BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B08

Length=455
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009590601.1|  PREDICTED: pollen-specific protein SF3-like        260   3e-85   Nicotiana tomentosiformis
ref|XP_009803543.1|  PREDICTED: pollen-specific protein SF3-like        259   3e-85   Nicotiana sylvestris
ref|XP_010322559.1|  PREDICTED: LIM domain-containing protein WLIM1     253   8e-83   
ref|XP_009610584.1|  PREDICTED: pollen-specific protein SF3-like ...    253   2e-82   Nicotiana tomentosiformis
gb|KDP31140.1|  hypothetical protein JCGZ_11516                         251   1e-81   Jatropha curcas
ref|XP_002511450.1|  Pollen-specific protein SF3, putative              249   3e-81   Ricinus communis
emb|CDP17006.1|  unnamed protein product                                249   4e-81   Coffea canephora [robusta coffee]
ref|XP_010272036.1|  PREDICTED: LIM domain-containing protein WLI...    249   5e-81   Nelumbo nucifera [Indian lotus]
ref|XP_009610583.1|  PREDICTED: pollen-specific protein SF3-like ...    248   1e-80   Nicotiana tomentosiformis
ref|XP_004299580.1|  PREDICTED: LIM domain-containing protein WLI...    248   2e-80   Fragaria vesca subsp. vesca
gb|AAX95760.2|  Pollen-specific protein SF3, putative                   248   2e-80   Solanum lycopersicum
ref|XP_002283525.1|  PREDICTED: LIM domain-containing protein WLIM1     247   2e-80   Vitis vinifera
ref|XP_009786244.1|  PREDICTED: pollen-specific protein SF3-like        247   2e-80   Nicotiana sylvestris
ref|XP_010111544.1|  Pollen-specific protein SF3                        247   6e-80   Morus notabilis
ref|XP_007138113.1|  hypothetical protein PHAVU_009G181200g             245   1e-79   Phaseolus vulgaris [French bean]
ref|XP_006439752.1|  hypothetical protein CICLE_v10022413mg             245   1e-79   Citrus clementina [clementine]
ref|XP_010254782.1|  PREDICTED: LIM domain-containing protein WLI...    245   2e-79   Nelumbo nucifera [Indian lotus]
ref|XP_011087164.1|  PREDICTED: LIM domain-containing protein WLI...    244   5e-79   Sesamum indicum [beniseed]
ref|XP_011028613.1|  PREDICTED: LIM domain-containing protein WLI...    243   9e-79   Populus euphratica
ref|XP_007209651.1|  hypothetical protein PRUPE_ppa012024mg             243   9e-79   Prunus persica
ref|XP_008393059.1|  PREDICTED: pollen-specific protein SF3-like        243   1e-78   
gb|KHG14633.1|  Pollen-specific SF3                                     243   1e-78   Gossypium arboreum [tree cotton]
gb|AII80542.1|  LIM-domain protein 8                                    243   2e-78   Gossypium hirsutum [American cotton]
ref|XP_008374471.1|  PREDICTED: pollen-specific protein SF3-like        242   4e-78   
gb|KHN16307.1|  Pollen-specific protein SF3                             242   4e-78   Glycine soja [wild soybean]
ref|NP_001238190.1|  uncharacterized protein LOC100500444               241   4e-78   
gb|KHN19331.1|  Pollen-specific protein SF3                             241   6e-78   Glycine soja [wild soybean]
ref|XP_007036121.1|  GATA type zinc finger transcription factor f...    240   2e-77   
ref|XP_004236135.1|  PREDICTED: LIM domain-containing protein WLIM1     240   2e-77   Solanum lycopersicum
ref|XP_006345025.1|  PREDICTED: pollen-specific protein SF3-like        239   6e-77   Solanum tuberosum [potatoes]
ref|XP_002321571.1|  hypothetical protein POPTR_0015s08360g             238   7e-77   
ref|NP_001235271.1|  uncharacterized protein LOC100500501               237   2e-76   
ref|XP_011044348.1|  PREDICTED: LIM domain-containing protein WLI...    235   2e-75   Populus euphratica
ref|XP_010678700.1|  PREDICTED: LIM domain-containing protein WLI...    236   2e-75   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010027995.1|  PREDICTED: pollen-specific protein SF3-like        234   3e-75   Eucalyptus grandis [rose gum]
ref|XP_002318024.1|  hypothetical protein POPTR_0012s07870g             234   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_007036120.1|  GATA type zinc finger transcription factor f...    232   4e-74   
