66700.1|  G-protein complex beta subunit                        57.4    1e-07   
ref|NP_001266445.1|  guanine nucleotide-binding protein subunit b...  57.4    1e-07   
ref|XP_009836542.1|  guanine nucleotide-binding protein subunit b...  57.4    1e-07   
emb|CCA74715.1|  probable CPC2 protein, guanine nucleotide-bindin...  57.4    1e-07   
gb|KDQ27929.1|  hypothetical protein PLEOSDRAFT_1065257               57.0    1e-07   
ref|XP_008550736.1|  PREDICTED: guanine nucleotide-binding protei...  55.1    1e-07   
dbj|BAG53102.1|  unnamed protein product                              56.6    1e-07   
dbj|BAD52259.1|  receptor for activated protein kinase C homolog      57.0    1e-07   
gb|ADV40152.1|  G protein beta subunit-like protein                   56.6    1e-07   
ref|XP_002804718.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    1e-07   
ref|NP_001260217.1|  receptor of activated protein kinase C 1, is...  54.7    1e-07   
gb|EPT05016.1|  hypothetical protein FOMPIDRAFT_1045684               57.0    1e-07   
gb|AAY66933.1|  guanine nucleotide-binding protein                    57.0    1e-07   
ref|XP_002490174.1|  G-protein beta subunit and guanine nucleotid...  57.0    1e-07   
ref|XP_007244608.1|  PREDICTED: guanine nucleotide-binding protei...  57.0    1e-07   
ref|XP_007362000.1|  guanine nucleotide binding protein beta subunit  56.6    1e-07   
ref|XP_009448629.1|  PREDICTED: guanine nucleotide-binding protei...  57.0    2e-07   
ref|XP_008955163.1|  PREDICTED: guanine nucleotide-binding protei...  57.0    2e-07   
dbj|BAL72827.1|  receptor for activated protein kinase C1             56.6    2e-07   
ref|XP_004586327.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
ref|XP_006987199.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
gb|AAG29506.1|  activated protein kinase C receptor                   56.6    2e-07   
tpg|DAA27596.1|  TPA: guanine nucleotide-binding protein subunit ...  56.6    2e-07   
ref|XP_005062497.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
ref|XP_005234127.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  56.6    2e-07   
dbj|BAE40059.1|  unnamed protein product                              56.6    2e-07   
gb|AAI02287.2|  GNB2L1 protein                                        56.6    2e-07   
ref|XP_004780256.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
ref|XP_007431363.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
dbj|BAA06185.1|  G protein beta subuit like                           56.6    2e-07   
ref|XP_004387229.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
dbj|BAE35378.1|  unnamed protein product                              56.6    2e-07   
ref|NP_006089.1|  guanine nucleotide-binding protein subunit beta...  56.6    2e-07   
ref|XP_005534099.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
dbj|BAD96208.1|  guanine nucleotide binding protein (G protein), ...  56.6    2e-07   
gb|AAA18951.1|  protein kinase C receptor                             56.6    2e-07   
ref|XP_003333548.2|  guanine nucleotide-binding protein subunit b...  56.2    2e-07   
ref|XP_002181732.1|  predicted protein                                56.6    2e-07   
gb|KEI37942.1|  hypothetical protein L969DRAFT_89179                  56.6    2e-07   
ref|XP_006270088.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
gb|KFO20808.1|  Guanine nucleotide-binding protein subunit beta-2...  56.6    2e-07   
ref|XP_008197431.1|  PREDICTED: guanine nucleotide-binding protei...  54.3    2e-07   
gb|AAP36938.1|  Homo sapiens guanine nucleotide binding protein (...  56.6    2e-07   
gb|EHB05258.1|  Guanine nucleotide-binding protein subunit beta-2...  56.6    2e-07   
gb|KFO76552.1|  Guanine nucleotide-binding protein subunit beta-2...  56.6    2e-07   
gb|EPY85923.1|  guanine nucleotide binding protein, beta polypept...  56.6    2e-07   
ref|XP_005536426.1|  receptor for activated protein kinase C          56.2    2e-07   
ref|NP_001279416.1|  guanine nucleotide-binding protein subunit b...  56.6    2e-07   
ref|XP_007899557.1|  PREDICTED: guanine nucleotide-binding protei...  56.2    2e-07   
gb|EMD37863.1|  guanine nucleotide binding protein beta subunit       56.2    2e-07   
ref|XP_008681951.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
gb|AAO21313.1|  lung cancer oncogene 7                                56.6    2e-07   
ref|XP_008156879.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
ref|NP_001291025.1|  guanine nucleotide binding protein (G protei...  56.2    2e-07   
ref|XP_006105825.1|  PREDICTED: LOW QUALITY PROTEIN: guanine nucl...  56.6    2e-07   
ref|XP_008013783.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
tpg|DAA34130.1|  TPA: G protein beta subunit-like protein             55.1    2e-07   
gb|AJG43933.1|  guanine nucleotide-binding protein subunit beta-l...  53.5    2e-07   
gb|EAW53696.1|  guanine nucleotide binding protein (G protein), b...  56.6    2e-07   
ref|XP_005862397.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   
gb|ACN10148.1|  Guanine nucleotide-binding protein subunit beta-2...  56.2    2e-07   
ref|XP_006766909.1|  PREDICTED: guanine nucleotide-binding protei...  56.6    2e-07   



>gb|AAN86757.1| G-protein beta-subunit/auxin-regulated protein [Nicotiana tabacum]
Length=64

 Score =   102 bits (255),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+  TDWVTAIA P+DNSD IV+SSRDKSIIVW++TKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRL  60



>emb|CAA96528.1| G protein beta-subunit-like protein [Nicotiana plumbaginifolia]
Length=328

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKS+IVW+LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRL  60



>ref|XP_009776114.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=328

 Score =   104 bits (260),  Expect = 6e-25, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKS+IVW+LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWSLTKDGPQYGVPRRRL  60



>ref|XP_009600162.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=328

 Score =   103 bits (258),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKS+IVW LTKDGPQ+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSLIVWALTKDGPQYGVPRRRL  60



>gb|AJE63428.1| transcription factor ArcA1 [Capsicum annuum]
Length=330

 Score =   103 bits (256),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGP +GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPTYGVPRRRL  60



>ref|XP_009778426.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=326

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+  TDWVTAIA P+DNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  60



>ref|NP_001233881.1| ArcA2 protein [Solanum lycopersicum]
 dbj|BAA76896.1| LeArcA2 protein [Solanum lycopersicum]
Length=326

 Score =   102 bits (255),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60



>ref|XP_006341557.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=327

 Score =   102 bits (255),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60



>gb|ABB86277.1| ArcA2 protein-like [Solanum tuberosum]
Length=327

 Score =   102 bits (254),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 50/60 (83%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MAQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGAQYGVPRRRL  60



>ref|XP_009624187.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=326

 Score =   102 bits (253),  Expect = 7e-24, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 54/60 (90%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+  TDWVTAIA P+DNSD IV+SSRDKSIIVW++TKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRL  60



>ref|NP_001233876.1| ArcA1 protein [Solanum lycopersicum]
 dbj|BAA76895.1| LeArcA1 protein [Solanum lycopersicum]
Length=326

 Score =   101 bits (252),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 49/60 (82%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGSQYGVPRRRL  60



>sp|P93340.1|GBLP_NICPL RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana plumbaginifolia]
 emb|CAA70705.1| G protein beta subunit [Nicotiana plumbaginifolia]
Length=326

 Score =   101 bits (251),  Expect = 1e-23, Method: Compositional matrix adjust.
 Identities = 47/60 (78%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+ E LVLRGTM+  TDWVTAIA P+DNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  1    MSHESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  60



>ref|XP_004252271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solanum lycopersicum]
Length=301

 Score =   100 bits (248),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60



>ref|XP_006353816.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=329

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60



>ref|XP_004252270.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X1 [Solanum lycopersicum]
Length=329

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTK+G Q+GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKEGSQYGVPRRRL  60



>ref|XP_006365404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Solanum tuberosum]
Length=326

 Score =   100 bits (248),  Expect = 3e-23, Method: Compositional matrix adjust.
 Identities = 48/60 (80%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTMK  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDG  +GV RRRL
Sbjct  1    MSQESLVLRGTMKAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGSHYGVPRRRL  60



>gb|ACR77528.1| heterotrimeric G protein beta 1 subunit [Nicotiana benthamiana]
Length=326

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+  TDWVTAIA P+DNSD IV+SSRDKSIIVW++TKDGP +GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATPVDNSDMIVTSSRDKSIIVWSITKDGPLYGVPRRRL  60



>sp|P49026.1|GBLP_TOBAC RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tabacum]
 dbj|BAA04478.1| G protein beta subunit-like protein [Nicotiana tabacum]
Length=326

 Score = 98.6 bits (244),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 46/60 (77%), Positives = 53/60 (88%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE LVLRGTM+  TDWVTAIA  +DNSD IV+SSRDKSIIVW++TKDGPQ+GV RRRL
Sbjct  1    MSQESLVLRGTMRAHTDWVTAIATAVDNSDMIVTSSRDKSIIVWSITKDGPQYGVPRRRL  60



>ref|XP_009780116.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana sylvestris]
Length=325

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  65   QECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
             E LVLRGTM+  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  2    SESLVLRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  59



>ref|XP_009611065.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nicotiana tomentosiformis]
Length=325

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 47/58 (81%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = +2

Query  65   QECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
             E LVLRGTM+  TDWVTAIA PIDNSD IV+SSRDKSIIVW+LTKDGPQ+GV RRRL
Sbjct  2    SESLVLRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSIIVWSLTKDGPQYGVPRRRL  59



>gb|EYU17645.1| hypothetical protein MIMGU_mgv1a009858mg [Erythranthe guttata]
Length=329

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE L+LRGTM+  TDWVTAIA PIDNSD IV+SSRDKS+I+WNLTK+   +GVARRRL
Sbjct  1    MAQEQLILRGTMRAHTDWVTAIATPIDNSDMIVTSSRDKSLILWNLTKEDKNYGVARRRL  60



>gb|EYU40229.1| hypothetical protein MIMGU_mgv1a008949mg [Erythranthe guttata]
Length=357

 Score = 93.6 bits (231),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 45/65 (69%), Positives = 53/65 (82%), Gaps = 0/65 (0%)
 Frame = +2

Query  44   QRERKMAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGV  223
              +  MAQE LVLRGTM+  TDWVTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV
Sbjct  24   HNQSAMAQEQLVLRGTMRAHTDWVTAIATPIDNSDMIVTASRDKSIILWSLTKEDRTYGV  83

Query  224  ARRRL  238
            ARRRL
Sbjct  84   ARRRL  88



>ref|XP_011084467.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Sesamum indicum]
Length=318

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE LVLRGT++  TDWVTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVARRRL
Sbjct  1    MAQEQLVLRGTLRAHTDWVTAIATPIDNSDMIVTSSRDKSIILWALTKEDKTYGVARRRL  60



>emb|CDO98381.1| unnamed protein product [Coffea canephora]
Length=1395

 Score = 95.1 bits (235),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 47/82 (57%), Positives = 59/82 (72%), Gaps = 4/82 (5%)
 Frame = +2

Query  5     FQTLRFRPPNS*SQRER----KMAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRD  172
             F   R  PP + +   R    KM+Q+ L+LRGTM+  TDWVTAIA PIDN+D IV+SSRD
Sbjct  1044  FSIFRLSPPKNPAPHSRSSSLKMSQDQLILRGTMRAHTDWVTAIATPIDNTDMIVTSSRD  1103

Query  173   KSIIVWNLTKDGPQFGVARRRL  238
             KSII+W+LTK+   +GV RRRL
Sbjct  1104  KSIILWSLTKEDKTYGVPRRRL  1125



>ref|XP_011072970.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Sesamum indicum]
Length=329

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 51/60 (85%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+QE L+LRGT++  TDWVTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVARRRL
Sbjct  1    MSQEQLILRGTLRAHTDWVTAIATPIDNSDMIVTSSRDKSIILWALTKEEKSYGVARRRL  60



>ref|XP_011039104.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+  TD VTAIA PIDN+D IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRL  60



>ref|XP_011039103.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/60 (73%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+  TD VTAIA PIDN+D IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSSSRDKSIILWHLTKDEKTYGVARRRL  60



>ref|XP_011000479.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Populus euphratica]
Length=328

 Score = 89.0 bits (219),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA + LVLRGTM+  TD VTAIA PIDNSD IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MASDTLVLRGTMRAHTDQVTAIATPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRL  60



>ref|XP_002321505.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|ABK92879.1| unknown [Populus trichocarpa]
 gb|EEF05632.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA + LVLRGTM+  TD VTAIA PIDNSD IVSSSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MASDTLVLRGTMRAHTDQVTAIATPIDNSDMIVSSSRDKSIILWSLTKDEKTYGVARRRL  60



>gb|KJB53022.1| hypothetical protein B456_008G288800 [Gossypium raimondii]
Length=326

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MAFEGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  60



>gb|KHG17882.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=326

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 45/60 (75%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MAFEGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  60



>ref|XP_002318528.1| GTP-binding protein beta chain [Populus trichocarpa]
 gb|EEE96748.1| GTP-binding protein beta chain [Populus trichocarpa]
Length=328

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E L+LRGTM+  TD VTAIA PIDN+D IVS+SRDKSII+W+LTKD   +GVARRRL
Sbjct  1    MATETLILRGTMRAHTDQVTAIATPIDNTDMIVSASRDKSIILWHLTKDEKTYGVARRRL  60



>emb|CDX81860.1| BnaC08g37410D [Brassica napus]
Length=250

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>emb|CDY26186.1| BnaA06g12310D [Brassica napus]
Length=250

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>emb|CDY60778.1| BnaC05g50130D [Brassica napus]
Length=250

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>emb|CDY21720.1| BnaA09g44710D [Brassica napus]
Length=250

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>gb|KHG00880.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  5    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  61



>gb|KJB37175.1| hypothetical protein B456_006G192600 [Gossypium raimondii]
Length=327

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GVARRRL
Sbjct  5    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVARRRL  61



>ref|XP_009117627.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=327

 Score = 85.5 bits (210),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 43/57 (75%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>gb|EPS70887.1| hypothetical protein M569_03871 [Genlisea aurea]
Length=326

 Score = 85.5 bits (210),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 41/60 (68%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M+Q+ LVLRGTM+  T+WVTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRL
Sbjct  1    MSQDQLVLRGTMRAHTNWVTAIATPIDNSDMIVTASRDKSIILWALTKEDRTYGVPRRRL  60



>emb|CBI15540.3| unnamed protein product [Vitis vinifera]
Length=1318

 Score = 88.2 bits (217),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/65 (68%), Positives = 50/65 (77%), Gaps = 0/65 (0%)
 Frame = +2

Query  44    QRERKMAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGV  223
             +RE     E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV
Sbjct  1050  ERESSKMAETLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDDKTYGV  1109

Query  224   ARRRL  238
              RRRL
Sbjct  1110  PRRRL  1114



>ref|XP_010097592.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
 gb|EXB69124.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Morus notabilis]
Length=330

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  1    MASEGLVLRGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWHLTKEDKAYGVPRRRL  60



>gb|KDP37901.1| hypothetical protein JCGZ_05340 [Jatropha curcas]
Length=329

 Score = 85.1 bits (209),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 43/60 (72%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTK+   +GV RRRL
Sbjct  1    MAVEGLVLRGTMRAHTDQVTAIATPIDNSDMIVTSSRDKSIILWHLTKEEKTYGVPRRRL  60



>gb|ABK26798.1| unknown [Picea sitchensis]
 gb|ACN40746.1| unknown [Picea sitchensis]
 gb|ACN40912.1| unknown [Picea sitchensis]
Length=316

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IVSSSRDKSI++WNLTK+  ++GV RRRL
Sbjct  3    EALVLRGTMEGHTDAVTAIATPIDNSDMIVSSSRDKSILLWNLTKEPEKYGVPRRRL  59



>ref|XP_002281279.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Vitis vinifera]
 emb|CAN61810.1| hypothetical protein VITISV_026180 [Vitis vinifera]
Length=327

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRL
Sbjct  3    ETLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDDKTYGVPRRRL  59



>ref|XP_007036696.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
 gb|EOY21197.1| Transducin/WD40 repeat-like superfamily protein [Theobroma cacao]
Length=327

 Score = 83.6 bits (205),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GV RRRL
Sbjct  5    EALVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWQLTKDEKTYGVPRRRL  61



>emb|CDX83869.1| BnaC08g17760D [Brassica napus]
Length=250

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRL  59



>emb|CDX96736.1| BnaA08g22790D [Brassica napus]
Length=250

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRL  59



>gb|KDO62873.1| hypothetical protein CISIN_1g048118mg [Citrus sinensis]
Length=303

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSIIVW+LTK+   +GVARRRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRL  59



>sp|Q39336.1|GBLP_BRANA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Brassica napus]
 emb|CAA83924.1| guanine nucleotide regulatory protein [Brassica napus]
Length=327

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSDTIVS+SRDKSIIVW LTKD   +GV +RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDTIVSASRDKSIIVWKLTKDDKSYGVRQRRL  59



>ref|XP_009149259.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Brassica rapa]
Length=328

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IVS+SRDKSIIVW LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDPIVSASRDKSIIVWKLTKDDKSYGVAQRRL  59



>gb|KHG29145.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Gossypium arboreum]
Length=327

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
              E L+LRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRL
Sbjct  3    GSEGLILRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRL  61



>gb|KJB08186.1| hypothetical protein B456_001G069800 [Gossypium raimondii]
Length=327

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/59 (69%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
              E L+LRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W+LTKD   +GV RRRL
Sbjct  3    GSEGLILRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWHLTKDEKTYGVPRRRL  61



>ref|XP_006451669.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
 ref|XP_006490737.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Citrus sinensis]
 gb|ESR64909.1| hypothetical protein CICLE_v10008909mg [Citrus clementina]
Length=327

 Score = 83.2 bits (204),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSIIVW+LTK+   +GVARRRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWHLTKEEKTYGVARRRL  59



>gb|AFV60006.1| heterotrimeric guanine nucleotide-binding protein subunit beta 
[Eschscholzia californica]
Length=313

 Score = 82.4 bits (202),  Expect = 6e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + LVLRGT+K   D VTAIA PIDNSD IVSSSRDKSI+VW+LTK+ P +GV RRRL
Sbjct  3    DVLVLRGTLKGHDDMVTAIATPIDNSDMIVSSSRDKSILVWHLTKEDPTYGVPRRRL  59



>emb|CDX92200.1| BnaA05g22070D [Brassica napus]
Length=325

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_009145932.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=325

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRL  59



>emb|CDX95784.1| BnaC05g35350D [Brassica napus]
Length=325

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_009110365.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brassica rapa]
Length=327

 Score = 82.4 bits (202),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVSASRDKSIILWKLTKDDKSYGVAQRRL  59



>emb|CDX95554.1| BnaC01g34460D [Brassica napus]
Length=326

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRL  59



>ref|XP_009113515.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Brassica rapa]
Length=326

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRL  59



>emb|CDY18497.1| BnaA01g26980D [Brassica napus]
Length=326

 Score = 82.0 bits (201),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKDEKSYGVAQRRL  59



>ref|XP_006297909.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
 gb|EOA30807.1| hypothetical protein CARUB_v10013951mg, partial [Capsella rubella]
Length=380

 Score = 82.8 bits (203),  Expect = 8e-17, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 9/78 (12%)
 Frame = +2

Query  5    FQTLRFRPPNS*SQRERKMAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSII  184
             ++LR  P N        MA E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII
Sbjct  45   LESLRSEPLN--------MA-EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSII  95

Query  185  VWNLTKDGPQFGVARRRL  238
            +W LTKD   +GVA+RRL
Sbjct  96   LWKLTKDDKSYGVAQRRL  113



>ref|XP_008240184.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Prunus mume]
Length=327

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W+LTKD   +GV RRRL
Sbjct  3    ETLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRL  59



>ref|XP_001780288.1| predicted protein [Physcomitrella patens]
 gb|EDQ54847.1| predicted protein [Physcomitrella patens]
Length=316

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGT+K  ++WVTAIA P+DN D I+SSSRDKSIIVW LT++   +GVARRRL
Sbjct  3    ETLVLRGTLKGHSNWVTAIACPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRL  59



>ref|XP_010540016.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score = 81.6 bits (200),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+DTIVSSSRDKS+I+W LTKD   +GV +RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADTIVSSSRDKSVILWKLTKDDKAYGVPQRRL  59



>ref|XP_001779496.1| predicted protein [Physcomitrella patens]
 gb|EDQ55672.1| predicted protein [Physcomitrella patens]
Length=316

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGT+K  ++WVTAIA P+DN D I+SSSRDKSIIVW LT++   +GVARRRL
Sbjct  3    ETLVLRGTLKGHSNWVTAIACPLDNPDLILSSSRDKSIIVWTLTREEGNYGVARRRL  59



>dbj|BAH56896.1| AT1G18080 [Arabidopsis thaliana]
Length=276

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_002885240.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
 gb|EFH61499.1| guanine nucleotide-binding family protein [Arabidopsis lyrata 
subsp. lyrata]
Length=327

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_010506450.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_010498185.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDEKSYGVAQRRL  59



>ref|XP_010487724.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_010476972.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Camelina sativa]
Length=328

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|XP_010465892.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein C [Camelina sativa]
Length=326

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRL  59



>gb|AAB82647.1| WD-40 repeat protein [Arabidopsis thaliana]
Length=327

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|NP_173248.1| guanine nucleotide-binding protein subunit beta-like protein 
A [Arabidopsis thaliana]
 sp|O24456.2|GBLPA_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; AltName: Full=Receptor for activated C kinase 
1A; AltName: Full=WD-40 repeat auxin-dependent protein ARCA 
[Arabidopsis thaliana]
 gb|AAF78369.1|AC069551_2 T10O22.6 [Arabidopsis thaliana]
 gb|AAF97825.1|AC034107_8 Identical to WD-40 repeat protein (AtArcA) from Arabidopsis thaliana 
gb|U77381 and contains multiple WD (G-beta repeat) PF|00400 
domains. ESTs gb|Z17972, gb|AI099926, gb|T42961, gb|R30131, 
gb|AV541608, gb|AV532234, gb|AV543299, gb|AV440652 come 
from this gene [Arabidopsis thaliana]
 gb|AAK59512.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAL34190.1| putative WD-40 repeat protein [Arabidopsis thaliana]
 gb|AAM66016.1| WD-40 repeat protein [Arabidopsis thaliana]
 gb|AEE29673.1| WD-40 repeat ArcA-like protein [Arabidopsis thaliana]
Length=327