ref|XP_006836719.1|  hypothetical protein AMTR_s00088p00121090          231   6e-74   Amborella trichopoda
ref|XP_010037591.1|  PREDICTED: pollen-specific protein SF3-like ...    231   9e-74   Eucalyptus grandis [rose gum]
ref|XP_011071800.1|  PREDICTED: LIM domain-containing protein WLI...    229   2e-73   Sesamum indicum [beniseed]
ref|XP_008453121.1|  PREDICTED: pollen-specific protein SF3-like        227   2e-72   Cucumis melo [Oriental melon]
ref|XP_003550749.1|  PREDICTED: pollen-specific protein SF3-like        227   3e-72   Glycine max [soybeans]
ref|XP_004138126.1|  PREDICTED: pollen-specific protein SF3-like        225   1e-71   Cucumis sativus [cucumbers]
gb|EYU29934.1|  hypothetical protein MIMGU_mgv1a014656mg                223   5e-71   Erythranthe guttata [common monkey flower]
gb|EYU42534.1|  hypothetical protein MIMGU_mgv1a021971mg                223   8e-71   Erythranthe guttata [common monkey flower]
ref|XP_007155394.1|  hypothetical protein PHAVU_003G197600g             223   8e-71   Phaseolus vulgaris [French bean]
ref|XP_003525489.1|  PREDICTED: pollen-specific protein SF3-like        224   1e-70   Glycine max [soybeans]
ref|XP_004501954.1|  PREDICTED: pollen-specific protein SF3-like        221   5e-70   Cicer arietinum [garbanzo]
ref|XP_004508840.1|  PREDICTED: pollen-specific protein SF3-like        216   5e-68   Cicer arietinum [garbanzo]
gb|ABK23670.1|  unknown                                                 216   7e-68   Picea sitchensis
ref|XP_011030325.1|  PREDICTED: LIM domain-containing protein WLI...    215   1e-67   Populus euphratica
ref|XP_002298780.2|  hypothetical protein POPTR_0001s30020g             215   1e-67   
gb|ABK94586.1|  unknown                                                 215   2e-67   Populus trichocarpa [western balsam poplar]
gb|AGJ83946.1|  lim protein 6                                           214   2e-67   Gossypium hirsutum [American cotton]
gb|KJB32231.1|  hypothetical protein B456_005G230900                    214   2e-67   Gossypium raimondii
ref|XP_009766668.1|  PREDICTED: pollen-specific protein SF3-like        214   2e-67   Nicotiana sylvestris
gb|ACA33841.1|  LIM2 transcription factor                               213   4e-67   Pinus pinaster [cluster pine]
gb|KHN04435.1|  Pollen-specific protein SF3                             214   4e-67   Glycine soja [wild soybean]
ref|XP_011092491.1|  PREDICTED: LIM domain-containing protein WLI...    214   4e-67   Sesamum indicum [beniseed]
gb|AAF13231.1|  pollen specific LIM domain protein 1a                   213   6e-67   Nicotiana tabacum [American tobacco]
dbj|BAO02514.1|  predicted LIM domain-containing protein ortholog       213   7e-67   Nicotiana alata [flowering tobacco]
gb|ABK58465.1|  LIM domain protein GLIM1b                               212   2e-66   Populus tremula x Populus alba [gray poplar]
ref|XP_007042657.1|  GATA type zinc finger transcription factor f...    212   2e-66   Theobroma cacao [chocolate]
ref|XP_011457848.1|  PREDICTED: LIM domain-containing protein WLI...    212   2e-66   Fragaria vesca subsp. vesca
ref|XP_010272870.1|  PREDICTED: LIM domain-containing protein WLI...    212   2e-66   
ref|XP_007201308.1|  hypothetical protein PRUPE_ppa011881mg             211   4e-66   Prunus persica
ref|XP_011002116.1|  PREDICTED: LIM domain-containing protein WLI...    211   4e-66   Populus euphratica
ref|XP_002313186.2|  hypothetical protein POPTR_0009s09040g             211   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_009606069.1|  PREDICTED: pollen-specific protein SF3-like        210   5e-66   Nicotiana tomentosiformis
gb|ABK95336.1|  unknown                                                 211   5e-66   Populus trichocarpa [western balsam poplar]
ref|XP_010928557.1|  PREDICTED: LIM domain-containing protein WLI...    213   6e-66   Elaeis guineensis
ref|XP_009408124.1|  PREDICTED: pollen-specific protein SF3-like        210   7e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009414770.1|  PREDICTED: pollen-specific protein SF3-like        210   9e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004250748.1|  PREDICTED: LIM domain-containing protein WLI...    210   1e-65   Solanum lycopersicum
ref|NP_001235758.1|  uncharacterized protein LOC100305720               210   1e-65   Glycine max [soybeans]
ref|NP_001238580.1|  uncharacterized protein LOC100499957               210   1e-65   Glycine max [soybeans]
ref|XP_010548517.1|  PREDICTED: LIM domain-containing protein WLI...    209   1e-65   Tarenaya hassleriana [spider flower]
gb|ABK58464.1|  LIM domain protein GLIM1a                               210   1e-65   Populus tremula x Populus alba [gray poplar]
ref|XP_002285355.1|  PREDICTED: LIM domain-containing protein WLIM1     210   1e-65   Vitis vinifera
ref|XP_009418011.1|  PREDICTED: pollen-specific protein SF3-like        210   1e-65   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB32232.1|  hypothetical protein B456_005G230900                    209   2e-65   Gossypium raimondii
ref|XP_008793824.1|  PREDICTED: pollen-specific protein SF3-like ...    210   3e-65   Phoenix dactylifera
ref|XP_006342667.1|  PREDICTED: pollen-specific protein SF3-like        208   4e-65   Solanum tuberosum [potatoes]
ref|XP_009769329.1|  PREDICTED: pollen-specific protein SF3-like        209   4e-65   Nicotiana sylvestris
ref|XP_009598300.1|  PREDICTED: pollen-specific protein SF3-like        208   4e-65   Nicotiana tomentosiformis
ref|XP_011074349.1|  PREDICTED: LIM domain-containing protein WLIM1     209   4e-65   Sesamum indicum [beniseed]
ref|XP_004252738.1|  PREDICTED: LIM domain-containing protein WLI...    208   5e-65   Solanum lycopersicum
ref|XP_006352087.1|  PREDICTED: pollen-specific protein SF3-like        208   5e-65   Solanum tuberosum [potatoes]
ref|XP_006857164.1|  hypothetical protein AMTR_s00065p00168710          208   5e-65   Amborella trichopoda
gb|KHN36972.1|  Pollen-specific protein SF3                             208   6e-65   Glycine soja [wild soybean]
gb|EYU25518.1|  hypothetical protein MIMGU_mgv1a014425mg                208   6e-65   Erythranthe guttata [common monkey flower]
ref|XP_009415386.1|  PREDICTED: pollen-specific protein SF3-like        208   7e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001238429.1|  uncharacterized protein LOC100499947               208   8e-65   Glycine max [soybeans]
gb|ABK93551.1|  unknown                                                 207   1e-64   Populus trichocarpa [western balsam poplar]
ref|XP_002510088.1|  Pollen-specific protein SF3, putative              207   1e-64   Ricinus communis
gb|AFK42303.1|  unknown                                                 207   1e-64   Medicago truncatula
ref|XP_003608956.1|  LIM domain protein                                 207   1e-64   Medicago truncatula
ref|XP_011457843.1|  PREDICTED: LIM domain-containing protein WLI...    207   1e-64   Fragaria vesca subsp. vesca
ref|XP_002266499.1|  PREDICTED: LIM domain-containing protein WLIM1     207   1e-64   Vitis vinifera
ref|XP_002302405.2|  hypothetical protein POPTR_0002s11880g             207   1e-64   
ref|XP_010913501.1|  PREDICTED: LIM domain-containing protein WLI...    207   1e-64   Elaeis guineensis
ref|XP_010544006.1|  PREDICTED: LIM domain-containing protein WLIM1     207   2e-64   Tarenaya hassleriana [spider flower]
gb|AAD39103.1|AF116849_1  LIM domain protein WLIM-1                     206   2e-64   Helianthus annuus
ref|XP_004141291.1|  PREDICTED: pollen-specific protein SF3-like        206   2e-64   Cucumis sativus [cucumbers]
ref|XP_006595535.1|  PREDICTED: uncharacterized protein LOC100527...    207   2e-64   Glycine max [soybeans]
ref|XP_008364385.1|  PREDICTED: pollen-specific protein SF3-like        207   2e-64   
ref|XP_004136935.1|  PREDICTED: pollen-specific protein SF3-like        207   2e-64   Cucumis sativus [cucumbers]
ref|XP_008236308.1|  PREDICTED: pollen-specific protein SF3-like        207   3e-64   Prunus mume [ume]
ref|XP_008452649.1|  PREDICTED: pollen-specific protein SF3-like ...    206   3e-64   Cucumis melo [Oriental melon]
dbj|BAM05591.1|  LIM transcription factor                               206   3e-64   Eucalyptus pyrocarpa