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_010243791.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTMK  +D VTAIA PIDNSD IVSSSRDKS++VW+LTK+   +GV RRRL
Sbjct  3    ETLVLKGTMKGHSDMVTAIATPIDNSDMIVSSSRDKSVLVWHLTKEEGTYGVPRRRL  59



>ref|XP_006305339.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
 gb|EOA38237.1| hypothetical protein CARUB_v10009720mg [Capsella rubella]
Length=328

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_002890259.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66518.1| hypothetical protein ARALYDRAFT_889221 [Arabidopsis lyrata subsp. 
lyrata]
Length=327

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_006837182.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
 gb|ERN00036.1| hypothetical protein AMTR_s00105p00058690 [Amborella trichopoda]
Length=314

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTMK  +D VTAIA P+DNSD IVSSSRDKS+++W+LTK+   +GV RRRL
Sbjct  3    ETLVLRGTMKGHSDMVTAIATPVDNSDVIVSSSRDKSVLLWHLTKEEGTYGVPRRRL  59



>gb|KFK43977.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score = 80.9 bits (198),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLILKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_001754916.1| predicted protein [Physcomitrella patens]
 gb|EDQ80370.1| predicted protein [Physcomitrella patens]
Length=316

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGT+K   +WVTAIA P+DN D I+SSSRDKSIIVW+L+++   +GVARRRL
Sbjct  3    ETLVLRGTLKGHANWVTAIACPLDNPDLILSSSRDKSIIVWHLSREEGNYGVARRRL  59



>ref|XP_006416642.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
 gb|ESQ34995.1| hypothetical protein EUTSA_v10008183mg [Eutrema salsugineum]
Length=328

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLILKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  59



>ref|XP_008803271.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=323

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/66 (65%), Positives = 49/66 (74%), Gaps = 9/66 (14%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + LVLRGT++  +D VTAIAAPIDNSD IVSSSRDKSI+VWNLTKD P          +G
Sbjct  3    DTLVLRGTLRGHSDMVTAIAAPIDNSDMIVSSSRDKSILVWNLTKDAPLSAEGAAASSYG  62

Query  221  VARRRL  238
            V RRRL
Sbjct  63   VPRRRL  68



>ref|XP_009380503.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Musa acuminata subsp. malaccensis]
Length=323

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 43/67 (64%), Positives = 49/67 (73%), Gaps = 10/67 (15%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP----------QF  217
            + LVLRGTM+  TD VTAIAAPIDNSD IVSSSRDKS++VW+LTKD P           +
Sbjct  3    DTLVLRGTMRGHTDMVTAIAAPIDNSDMIVSSSRDKSVLVWHLTKDAPAASADGSGVGSY  62

Query  218  GVARRRL  238
            GV RRRL
Sbjct  63   GVPRRRL  69



>ref|XP_004299548.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Fragaria vesca subsp. vesca]
Length=326

 Score = 80.5 bits (197),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 40/60 (67%), Positives = 46/60 (77%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M  E LVL+GTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W L KD   +GV RRRL
Sbjct  1    MGSEGLVLKGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWQLNKDENSYGVPRRRL  60



>gb|ACJ85349.1| unknown [Medicago truncatula]
Length=285

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>ref|XP_007209348.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
 gb|EMJ10547.1| hypothetical protein PRUPE_ppa008536mg [Prunus persica]
Length=327

 Score = 80.1 bits (196),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + LVLRGTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W+LTKD   +GV RRRL
Sbjct  3    DTLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLTKDEKTYGVPRRRL  59



>ref|XP_003631071.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Medicago truncatula]
 gb|AET05547.1| guanine nucleotide-binding protein beta subunit-like protein 
[Medicago truncatula]
Length=325

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>gb|AFK36580.1| unknown [Medicago truncatula]
Length=325

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>sp|O24076.1|GBLP_MEDSA RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Medicago sativa]
 emb|CAA69934.1| G protein beta subunit-like [Medicago sativa subsp. x varia]
Length=325

 Score = 80.1 bits (196),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>ref|XP_009360100.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRL
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRL  59



>ref|XP_008393404.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
Length=326

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRL
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRL  59



>ref|XP_008374821.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein [Malus domestica]
 ref|XP_008364648.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Malus domestica]
 ref|XP_009347770.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Pyrus x bretschneideri]
Length=326

 Score = 79.7 bits (195),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNS+ IVS+SRDKSII+W+L KD   +GV RRRL
Sbjct  3    ENLVLRGTMRAHTDMVTAIAIPIDNSEMIVSASRDKSIILWHLNKDEKTYGVPRRRL  59



>ref|XP_004503304.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cicer arietinum]
Length=317

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEEKVYGVPRRRL  59



>ref|XP_006406649.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
 gb|ESQ48102.1| hypothetical protein EUTSA_v10021128mg [Eutrema salsugineum]
Length=327

 Score = 79.7 bits (195),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +G A+RRL
Sbjct  3    EGLVLKGTMRAHTDMVTAIATPIDNSDIIVTASRDKSIILWKLTKDEKSYGYAQRRL  59



>ref|XP_010256121.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Nelumbo nucifera]
Length=314

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GTMK  +D VTAIA PIDNSD IVSSSRDKS++VW+LTK+   +GV RRRL
Sbjct  3    ETLILKGTMKGHSDMVTAIATPIDNSDMIVSSSRDKSVLVWHLTKEEGIYGVPRRRL  59



>ref|XP_007160506.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
 gb|ACV72060.1| RACK1 [Phaseolus vulgaris]
 gb|ESW32500.1| hypothetical protein PHAVU_002G327500g [Phaseolus vulgaris]
Length=324

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRL  59



>ref|XP_010923802.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score = 79.3 bits (194),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 42/66 (64%), Positives = 48/66 (73%), Gaps = 9/66 (14%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + L+LRGTM+  TD VTAIA PIDNSD IVSSSRDKS++VWNLTKD P          +G
Sbjct  3    DTLILRGTMRGHTDVVTAIATPIDNSDMIVSSSRDKSVLVWNLTKDAPLSSEGAGASSYG  62

Query  221  VARRRL  238
            V RRRL
Sbjct  63   VPRRRL  68



>gb|AGV54321.1| RACK1 [Phaseolus vulgaris]
Length=324

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRL  59



>ref|XP_010678120.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Beta vulgaris subsp. vulgaris]
Length=326

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGTM+  TD VTAIA PIDNSD IV++SRDKSIIVWNLTK+   +GV +RRL
Sbjct  3    EQLQLRGTMRAHTDMVTAIATPIDNSDMIVTASRDKSIIVWNLTKEDKIYGVPKRRL  59



>gb|KFK39137.1| guanine nucleotide-binding protein subunit beta-like protein 
[Arabis alpina]
Length=327

 Score = 79.3 bits (194),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W L KD   +GVA+RRL
Sbjct  3    EGLVLKGTMRAHTDQVTAIATPIDNSDIIVTASRDKSIILWKLNKDDKSYGVAQRRL  59



>ref|XP_008453452.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Cucumis melo]
Length=327

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GV +RRL
Sbjct  3    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIILWRLTKEEKTYGVPQRRL  59



>ref|XP_004137327.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 ref|XP_004160431.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like [Cucumis sativus]
 gb|KGN63851.1| hypothetical protein Csa_1G024830 [Cucumis sativus]
Length=327

 Score = 79.3 bits (194),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GV +RRL
Sbjct  3    EGLVLRGTMRAHTDMVTAIATPIDNSDMIVTSSRDKSIIMWRLTKEEKTYGVPQRRL  59



>ref|XP_006393380.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
 gb|ESQ30666.1| hypothetical protein EUTSA_v10011646mg [Eutrema salsugineum]
Length=327

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RRL
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDIIVTSSRDKSIILWKLTKEDKSYGVAQRRL  59



>ref|XP_009400497.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/68 (62%), Positives = 49/68 (72%), Gaps = 11/68 (16%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP-----------Q  214
            + LVLRGTM+  TD VTAIAAPIDNSD IVSSSRDKS++VW+LTKD P            
Sbjct  3    DTLVLRGTMRGHTDMVTAIAAPIDNSDMIVSSSRDKSVLVWHLTKDAPSASGDGTATGSS  62

Query  215  FGVARRRL  238
            +GV +RRL
Sbjct  63   YGVPKRRL  70



>ref|XP_010537487.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Tarenaya hassleriana]
Length=328

 Score = 79.0 bits (193),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDN+D IVSSSRDKSI++W LTKD   +GV +RRL
Sbjct  3    EGLVLKGTMRAHTDEVTAIATPIDNADIIVSSSRDKSIVLWKLTKDEKAYGVPQRRL  59



>ref|XP_010036939.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW48591.1| hypothetical protein EUGRSUZ_K02261 [Eucalyptus grandis]
Length=326

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GTM+  TD VTAIA PIDNSD +V+SSRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLILKGTMRAHTDMVTAIAIPIDNSDMVVTSSRDKSIILWHLTKEEKVYGVPRRRL  59



>ref|NP_188441.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
 sp|Q9LV28.1|GPLPC_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein C; AltName: Full=Receptor for activated C kinase 
1C [Arabidopsis thaliana]
 dbj|BAB02025.1| guanine nucleotide-binding protein; activated protein kinase 
C receptor; RACK1 [Arabidopsis thaliana]
 gb|AAK91355.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AAM26650.1| AT3g18130/MRC8_11 [Arabidopsis thaliana]
 gb|AEE76051.1| receptor for activated C kinase 1C [Arabidopsis thaliana]
Length=326

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+G M+  TD VTAIA PIDNSD IV++SRDKSII+W LTKD   +GVA+RRL
Sbjct  3    EGLVLKGIMRAHTDIVTAIATPIDNSDIIVTASRDKSIILWKLTKDDKSYGVAQRRL  59



>ref|NP_001241455.1| uncharacterized protein LOC100778205 [Glycine max]
 gb|ACU23023.1| unknown [Glycine max]
Length=325

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            LVLRGTM+  TD VTAIA PIDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  5    LVLRGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>ref|XP_010479287.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|XP_010500401.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|XP_010461692.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Camelina sativa]
Length=326

 Score = 78.6 bits (192),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA PIDNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>gb|ACJ24167.1| Rack [Phaseolus vulgaris]
Length=324

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRDKSII+W LTK+   +GV RRRL
Sbjct  3    EGLVLKGTMRAHTDVVTAIATPIDNSDMIVTASRDKSIILWQLTKEDKTYGVPRRRL  59



>ref|XP_009405003.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Musa acuminata subsp. malaccensis]
Length=324

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 41/68 (60%), Positives = 49/68 (72%), Gaps = 11/68 (16%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP-----------Q  214
            + LVLRGTM+  +D VTAIAAP+DNSD IVSSSRDKS++VW+LTKD P            
Sbjct  3    DTLVLRGTMRGHSDMVTAIAAPVDNSDMIVSSSRDKSVLVWHLTKDAPAALADGSGAGSA  62

Query  215  FGVARRRL  238
            +GV RRRL
Sbjct  63   YGVPRRRL  70



>ref|XP_010549078.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score = 78.2 bits (191),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA P+DN+D IVSSSRDKSI++W LTKD   +GV +RRL
Sbjct  3    EGLVLKGTMRAHTDAVTAIATPVDNADFIVSSSRDKSIVLWKLTKDDKSYGVPQRRL  59



>gb|AAM65407.1| guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
Length=326

 Score = 78.2 bits (191),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|XP_002894122.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH70381.1| hypothetical protein ARALYDRAFT_474002 [Arabidopsis lyrata subsp. 
lyrata]
Length=326

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|XP_010032559.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein [Eucalyptus grandis]
 gb|KCW83972.1| hypothetical protein EUGRSUZ_B00856 [Eucalyptus grandis]
Length=327

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L L+GTMK  TD VTAIA PIDN+D IV+SSRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLHLKGTMKAHTDMVTAIAVPIDNADMIVTSSRDKSIILWHLTKEDKVYGVPRRRL  59



>ref|NP_175296.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
 sp|Q9C4Z6.1|GPLPB_ARATH RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; AltName: Full=Receptor for activated C kinase 
1B [Arabidopsis thaliana]
 gb|AAG50846.1|AC074308_2 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAG60127.1|AC073555_11 guanine nucleotide-binding protein, putative [Arabidopsis thaliana]
 gb|AAL24080.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AAM14291.1| putative guanine nucleotide-binding protein [Arabidopsis thaliana]
 gb|AEE32329.1| receptor for activated C kinase 1B [Arabidopsis thaliana]
Length=326

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|XP_006305354.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
 gb|EOA38252.1| hypothetical protein CARUB_v10009733mg [Capsella rubella]
Length=326

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA P+DNSD IV+SSRDKSII+W LTK+   +GVA+RR+
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPVDNSDVIVTSSRDKSIILWKLTKEDKSYGVAQRRM  59



>ref|NP_001235369.1| guanine nucleotide-binding protein subunit beta-like protein 
[Glycine max]
 sp|Q39836.1|GBLP_SOYBN RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Glycine max]
 gb|AAB05941.1| G beta-like protein [Glycine max]
Length=325

 Score = 77.8 bits (190),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+  TD VTAIA PIDNSD IV++SRD+SII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLKGTMRAHTDVVTAIATPIDNSDMIVTASRDRSIILWHLTKEDKTYGVPRRRL  59



>pdb|3DM0|A Chain A, Maltose Binding Protein Fusion With Rack1 From A. Thaliana
Length=694

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 39/55 (71%), Positives = 46/55 (84%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            LVL+GTM+  TD VTAIA PIDN+D IVS+SRDKSII+W LTKD   +GVA+RRL
Sbjct  372  LVLKGTMRAHTDMVTAIATPIDNADIIVSASRDKSIILWKLTKDDKAYGVAQRRL  426



>ref|XP_010924141.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=323

 Score = 77.4 bits (189),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 41/66 (62%), Positives = 48/66 (73%), Gaps = 9/66 (14%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + LVLRGT++  +D VTAIA PIDNSD IVSSSRDKSI+VW+LTKD P          +G
Sbjct  3    DTLVLRGTLRGHSDMVTAIATPIDNSDMIVSSSRDKSILVWHLTKDAPLSAEGAAASSYG  62

Query  221  VARRRL  238
            V RRRL
Sbjct  63   VPRRRL  68



>gb|ACJ85009.1| unknown [Medicago truncatula]
Length=219

 Score = 76.3 bits (186),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 39/57 (68%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGTM+  TD VTAIA  IDNSD IV++SRDKSII+W+LTK+   +GV RRRL
Sbjct  3    EGLVLRGTMRAHTDVVTAIATLIDNSDMIVTASRDKSIILWHLTKEDKTYGVPRRRL  59



>ref|XP_010549077.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score = 76.6 bits (187),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/57 (65%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+   D VTAIA P+DN+D IVSSSRDKSI+VW L+KD   +GV +RRL
Sbjct  3    EGLVLKGTMRAHADAVTAIATPVDNADFIVSSSRDKSIVVWKLSKDDKSYGVPQRRL  59



>ref|XP_009145001.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Brassica rapa]
Length=327

 Score = 76.3 bits (186),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 37/55 (67%), Positives = 44/55 (80%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            LVL+GTM   TD VTAIA P+DNSD IV+SSRDKSII+W L +D   +GVA+RRL
Sbjct  5    LVLKGTMCAHTDMVTAIATPVDNSDMIVTSSRDKSIILWKLNRDEKSYGVAQRRL  59



>ref|XP_009147950.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein B [Brassica rapa]
Length=328

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 46/57 (81%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM   TD VTAIA PID+SDTIV+SSRDKSII+  LTKD   +GVA+RRL
Sbjct  3    EGLVLKGTMCAHTDMVTAIATPIDSSDTIVTSSRDKSIILXKLTKDDKSYGVAQRRL  59



>ref|XP_008812615.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Phoenix dactylifera]
Length=331

 Score = 75.9 bits (185),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 47/66 (71%), Gaps = 9/66 (14%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------QFG  220
            + L+LRGTM+  +D VT IA PIDNSD IVSSSRDKSI+VW+LTKD P          +G
Sbjct  3    DTLILRGTMRGHSDVVTGIATPIDNSDMIVSSSRDKSILVWHLTKDAPLSTDGAAASSYG  62

Query  221  VARRRL  238
            V RRRL
Sbjct  63   VPRRRL  68



>ref|XP_002529557.1| receptor for activated protein kinase C, putative [Ricinus communis]
 gb|EEF32826.1| receptor for activated protein kinase C, putative [Ricinus communis]
Length=328

 Score = 75.5 bits (184),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 38/57 (67%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L GTM+  TD VTAIA PIDNSD IV++SRDKSII+W L KD   +GVA RRL
Sbjct  3    ERLILLGTMRAHTDQVTAIATPIDNSDMIVTASRDKSIILWKLIKDEKTYGVAHRRL  59



>ref|XP_010551145.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein B [Tarenaya hassleriana]
Length=327

 Score = 75.1 bits (183),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/57 (63%), Positives = 45/57 (79%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVL+GTM+   D VTAIA P+DN+D IVSSSRDKSI++W LTK+   +GV +RRL
Sbjct  3    EGLVLKGTMRAHADAVTAIATPVDNADFIVSSSRDKSIVLWKLTKEDKSYGVPQRRL  59



>gb|ACN41093.1| unknown [Picea sitchensis]
Length=321

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK------DGPQFGVAR  229
            E LVLRGTMK   +WVT+IA PIDNSD I+S SRDKSI+VW+LTK      +G  +GVA+
Sbjct  3    ETLVLRGTMKGHDNWVTSIATPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAK  62

Query  230  RRL  238
            RRL
Sbjct  63   RRL  65



>gb|ABK25010.1| unknown [Picea sitchensis]
 gb|ACN41136.1| unknown [Picea sitchensis]
Length=321

 Score = 74.3 bits (181),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 6/63 (10%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK------DGPQFGVAR  229
            E LVLRGTMK   +WVT+IA PIDNSD I+S SRDKSI+VW+LTK      +G  +GVA+
Sbjct  3    ETLVLRGTMKGHDNWVTSIATPIDNSDMIISGSRDKSILVWHLTKETTGGEEGGTYGVAK  62

Query  230  RRL  238
            RRL
Sbjct  63   RRL  65



>ref|XP_010916329.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=324

 Score = 73.6 bits (179),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/67 (57%), Positives = 48/67 (72%), Gaps = 10/67 (15%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP----------QF  217
            E LVL+GT++  +  VTAIAAP+DNSD +VSSSRDKS++VW+LTKD P           +
Sbjct  3    ETLVLKGTLRGHSGAVTAIAAPLDNSDMVVSSSRDKSVLVWHLTKDSPAAAAGEPGGSAY  62

Query  218  GVARRRL  238
            GV RRRL
Sbjct  63   GVPRRRL  69



>ref|XP_010926201.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Elaeis guineensis]
Length=299

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 14/71 (20%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG-------------  208
            E LV +GTM+  +D VTAIA P+DNSD IVSSSRDKS++VW+LTK               
Sbjct  3    ETLVFKGTMRGHSDVVTAIATPLDNSDMIVSSSRDKSVLVWHLTKASPVAVAGDSSATSA  62

Query  209  -PQFGVARRRL  238
             P +GV RRRL
Sbjct  63   VPSYGVPRRRL  73



>ref|XP_003567944.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A [Brachypodium distachyon]
Length=333

 Score = 69.3 bits (168),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/69 (57%), Positives = 45/69 (65%), Gaps = 9/69 (13%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQ--------  214
            MAQE L L GTM+   D VTAIAAPIDN+  IVSSSRDKS++VW+LT   P         
Sbjct  1    MAQESLSLVGTMRGHNDVVTAIAAPIDNTAFIVSSSRDKSVLVWDLTNPAPSPADGTVAT  60

Query  215  -FGVARRRL  238
             +GV  RRL
Sbjct  61   DYGVPFRRL  69



>ref|XP_007508318.1| predicted protein [Bathycoccus prasinos]
 emb|CCO20422.1| predicted protein [Bathycoccus prasinos]
Length=318

 Score = 68.9 bits (167),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRG ++    WVT+IA P+DNSD +++SSRDKS+I+W LT++   +G  RRRL
Sbjct  2    ETLTLRGVLEGHEGWVTSIATPLDNSDILLTSSRDKSVILWTLTREEGNYGYPRRRL  58



>emb|CDY71917.1| BnaCnng75080D [Brassica napus]
Length=244

 Score = 67.8 bits (164),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 33/49 (67%), Positives = 38/49 (78%), Gaps = 0/49 (0%)
 Frame = +2

Query  92   MKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            M   TD VTAIA P+DNSD IV+SSRDKSII+W L KD   +GVA+RRL
Sbjct  1    MCAHTDMVTAIATPVDNSDMIVTSSRDKSIILWKLNKDEKSYGVAQRRL  49



>emb|CEG00110.1| G-protein beta WD-40 repeat [Ostreococcus tauri]
Length=319

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + LRG +K   +WVT+IA P+DNSD ++SSSRDK++I+WNLT++   +G  RR L
Sbjct  5    MQLRGVLKGHENWVTSIATPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSL  59



>ref|XP_001421096.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 ref|XP_001422858.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABO99389.1| Receptor of activated protein kinase C 1A, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
 gb|ABP01217.1| Receptor of activated protein kinase C 1B, component of 40S small 
ribosomal subunit [Ostreococcus lucimarinus CCE9901]
Length=321

 Score = 68.6 bits (166),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 42/55 (76%), Gaps = 0/55 (0%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + LRG +K   +WVT+IA P+DNSD ++SSSRDK++I+WNLT++   +G  RR L
Sbjct  5    MQLRGVLKGHENWVTSIATPLDNSDILLSSSRDKTVILWNLTREEENYGYPRRSL  59



>ref|XP_008811978.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A [Phoenix dactylifera]
Length=316

 Score = 68.2 bits (165),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP  211
            E LVL+GT++  +  VTAIAAP+DNSD IVSSSRDKS++VW+LTKD P
Sbjct  3    ETLVLKGTLRGHSGPVTAIAAPLDNSDMIVSSSRDKSVLVWHLTKDSP  50



>ref|XP_006679085.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80461.1| hypothetical protein BATDEDRAFT_33248 [Batrachochytrium dendrobatidis 
JAM81]
Length=315

 Score = 67.0 bits (162),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/57 (56%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + LVLRGT+K  T+WVTAIA   ++ DTI+S+SRDK++IVW LT+D   +GV  R L
Sbjct  3    DTLVLRGTLKGHTNWVTAIATSPESPDTILSASRDKTVIVWRLTRDDSNYGVPYRSL  59



>gb|EPZ34131.1| Guanine nucleotide-binding protein subunit beta-2-like 1 [Rozella 
allomycis CSF55]
Length=316

 Score = 66.2 bits (160),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/59 (59%), Positives = 42/59 (71%), Gaps = 4/59 (7%)
 Frame = +2

Query  74   LVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSR----DKSIIVWNLTKDGPQFGVARRRL  238
            LVLRGT++    WVTAIA P D+ D IVSSSR    DKS+IVW+LTKDG  +G  R+ L
Sbjct  5    LVLRGTLEGHDGWVTAIATPADSKDFIVSSSRVLIVDKSVIVWSLTKDGENYGKPRKSL  63



>ref|XP_004969582.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein A-like [Setaria italica]
Length=334

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 40/68 (59%), Positives = 45/68 (66%), Gaps = 9/68 (13%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK------DG---PQ  214
            AQE LVL G M+   D VTAIAAPIDNS  IVSSSRDKS++VW+LT       DG     
Sbjct  4    AQETLVLAGVMRGHNDVVTAIAAPIDNSPFIVSSSRDKSLLVWDLTNPVHVAGDGTTTAD  63

Query  215  FGVARRRL  238
            +GV  RRL
Sbjct  64   YGVPFRRL  71



>ref|XP_006644561.1| PREDICTED: LOW QUALITY PROTEIN: guanine nucleotide-binding protein 
subunit beta-like protein A-like [Oryza brachyantha]
Length=334

 Score = 66.2 bits (160),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 43/68 (63%), Gaps = 9/68 (13%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGP---------Q  214
            AQE LVL G M    D VTAIA PIDNS  IVSSSRDKS++VW+LT   P         +
Sbjct  4    AQESLVLAGVMHGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVPVVGETASATE  63

Query  215  FGVARRRL  238
            +GV  RRL
Sbjct  64   YGVPFRRL  71



>gb|EER45453.1| G-protein complex beta subunit CpcB [Histoplasma capsulatum H143]
Length=70

 Score = 62.8 bits (151),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LV RGT++    WVT++A  ++N D ++S+SRDK++I+WNLT+D   +G  +R L
Sbjct  3    EQLVHRGTLEGHNGWVTSLATSLENPDMLLSASRDKTLIIWNLTRDDTAYGYPKRSL  59



>ref|XP_005703361.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
 gb|EME26841.1| hypothetical protein Gasu_55280 [Galdieria sulphuraria]
Length=315

 Score = 65.9 bits (159),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 40/57 (70%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LV RG +K   +WVT+I  P+DNSD IVS SRD+ I++W +T++   FGV R+ L
Sbjct  3    ETLVYRGALKGHGNWVTSICTPLDNSDFIVSCSRDRKIMIWQITREEGAFGVPRKSL  59



>gb|EEC79656.1| hypothetical protein OsI_20897 [Oryza sativa Indica Group]
Length=312

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG-----------  208
             QE L L G ++   D VTAIAAPIDNS  IVSSSRDKS++VW++T              
Sbjct  3    GQESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAP  62

Query  209  PQFGVARRRL  238
            P++GV+ RRL
Sbjct  63   PEYGVSYRRL  72



>gb|EFX03206.1| g-protein beta subunit [Grosmannia clavigera kw1407]
Length=316

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++  + WVT++A  I+N + ++S SRDKS+I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHSGWVTSLATSIENPNMLLSGSRDKSLIIWNLTRDESQYGYPKRSL  59



>ref|XP_003664641.1| hypothetical protein MYCTH_2307651 [Myceliophthora thermophila 
ATCC 42464]
 gb|AEO59396.1| hypothetical protein MYCTH_2307651 [Myceliophthora thermophila 
ATCC 42464]
Length=316

 Score = 65.5 bits (158),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVTA+A  I+N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTALATSIENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_004343796.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
 gb|KJE96804.1| guanine nucleotide-binding protein [Capsaspora owczarzaki ATCC 
30864]
Length=316

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT+K  + WVT IA   +  D +VS+SRDKS+I+WNLT+D   +GV +RRL
Sbjct  3    EQLTLRGTLKGHSGWVTQIATTPEVPDLLVSASRDKSLIIWNLTRDETNYGVPKRRL  59



>ref|XP_006695086.1| putative guanine nucleotide-binding protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
 gb|EGS20201.1| putative guanine nucleotide-binding protein [Chaetomium thermophilum 
var. thermophilum DSM 1495]
Length=316

 Score = 65.1 bits (157),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +RRL
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRRL  59



>ref|XP_005652002.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
 gb|EIE27458.1| WD40 repeat-like protein [Coccomyxa subellipsoidea C-169]
Length=317

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L  RG+++    WVT+IA P+D NSDTI+SSSRDK+I+VW LT++   +G A+R L
Sbjct  3    ETLYHRGSLEGHAGWVTSIATPLDPNSDTILSSSRDKTILVWTLTREEGNYGFAKRSL  60



>ref|XP_003060952.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH54602.1| predicted protein [Micromonas pusilla CCMP1545]
Length=325

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT+K    WVT++A P+DNSD ++SSSRDK++I+W LT++   +G   R L
Sbjct  3    ESLNLRGTLKGHEGWVTSLACPLDNSDMLLSSSRDKTVILWTLTREEGNYGYPLRSL  59



>ref|NP_001056254.1| Os05g0552300 [Oryza sativa Japonica Group]
 sp|Q6L4F8.1|GBLPB_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein B; Short=GPB-LR; AltName: Full=Receptor for activated 
C kinase 1B [Oryza sativa Japonica Group]
 gb|AAT39277.1| putative guanine nucleotide-binding protein beta subunit [Oryza 
sativa Japonica Group]
 gb|AAT85192.1| putative guanine nucleotide binding protein beta subunit [Oryza 
sativa Japonica Group]
 dbj|BAF18168.1| Os05g0552300 [Oryza sativa Japonica Group]
 dbj|BAG88240.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG89443.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00554.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64615.1| hypothetical protein OsJ_19467 [Oryza sativa Japonica Group]
Length=336

 Score = 65.1 bits (157),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 44/70 (63%), Gaps = 11/70 (16%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDG-----------  208
             QE L L G ++   D VTAIAAPIDNS  IVSSSRDKS++VW++T              
Sbjct  3    GQESLTLAGVLRGHNDMVTAIAAPIDNSPFIVSSSRDKSLLVWDITNPSTAVATDPEAAP  62

Query  209  PQFGVARRRL  238
            P++GV+ RRL
Sbjct  63   PEYGVSYRRL  72



>ref|XP_003852899.1| guanine nucleotide-binding protein subunit beta-like protein 
[Zymoseptoria tritici IPO323]
 gb|EGP87875.1| hypothetical protein MYCGRDRAFT_57734 [Zymoseptoria tritici IPO323]
Length=316

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G A+R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDDTSYGFAKRSL  59



>gb|KFY05425.1| hypothetical protein V491_09140, partial [Pseudogymnoascus pannorum 
VKM F-3775]
Length=91

 Score = 62.0 bits (149),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 24/57 (42%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  3    EQLILKGTLEGHSGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDESSYGYPKRSL  59



>gb|EMS51011.1| Guanine nucleotide-binding protein subunit beta-like protein 
A [Triticum urartu]
Length=251

 Score = 63.5 bits (153),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 7/66 (11%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+   D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  63

Query  221  VARRRL  238
            V  RRL
Sbjct  64   VPFRRL  69



>ref|XP_003002475.1| G-protein beta subunit [Verticillium alfalfae VaMs.102]
 ref|XP_009657685.1| WD repeat-containing protein 5B [Verticillium dahliae VdLs.17]
 gb|EEY20936.1| G-protein beta subunit [Verticillium alfalfae VaMs.102]
 gb|EGY15522.1| WD repeat-containing protein 5B [Verticillium dahliae VdLs.17]
Length=316

 Score = 64.7 bits (156),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVL+GT++    WVT++A  I+N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LVLKGTLEGHNGWVTSLATSIENPNMLLSGSRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|EXX68230.1| Asc1p [Rhizophagus irregularis DAOM 197198w]
Length=308

 Score = 64.3 bits (155),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + L LRGT+   ++WVTAIA   +N D I+S+SRDK+IIVWNLT+D   +GV ++ L
Sbjct  3    DTLSLRGTLDGHSNWVTAIATTSENPDMILSASRDKTIIVWNLTRDETNYGVPKKSL  59



>gb|EHK42326.1| cross-pathway control WD-repeat protein cpc2 [Trichoderma atroviride 
IMI 206040]
Length=316

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++SSSRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSSSRDKTLIIWNLTRDETQYGYPKRSL  59



>gb|ABA01155.1| G protein beta subunit-like polypeptide [Chlamydomonas incerta]
Length=258

 Score = 63.5 bits (153),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LR T+K  T+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKAL  60



>ref|XP_002176069.1| RACK1 Cpc2 [Schizosaccharomyces japonicus yFS275]
 gb|EEB09776.1| RACK1 Cpc2 [Schizosaccharomyces japonicus yFS275]
Length=314

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLR T++  + WVT+++   +N D ++S SRDK+II+WNLT+D   +GVA+RRL
Sbjct  3    EQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKTIILWNLTRDDVNYGVAQRRL  59



>ref|XP_001796854.1| hypothetical protein SNOG_06484 [Phaeosphaeria nodorum SN15]
 gb|EAT86315.2| hypothetical protein SNOG_06484 [Phaeosphaeria nodorum SN15]
Length=221

 Score = 63.2 bits (152),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDETSYGYPKRSL  59



>sp|Q01369.1|GBLP_NEUCR RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein; AltName: Full=Cross-pathway control WD-repeat 
protein cpc-2 [Neurospora crassa OR74A]
 emb|CAA57460.1| CPC2 protein [Neurospora crassa]
Length=316

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +RRL
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDETSYGYPKRRL  59



>ref|NP_001043910.1| Os01g0686800 [Oryza sativa Japonica Group]
 sp|P49027.1|GBLPA_ORYSJ RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein A; Short=GPB-LR; AltName: Full=RWD; AltName: Full=Receptor 
for activated C kinase 1A [Oryza sativa Japonica 
Group]
 dbj|BAA07404.1| q group of receptor for activated C-kinase [Oryza sativa Japonica 
Group]
 dbj|BAF05824.1| Os01g0686800 [Oryza sativa Japonica Group]
 gb|EAY75412.1| hypothetical protein OsI_03315 [Oryza sativa Indica Group]
 gb|EAZ13132.1| hypothetical protein OsJ_03054 [Oryza sativa Japonica Group]
 dbj|BAG93799.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG87442.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH00562.1| unnamed protein product [Oryza sativa Japonica Group]
Length=334

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 37/68 (54%), Positives = 42/68 (62%), Gaps = 9/68 (13%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK---------DGPQ  214
            AQE LVL G M    D VTAIA PIDNS  IVSSSRDKS++VW+LT             +
Sbjct  4    AQESLVLAGVMHGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPVQNVGEGAGASE  63

Query  215  FGVARRRL  238
            +GV  RRL
Sbjct  64   YGVPFRRL  71



>gb|ESA03866.1| hypothetical protein GLOINDRAFT_336518 [Rhizophagus irregularis 
DAOM 181602]
 gb|EXX68229.1| Asc1p [Rhizophagus irregularis DAOM 197198w]
Length=315

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + L LRGT+   ++WVTAIA   +N D I+S+SRDK+IIVWNLT+D   +GV ++ L
Sbjct  3    DTLSLRGTLDGHSNWVTAIATTSENPDMILSASRDKTIIVWNLTRDETNYGVPKKSL  59



>gb|AGH70127.1| guanine nucleotide-binding protein subunit beta-2-like 1, partial 
[Placozoa sp. H4]
Length=216

 Score = 62.8 bits (151),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/60 (53%), Positives = 38/60 (63%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA E + LRGT+K    WVT IA      DTI+S+SRDKSII W LT+D   FGV  + L
Sbjct  1    MASEVISLRGTLKGHNGWVTQIATTPQYPDTILSASRDKSIIKWKLTRDEANFGVPEKSL  60



>ref|XP_960070.1| guanine nucleotide-binding protein subunit beta-like protein 
[Neurospora crassa OR74A]
 ref|XP_003351440.1| hypothetical protein SMAC_07639 [Sordaria macrospora k-hell]
 ref|XP_009853691.1| hypothetical protein NEUTE1DRAFT_117965 [Neurospora tetrasperma 
FGSC 2508]
 gb|EAA30834.1| guanine nucleotide-binding protein subunit beta-like protein 
[Neurospora crassa OR74A]
 gb|EGO55924.1| hypothetical protein NEUTE1DRAFT_117965 [Neurospora tetrasperma 
FGSC 2508]
 gb|EGZ68819.1| WD40 repeat-like protein [Neurospora tetrasperma FGSC 2509]
 emb|CCC12795.1| unnamed protein product [Sordaria macrospora k-hell]
 gb|KHE86605.1| hypothetical protein GE21DRAFT_10684 [Neurospora crassa]
Length=316

 Score = 64.3 bits (155),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +RRL
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDETSYGYPKRRL  59



>ref|XP_007783846.1| guanine nucleotide-binding protein subunit beta-like protein 
[Coniosporium apollinis CBS 100218]
 gb|EON68529.1| guanine nucleotide-binding protein subunit beta-like protein 
[Coniosporium apollinis CBS 100218]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = +2

Query  65   QECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
             E L+LRGT++  + WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  2    SETLILRGTLEGHSGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDESSYGYPKRSL  59



>ref|XP_007799385.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Eutypa lata UCREL1]
 gb|EMR61524.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Eutypa lata UCREL1]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  I+N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSIENPNMLLSGSRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|EMT31237.1| hypothetical protein F775_29537 [Aegilops tauschii]
Length=301

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 7/66 (11%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+   D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  63

Query  221  VARRRL  238
            V  RRL
Sbjct  64   VPFRRL  69



>gb|KEY66722.1| hypothetical protein S7711_06770 [Stachybotrys chartarum IBT 
7711]
 gb|KFA47216.1| hypothetical protein S40293_06701 [Stachybotrys chartarum IBT 
40293]
 gb|KFA70734.1| hypothetical protein S40288_08879 [Stachybotrys chartarum IBT 
40288]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 44/57 (77%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++  + WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHSGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>ref|XP_007925889.1| G protein beta subunit [Pseudocercospora fijiensis CIRAD86]
 gb|EME82846.1| G protein beta subunit [Pseudocercospora fijiensis CIRAD86]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDETSYGYPKRSL  59



>gb|KEZ40620.1| hypothetical protein SAPIO_CDS8541 [Scedosporium apiospermum]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  I+N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSIENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRSL  59



>gb|ABA01128.1| G protein beta subunit-like polypeptide, partial [Chlamydomonas 
incerta]
Length=278

 Score = 63.2 bits (152),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LR T+K  T+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKAL  60



>gb|EME46889.1| hypothetical protein DOTSEDRAFT_70743 [Dothistroma septosporum 
NZE10]
Length=316

 Score = 63.9 bits (154),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDDTSYGYPKRSL  59



>ref|XP_002777402.1| receptor for activated protein kinase C, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER09218.1| receptor for activated protein kinase C, putative [Perkinsus 
marinus ATCC 50983]
Length=174

 Score = 62.0 bits (149),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE L  RG ++  TDWVT+IA   ++   +VS SRDK I++W LT D    G  RR L
Sbjct  1    MAQEHLQFRGVLQGHTDWVTSIATTYEDPKMVVSGSRDKKIMIWELTNDSESAGYPRRSL  60



>ref|XP_007807134.1| G-protein beta subunit [Metarhizium acridum CQMa 102]
 gb|EFY93011.1| G-protein beta subunit [Metarhizium acridum CQMa 102]
Length=279

 Score = 63.2 bits (152),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_002967499.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
 gb|EFJ32098.1| hypothetical protein SELMODRAFT_144795 [Selaginella moellendorffii]
Length=315

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLT-KDGPQ--FGVARRRL  238
            + LV +G M+  TDWVTAIA P+DNSD I+S+SRDKS+++WN   KD  +  FG+ +RRL
Sbjct  3    DSLVSKGRMEGHTDWVTAIATPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRL  62



>emb|CDM83867.1| unnamed protein product [Triticum aestivum]
Length=332

 Score = 63.9 bits (154),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 7/66 (11%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+   D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDSSSEYG  63

Query  221  VARRRL  238
            V  RRL
Sbjct  64   VPFRRL  69



>ref|XP_002960209.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
 gb|EFJ37748.1| hypothetical protein SELMODRAFT_266532 [Selaginella moellendorffii]
Length=310

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 33/60 (55%), Positives = 45/60 (75%), Gaps = 3/60 (5%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLT-KDGPQ--FGVARRRL  238
            + LV +G M+  TDWVTAIA P+DNSD I+S+SRDKS+++WN   KD  +  FG+ +RRL
Sbjct  3    DSLVSKGRMEGHTDWVTAIATPVDNSDIILSASRDKSVLLWNTQHKDLTEQDFGLPQRRL  62



>ref|XP_007839961.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Pestalotiopsis fici W106-1]
 gb|ETS74705.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Pestalotiopsis fici W106-1]
Length=316

 Score = 63.5 bits (153),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|ENH83707.1| g-protein beta subunit [Colletotrichum orbiculare MAFF 240422]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>ref|XP_001239490.1| hypothetical protein CIMG_09111 [Coccidioides immitis RS]
 ref|XP_003067082.1| guanine nucleotide-binding protein beta subunit, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EER24937.1| guanine nucleotide-binding protein beta subunit, putative [Coccidioides 
posadasii C735 delta SOWgp]
 gb|EFW19263.1| guanine nucleotide binding protein [Coccidioides posadasii str. 
Silveira]
 gb|EAS27907.3| guanine nucleotide-binding protein subunit beta-like protein 
[Coccidioides immitis RS]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVTA+A  ++N + ++S+SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTALATSMENPNMLLSASRDKTLIIWNLTRDETAYGYPKRSL  59



>ref|NP_593770.1| 40S ribosomal protein cpc2/RACK1 [Schizosaccharomyces pombe 972h-]
 sp|Q10281.3|GBLP_SCHPO RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein; AltName: Full=Receptor of activated protein kinase 
C [Schizosaccharomyces pombe 972h-]
 emb|CAB11079.1| RACK1 ortholog Cpc2 [Schizosaccharomyces pombe]
Length=314

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLR T++  + WVT+++   +N D ++S SRDKSII+WNL +D   +GVA+RRL
Sbjct  3    EQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKSIILWNLVRDDVNYGVAQRRL  59



>ref|XP_001698065.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
 sp|P25387.1|GBLP_CHLRE RecName: Full=Guanine nucleotide-binding protein subunit beta-like 
protein [Chlamydomonas reinhardtii]
 emb|CAA37638.1| putative protein has homology to G protein beta subunit [Chlamydomonas 
reinhardtii]
 gb|EDO99650.1| receptor of activated protein kinase C 1 [Chlamydomonas reinhardtii]
Length=318

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 43/58 (74%), Gaps = 1/58 (2%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPID-NSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LR T+K  T+WVTAIA P+D +S+T++S+SRDKS++VW L +    +G AR+ L
Sbjct  3    ETLTLRATLKGHTNWVTAIATPLDPSSNTLLSASRDKSVLVWELERSESNYGYARKAL  60



>ref|XP_007602725.1| guanine nucleotide-binding protein subunit beta-like protein 
[Colletotrichum fioriniae PJ7]
 gb|EFQ34054.1| WD domain-containing protein [Colletotrichum graminicola M1.001]
 emb|CCF37228.1| guanine nucleotide-binding protein subunit beta-like protein 
[Colletotrichum higginsianum]
 gb|EXF73633.1| guanine nucleotide-binding protein subunit beta-like protein 
[Colletotrichum fioriniae PJ7]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|KID66925.1| G-protein beta subunit, partial [Metarhizium brunneum ARSEF 3297]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>emb|CCT69414.1| probable CPC2 protein [Fusarium fujikuroi IMI 58289]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|EQB48545.1| hypothetical protein CGLO_12231 [Colletotrichum gloeosporioides 
Cg-14]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDESQYGYPKRSL  59



>gb|EYE92822.1| GBLP_NEUCR guanine nucleotide-binding protein beta subunit-like 
protein [Aspergillus ruber CBS 135680]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDEQAYGYPKRSL  59



>gb|KGK37600.1| hypothetical protein JL09_g3231 [Pichia kudriavzevii]
Length=178

 Score = 62.0 bits (149),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGT++    WVT+++    N D ++S SRDK++IVW LT+D  Q+G+A++ L
Sbjct  6    EVLVLRGTLEGHNGWVTSLSTCAANPDLLLSGSRDKTLIVWQLTRDENQYGIAKKAL  62



>gb|ABD49712.1| G-protein beta subunit [Metarhizium anisopliae]
Length=316

 Score = 63.5 bits (153),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>gb|EXU98607.1| WD40 domain protein [Metarhizium robertsii]
 gb|KFG77858.1| G-protein beta subunit [Metarhizium anisopliae]
 gb|KID61577.1| G-protein beta subunit, partial [Metarhizium anisopliae ARSEF 
549]
 gb|KID83408.1| G-protein beta subunit [Metarhizium guizhouense ARSEF 977]
 gb|KID97217.1| G-protein beta subunit, partial [Metarhizium majus ARSEF 297]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_001631784.1| predicted protein [Nematostella vectensis]
 gb|EDO39721.1| predicted protein [Nematostella vectensis]
Length=315

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT+K    WVT IA    N DTI+SSSRDK +IVW LT+D   +G A++ L
Sbjct  3    EQLSLRGTLKGHNGWVTQIATNPSNPDTILSSSRDKKLIVWELTRDDANYGFAKKSL  59



>gb|KIL96127.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium avenaceum]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>gb|KFH46842.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Acremonium chrysogenum ATCC 11550]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>emb|CEJ92213.1| Putative Pc22g03140 protein [Torrubiella hemipterigena]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_009261603.1| FGB1 [Fusarium pseudograminearum CS3096]
 ref|XP_011318772.1| hypothetical protein FGSG_09870 [Fusarium graminearum PH-1]
 gb|EKJ69615.1| FGB1 [Fusarium pseudograminearum CS3096]
 gb|ESU16510.1| hypothetical protein FGSG_09870 [Fusarium graminearum PH-1]
 gb|EYB22203.1| hypothetical protein FG05_09870 [Fusarium graminearum]
 emb|CEF75165.1| unnamed protein product [Fusarium graminearum]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>dbj|BAD44728.1| G-protein beta like WD repeat protein [Fusarium oxysporum]
 gb|EMT63782.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. cubense race 4]
 gb|ENH62763.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. cubense race 1]
 gb|EWG39980.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium verticillioides 7600]
 gb|EWY91209.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum FOSC 3-a]
 gb|EWZ37815.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum Fo47]
 gb|EWZ89523.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. lycopersici MN25]
 gb|EXA45416.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. pisi HDV247]
 gb|EXK39870.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. melonis 26406]
 gb|EXK91365.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. raphani 54005]
 gb|EXL57288.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. radicis-lycopersici 26381]
 gb|EXL84460.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. conglutinans race 2 54008]
 gb|EXM01233.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. cubense tropical race 4 54006]
 gb|EXM32255.1| guanine nucleotide-binding protein subunit beta-like protein 
[Fusarium oxysporum f. sp. vasinfectum 25433]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_001226350.1| guanine nucleotide-binding protein beta subunit-like protein 
[Chaetomium globosum CBS 148.51]
 gb|EAQ84409.1| guanine nucleotide-binding protein beta subunit-like protein 
[Chaetomium globosum CBS 148.51]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>gb|KEQ62286.1| WD40 repeat-like protein [Aureobasidium melanogenum CBS 110374]
 gb|KEQ76655.1| WD40 repeat-like protein [Aureobasidium pullulans var. namibiae 
CBS 147.97]
 gb|KEQ85910.1| WD40 repeat-like protein [Aureobasidium pullulans EXF-150]
 gb|KEQ92473.1| hypothetical protein AUEXF2481DRAFT_420204 [Aureobasidium subglaciale 
EXF-2481]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S+SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSASRDKTLIIWNLTRDETSYGYPKRSL  59



>ref|XP_007582921.1| putative g-protein comlpex beta subunit protein [Neofusicoccum 
parvum UCRNP2]
 gb|EOD49614.1| putative g-protein comlpex beta subunit protein [Neofusicoccum 
parvum UCRNP2]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDEQAYGYPKRSL  59



>gb|EMF14147.1| WD repeat-containing protein 51A [Sphaerulina musiva SO2202]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIVWNLTRDETSYGYPKRSL  59



>dbj|BAJ98167.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=332

 Score = 63.5 bits (153),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 36/66 (55%), Positives = 42/66 (64%), Gaps = 7/66 (11%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTK-------DGPQFG  220
            AQE LV  G M+   D VTAIA PIDNS  IVSSSRDKS++VW+LT           ++G
Sbjct  4    AQESLVYAGVMRGHNDVVTAIATPIDNSPFIVSSSRDKSLLVWDLTNPIQATQDTSSEYG  63

Query  221  VARRRL  238
            V  RRL
Sbjct  64   VPFRRL  69



>ref|XP_007824428.1| WD40 repeat 2 [Metarhizium robertsii ARSEF 23]
 gb|EFY96327.1| WD40 repeat 2 [Metarhizium robertsii ARSEF 23]
Length=316

 Score = 63.2 bits (152),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_001903663.1| hypothetical protein [Podospora anserina S mat+]
 emb|CAP61438.1| unnamed protein product [Podospora anserina S mat+]
 emb|CDP27792.1| Putative Guanine nucleotide-binding protein [Podospora anserina 
S mat+]
Length=316

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 46/60 (77%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSASRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_008600266.1| WD domain-containing protein [Beauveria bassiana ARSEF 2860]
 gb|EJP64243.1| WD domain-containing protein [Beauveria bassiana ARSEF 2860]
Length=318

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT+K    WVT++A  ++N + ++S SRDK++I+WNLT+D  ++G  +R L
Sbjct  1    MAEQ-LILKGTLKGHNGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDETEYGYPKRSL  59



>gb|EPX70722.1| RACK1 Cpc2 [Schizosaccharomyces octosporus yFS286]
 gb|EPY51883.1| RACK1 Cpc2 [Schizosaccharomyces cryophilus OY26]
Length=314

 Score = 63.2 bits (152),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLR T++  + WVT+++   +N D ++S SRDKSII+WNL +D   +G+A+RRL
Sbjct  3    EQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKSIILWNLVRDDMNYGIAQRRL  59



>ref|XP_002779700.1| receptor for activated protein kinase C, putative [Perkinsus 
marinus ATCC 50983]
 gb|EER11495.1| receptor for activated protein kinase C, putative [Perkinsus 
marinus ATCC 50983]
Length=218

 Score = 61.6 bits (148),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 37/60 (62%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE L  RG ++  TDWVT+IA   ++   +VS SRDK I++W LT D    G  RR L
Sbjct  1    MAQEHLQFRGVLQGHTDWVTSIATTYEDPKMVVSGSRDKKIMIWELTNDSESAGYPRRSL  60



>ref|XP_008202084.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Nasonia vitripennis]
Length=107

 Score = 60.8 bits (146),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT++    WVT IA      D I+SSSRDK++IVW LT+D   +GV ++RL
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGVPQKRL  59



>emb|CEP13972.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 30/57 (53%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + L LRGT++   +WVTAIA   +  D ++S+SRDKSIIVWNLT+D   +GV R+ L
Sbjct  2    DTLTLRGTLEGHGNWVTAIATTSEAPDMVLSASRDKSIIVWNLTRDELNYGVPRKSL  58



>gb|EQK99976.1| cross-pathway control WD-repeat protein cpc2 [Ophiocordyceps 
sinensis CO18]
Length=316

 Score = 63.2 bits (152),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDESQYGYPKRSL  59



>ref|XP_003176836.1| G-protein comlpex beta subunit CpcB [Microsporum gypseum CBS 
118893]
 ref|XP_003238796.1| guanine nucleotide-binding protein beta subunit [Trichophyton 
rubrum CBS 118892]
 gb|EFQ97884.1| G-protein comlpex beta subunit CpcB [Microsporum gypseum CBS 
118893]
 gb|EGD84505.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 118892]
 gb|EGD94801.1| G-protein comlpex beta subunit CpcB [Trichophyton tonsurans CBS 
112818]
 gb|EGE02059.1| receptor for activated PKC [Trichophyton equinum CBS 127.97]
 gb|EZF10554.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum MR850]
 gb|EZF32416.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton interdigitale H6]
 gb|EZF37424.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 100081]
 gb|EZF48121.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 288.86]
 gb|EZF58676.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 289.86]
 gb|EZF69279.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton soudanense CBS 452.61]
 gb|EZF79974.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum MR1448]
 gb|EZF90639.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum MR1459]
 gb|EZG01691.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 735.88]
 gb|EZG12250.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum CBS 202.88]
 gb|KDB22274.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton interdigitale MR816]
 gb|KDB29169.1| guanine nucleotide-binding protein subunit beta-like protein 
[Trichophyton rubrum D6]
Length=316

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S+SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLQGHNGWVTSLATTLENPNMLLSASRDKTLIVWNLTRDDTAYGYPKRSL  59



>ref|XP_006665983.1| guanine nucleotide-binding protein beta subunit-like protein 
[Cordyceps militaris CM01]
 gb|EGX96106.1| guanine nucleotide-binding protein beta subunit-like protein 
[Cordyceps militaris CM01]
Length=318

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT+K    WVT++A  ++N + ++S SRDK++I+WNLT+D  ++G  +R L
Sbjct  1    MAEQ-LILKGTLKGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETEYGYPKRSL  59



>ref|XP_002850965.1| G-protein complex beta subunit CpcB [Arthroderma otae CBS 113480]
 gb|EEQ28181.1| G-protein complex beta subunit CpcB [Arthroderma otae CBS 113480]
Length=316

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S+SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLQGHNGWVTSLATTLENPNMLLSASRDKTLIVWNLTRDDTAYGYPKRSL  59



>gb|EHK21487.1| cross-pathway control WD-repeat protein cpc2 [Trichoderma virens 
Gv29-8]
Length=316

 Score = 62.8 bits (151),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_001932022.1| WD repeat containing protein 51A [Pyrenophora tritici-repentis 
Pt-1C-BFP]
 gb|EDU41127.1| WD repeat containing protein 51A [Pyrenophora tritici-repentis 
Pt-1C-BFP]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDETSYGYPKRSL  59



>gb|KHJ35931.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Erysiphe necator]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++  + WVT++A  ++N D ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  3    EQLILKGTLEGHSGWVTSLATSLENPDMLLSGSRDKTLIIWNLTRDESSYGYPKRSL  59



>ref|XP_008020415.1| hypothetical protein SETTUDRAFT_85587 [Setosphaeria turcica Et28A]
 gb|EOA91576.1| hypothetical protein SETTUDRAFT_85587 [Setosphaeria turcica Et28A]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDETSYGYPKRSL  59



>ref|XP_003301795.1| hypothetical protein PTT_13386 [Pyrenophora teres f. teres 0-1]
 ref|XP_003837489.1| similar to guanine nucleotide-binding protein subunit beta-2-like 
1 [Leptosphaeria maculans JN3]
 ref|XP_007684284.1| hypothetical protein COCMIDRAFT_2059 [Bipolaris oryzae ATCC 44560]
 ref|XP_007695368.1| hypothetical protein COCSADRAFT_22774 [Bipolaris sorokiniana 
ND90Pr]
 ref|XP_007708950.1| hypothetical protein COCCADRAFT_87357 [Bipolaris zeicola 26-R-13]
 gb|EFQ90102.1| hypothetical protein PTT_13386 [Pyrenophora teres f. teres 0-1]
 emb|CBX94049.1| similar to guanine nucleotide-binding protein subunit beta-2-like 
1 [Leptosphaeria maculans JN3]
 gb|EMD68324.1| hypothetical protein COCSADRAFT_22774 [Bipolaris sorokiniana 
ND90Pr]
 gb|EMD93669.1| hypothetical protein COCHEDRAFT_1223343 [Bipolaris maydis C5]
 gb|ENH98807.1| hypothetical protein COCC4DRAFT_76953 [Bipolaris maydis ATCC 
48331]
 gb|EUC36719.1| hypothetical protein COCCADRAFT_87357 [Bipolaris zeicola 26-R-13]
 gb|EUC49202.1| hypothetical protein COCMIDRAFT_2059 [Bipolaris oryzae ATCC 44560]
 gb|EUN27615.1| hypothetical protein COCVIDRAFT_37322 [Bipolaris victoriae FI3]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDETSYGYPKRSL  59



>ref|XP_002481861.1| G-protein complex beta subunit CpcB [Talaromyces stipitatus ATCC 
10500]
 gb|EED17869.1| G-protein complex beta subunit CpcB [Talaromyces stipitatus ATCC 
10500]
 dbj|GAM36291.1| cytoplasm protein [Talaromyces cellulolyticus]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+LRGT++    WVT++A  ++N + ++S+SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LILRGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIVWNLTRDDQAYGYPKRSL  59



>ref|XP_006962578.1| cross-pathway control WD-repeat-containing protein [Trichoderma 
reesei QM6a]
 gb|EGR51292.1| cross-pathway control WD-repeat-containing protein [Trichoderma 
reesei QM6a]
 gb|ETS04291.1| WD domain-containing protein [Trichoderma reesei RUT C-30]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_007915760.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Togninia minima UCRPA7]
 gb|EON99443.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Togninia minima UCRPA7]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDESQYGYPKRSL  59



>ref|XP_003651077.1| hypothetical protein THITE_2169762 [Thielavia terrestris NRRL 
8126]
 gb|AEO64741.1| hypothetical protein THITE_2169762 [Thielavia terrestris NRRL 
8126]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRSL  59



>ref|XP_003051079.1| predicted protein [Nectria haematococca mpVI 77-13-4]
 gb|EEU45366.1| predicted protein [Nectria haematococca mpVI 77-13-4]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++S SRDK++I+WNLT+D  Q+G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSGSRDKTLIIWNLTRDETQYGYPKRSL  59



>emb|CBN79872.2| guanine nucleotide binding protein beta polypeptide 2-like 1 
(Partial) [Ectocarpus siliculosus]
Length=206

 Score = 61.2 bits (147),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 31/57 (54%), Positives = 36/57 (63%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L  RG +    DWVT+IAA  +N D IVSSSRDKSIIVW L +   Q+G   R L
Sbjct  3    EQLKFRGQLVAHEDWVTSIAATSENPDMIVSSSRDKSIIVWKLQRGEDQYGYPHRSL  59



>ref|XP_003014052.1| vegetative incompatibility WD repeat protein, putative [Arthroderma 
benhamiae CBS 112371]
 ref|XP_003022946.1| vegetative incompatibility WD repeat protein, putative [Trichophyton 
verrucosum HKI 0517]
 gb|EFE33412.1| vegetative incompatibility WD repeat protein, putative [Arthroderma 
benhamiae CBS 112371]
 gb|EFE42328.1| vegetative incompatibility WD repeat protein, putative [Trichophyton 
verrucosum HKI 0517]
Length=334

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S+SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLQGHNGWVTSLATTLENPNMLLSASRDKTLIVWNLTRDDTAYGYPKRSL  59



>dbj|GAM85656.1| hypothetical protein ANO11243_036630 [fungal sp. No.11243]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++  + WVT++A   +N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHSGWVTSLATSAENPNMLLSGSRDKSLIIWNLTRDDTSYGYPKRSL  59



>emb|CDM37037.1| Guanine nucleotide-binding protein subunit beta-like protein 
[Penicillium roqueforti FM164]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIIWNLTRDEQAYGYPKRSL  59



>ref|XP_002456166.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
 gb|EES01286.1| hypothetical protein SORBIDRAFT_03g031520 [Sorghum bicolor]
Length=332

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/68 (56%), Positives = 43/68 (63%), Gaps = 9/68 (13%)
 Frame = +2

Query  62   AQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNL------TKDG---PQ  214
            AQE LVL G M+     VTAIA PIDNSD IVSSSRDKS++VW+L        DG     
Sbjct  4    AQETLVLAGVMRGHNGVVTAIATPIDNSDLIVSSSRDKSLLVWDLRNPVQAAGDGTTTAD  63

Query  215  FGVARRRL  238
            +GV  RRL
Sbjct  64   YGVPLRRL  71



>gb|AAK38633.1|AF320333_1 G protein beta subunit-like protein Rkp1 [Schizosaccharomyces 
pombe]
 gb|AAA56865.2| guanine nucleotide regulatory protein [Schizosaccharomyces pombe]
Length=314

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 42/57 (74%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLR T++  + WVT+++   +N D ++S SRDKSI++WNL +D   +GVA+RRL
Sbjct  3    EQLVLRATLEGHSGWVTSLSTAPENPDILLSGSRDKSILLWNLVRDDVNYGVAQRRL  59



>ref|XP_002564357.1| Pc22g03140 [Penicillium rubens Wisconsin 54-1255]
 emb|CAP97602.1| Pc22g03140 [Penicillium rubens Wisconsin 54-1255]
 gb|EKV07118.1| G-protein comlpex beta subunit CpcB [Penicillium digitatum PHI26]
 gb|EKV14263.1| G-protein comlpex beta subunit CpcB [Penicillium digitatum Pd1]
 gb|KGO37720.1| hypothetical protein PEXP_077360 [Penicillium expansum]
 gb|KGO49929.1| hypothetical protein PEX2_105630 [Penicillium expansum]
 gb|KGO64190.1| hypothetical protein PITC_086860 [Penicillium italicum]
 gb|KGO65530.1| hypothetical protein PEX1_079520 [Penicillium expansum]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S+SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIIWNLTRDEQAYGYPKRSL  59



>ref|XP_009065209.1| hypothetical protein LOTGIDRAFT_184120 [Lottia gigantea]
 gb|ESO84081.1| hypothetical protein LOTGIDRAFT_184120 [Lottia gigantea]
Length=317

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MAQE + LRGT+   + WVT IA      DT++S+SRDK++I+W LTKD   +G+A + L
Sbjct  1    MAQEQMTLRGTLTGHSGWVTQIATNPGFPDTLLSASRDKTLILWKLTKDETNYGIAHKSL  60



>ref|XP_011334835.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Cerapachys biroi]
Length=107

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT++    WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL
Sbjct  3    ESLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRL  59



>ref|XP_002147691.1| G-protein comlpex beta subunit CpcB [Talaromyces marneffei ATCC 
18224]
 gb|ACB30372.1| G-protein complex beta subunit CpcB [Talaromyces marneffei]
 gb|EEA24180.1| G-protein comlpex beta subunit CpcB [Talaromyces marneffei ATCC 
18224]
Length=316

 Score = 62.8 bits (151),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+LRGT++    WVT++A  ++N + ++S+SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LILRGTLEGHNGWVTSLATSLENPNMLLSASRDKTLIVWNLTRDDQAYGYPKRSL  59



>gb|ERS97367.1| guanine nucleotide-binding protein subunit beta-like protein 
[Sporothrix schenckii ATCC 58251]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 25/57 (44%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L+L+GT++  + WVT++A  I+N + ++S SRDK++I+W+LT+D  Q+G  +R L
Sbjct  3    EQLILKGTLEGHSGWVTSLATSIENPNMLLSGSRDKTLIIWDLTRDEAQYGYPKRSL  59



>gb|KIV99542.1| guanine nucleotide-binding protein subunit beta-like protein 
[Verruconis gallopava]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 43/57 (75%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E LVLRGT++  + WVTA+A  ++N + ++S+SRDK++I+W+LT+D   +G  +R L
Sbjct  3    EQLVLRGTLEGHSGWVTALATSLENPNMLLSASRDKTLIIWDLTRDETSYGYPKRSL  59



>ref|XP_006620959.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein-like isoform X2 [Apis dorsata]
 ref|XP_011049913.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Acromyrmex echinatior]
 ref|XP_011145381.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Harpegnathos saltator]
 ref|XP_011155979.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Solenopsis invicta]
Length=107

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT++    WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRL  59



>ref|XP_011259053.1| PREDICTED: guanine nucleotide-binding protein subunit beta-like 
protein isoform X2 [Camponotus floridanus]
Length=107

 Score = 60.1 bits (144),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            E L LRGT++    WVT IA      D I+SSSRDK++IVW LT+D   +G+ ++RL
Sbjct  3    ETLQLRGTLRGHNGWVTQIATNPKYPDMILSSSRDKTLIVWKLTRDEANYGIPQKRL  59



>emb|CEP08121.1| hypothetical protein [Parasitella parasitica]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 29/57 (51%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = +2

Query  68   ECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            + L LRGT++   +WVTAIA   +  D ++S+SRDKS+IVWNLT+D   +GV R+ L
Sbjct  2    DTLTLRGTLEGHGNWVTAIATTSEAPDMVLSASRDKSVIVWNLTRDELNYGVPRKSL  58



>ref|XP_661767.1| GBLP_NEUCR Guanine nucleotide-binding protein beta subunit-like 
protein (Cross-pathway control WD-repeat protein cpc-2) [Aspergillus 
nidulans FGSC A4]
 gb|AAF98065.1|AF176775_1 Gbeta like protein [Aspergillus nidulans]
 gb|EAA59424.1| GBLP_NEUCR Guanine nucleotide-binding protein beta subunit-like 
protein (Cross-pathway control WD-repeat protein cpc-2) [Aspergillus 
nidulans FGSC A4]
 tpe|CBF74576.1| TPA: GBLP_NEUCR Guanine nucleotide-binding protein beta subunit-like 
protein (Cross-pathway control WD-repeat protein cpc-2)Gbeta 
like protein ; [Source:UniProtKB/TrEMBL;Acc:Q9HGV7] 
[Aspergillus nidulans FGSC A4]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDEQAYGYPKRSL  59



>gb|ABS18779.1| putative WD40 protein [Rusavskia elegans]
Length=316

 Score = 62.4 bits (150),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LV+RGT++  + WVT++A  ++N + ++S SRDK++IVWNLT+D   +G  +R L
Sbjct  1    MAEQ-LVMRGTLEGHSRWVTSLATSLENPNMLLSGSRDKTLIVWNLTRDDQNYGYPKRSL  59



>ref|XP_001816748.1| guanine nucleotide-binding protein subunit beta-like protein 
[Aspergillus oryzae RIB40]
 ref|XP_002383324.1| G-protein complex beta subunit CpcB [Aspergillus flavus NRRL3357]
 dbj|BAE54746.1| unnamed protein product [Aspergillus oryzae RIB40]
 gb|EED47144.1| G-protein complex beta subunit CpcB [Aspergillus flavus NRRL3357]
 gb|EIT79280.1| G protein beta subunit-like protein [Aspergillus oryzae 3.042]
 gb|KDE83818.1| G protein [Aspergillus oryzae 100-8]
Length=316

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDEQAYGYPKRSL  59



>ref|XP_001551314.1| guanine nucleotide-binding protein beta subunit [Botrytis cinerea 
B05.10]
 ref|XP_001598811.1| hypothetical protein SS1G_00900 [Sclerotinia sclerotiorum 1980]
 gb|EDN91497.1| hypothetical protein SS1G_00900 [Sclerotinia sclerotiorum 1980 
UF-70]
 emb|CCD44166.1| BcGBL1, heterotrimeric Gbeta-like protein [Botrytis cinerea T4]
 gb|EMR87116.1| putative guanine nucleotide-binding protein subunit beta-like 
protein [Botrytis cinerea BcDW1]
Length=316

 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++  + WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LILKGTLEGHSGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDETSYGYPKRSL  59



>gb|EPS33376.1| hypothetical protein PDE_08338 [Penicillium oxalicum 114-2]
Length=316

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDEQAYGYPKRSL  59



>gb|EKG14448.1| hypothetical protein MPH_08297 [Macrophomina phaseolina MS6]
Length=316

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/60 (45%), Positives = 44/60 (73%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ LVLRGT++    WVT++A  ++N + ++S SRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LVLRGTLEGHNGWVTSLATSLENPNMLLSGSRDKTLIIWNLTRDEQAYGYPKRSL  59



>ref|XP_003710816.1| guanine nucleotide-binding protein subunit beta-like protein 
[Magnaporthe oryzae 70-15]
 gb|EHA58204.1| guanine nucleotide-binding protein subunit beta-like protein 
[Magnaporthe oryzae 70-15]
 gb|ELQ34650.1| WD repeat-containing protein 38 [Magnaporthe oryzae Y34]
 gb|ELQ59309.1| WD repeat-containing protein 38 [Magnaporthe oryzae P131]
Length=316

 Score = 62.0 bits (149),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++    WVT++A  ++N + ++SSSRDK++I+WNLT+D   +G  +R L
Sbjct  1    MAEQ-LILKGTLEGHNGWVTSLATSMENPNMLLSSSRDKTLIIWNLTRDETSYGYPKRSL  59



>gb|ESZ90478.1| g-protein beta subunit [Sclerotinia borealis F-4157]
Length=410

 Score = 62.8 bits (151),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/60 (43%), Positives = 45/60 (75%), Gaps = 1/60 (2%)
 Frame = +2

Query  59   MAQECLVLRGTMKXXTDWVTAIAAPIDNSDTIVSSSRDKSIIVWNLTKDGPQFGVARRRL  238
            MA++ L+L+GT++  + WVT++A  ++N + ++S SRDKS+I+WNLT+D   +G  +R L
Sbjct  95   MAEQ-LILKGTLEGHSGWVTSLATSLENPNMLLSGSRDKSLIIWNLTRDESNYGYPKRSL  153



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561347857865