gb|AAD02543.1|  PGPS/D1                                                 206   4e-64   Petunia x hybrida [garden petunia]
gb|EYU39077.1|  hypothetical protein MIMGU_mgv1a014557mg                206   4e-64   Erythranthe guttata [common monkey flower]
gb|ABK22236.1|  unknown                                                 206   4e-64   Picea sitchensis
ref|XP_007225874.1|  hypothetical protein PRUPE_ppa011761mg             206   4e-64   Prunus persica
ref|XP_004962903.1|  PREDICTED: pollen-specific protein SF3-like        206   5e-64   Setaria italica
ref|XP_006664058.1|  PREDICTED: pollen-specific protein SF3-like        206   6e-64   Oryza brachyantha
gb|AFK42495.1|  unknown                                                 206   6e-64   Lotus japonicus
gb|AFK47041.1|  unknown                                                 206   6e-64   Lotus japonicus
ref|XP_008220373.1|  PREDICTED: pollen-specific protein SF3-like        206   7e-64   Prunus mume [ume]
ref|XP_007160919.1|  hypothetical protein PHAVU_001G028200g             206   7e-64   Phaseolus vulgaris [French bean]
ref|XP_003576026.1|  PREDICTED: LIM domain-containing protein WLIM1     205   8e-64   Brachypodium distachyon [annual false brome]
gb|ABA99040.1|  Pollen-specific protein SF3, putative, expressed        205   8e-64   Oryza sativa Japonica Group [Japonica rice]
gb|AAD56959.1|AF187105_1  LIM domain protein WLIM1                      205   9e-64   Helianthus annuus
ref|XP_008444540.1|  PREDICTED: pollen-specific protein SF3             205   1e-63   Cucumis melo [Oriental melon]
ref|XP_010999890.1|  PREDICTED: LIM domain-containing protein WLI...    205   1e-63   Populus euphratica
dbj|BAB84581.1|  transcription factor LIM                               205   1e-63   Populus sieboldii x Populus grandidentata
ref|XP_002320687.1|  transcription factor LIM family protein            205   1e-63   Populus trichocarpa [western balsam poplar]
ref|XP_002532425.1|  Cysteine and glycine-rich protein, putative        205   1e-63   Ricinus communis
ref|XP_010094354.1|  Pollen-specific protein SF3                        205   1e-63   Morus notabilis
ref|XP_004142897.1|  PREDICTED: pollen-specific protein SF3-like        205   2e-63   Cucumis sativus [cucumbers]
emb|CDP01275.1|  unnamed protein product                                204   2e-63   Coffea canephora [robusta coffee]
dbj|BAM05589.1|  LIM transcription factor                               204   2e-63   Eucalyptus pilularis
ref|XP_010061652.1|  PREDICTED: pollen-specific protein SF3-like        204   2e-63   Eucalyptus grandis [rose gum]
gb|AAD56948.1|AF184109_1  LIM domain protein WLIM1                      204   2e-63   Nicotiana tabacum [American tobacco]
ref|XP_007136766.1|  hypothetical protein PHAVU_009G072200g             204   2e-63   Phaseolus vulgaris [French bean]
gb|KJB77631.1|  hypothetical protein B456_012G147400                    204   3e-63   Gossypium raimondii
gb|AII80541.1|  LIM-domain protein 7                                    204   3e-63   Gossypium hirsutum [American cotton]
ref|XP_004290976.1|  PREDICTED: LIM domain-containing protein WLIM1     204   3e-63   Fragaria vesca subsp. vesca
ref|XP_010687903.1|  PREDICTED: LIM domain-containing protein WLIM1     204   3e-63   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_007018479.1|  GATA type zinc finger transcription factor f...    204   3e-63   
ref|XP_008347599.1|  PREDICTED: pollen-specific protein SF3-like        204   4e-63   
ref|XP_009360821.1|  PREDICTED: pollen-specific protein SF3-like        203   5e-63   Pyrus x bretschneideri [bai li]
gb|ABK58467.1|  LIM domain protein WLIM1a                               203   5e-63   Populus tremula x Populus alba [gray poplar]
ref|NP_001237652.1|  uncharacterized protein LOC100527547               203   6e-63   Glycine max [soybeans]
ref|XP_008393720.1|  PREDICTED: pollen-specific protein SF3-like        203   6e-63   
ref|XP_009623970.1|  PREDICTED: pollen-specific protein SF3-like        203   6e-63   Nicotiana tomentosiformis
ref|XP_006433641.1|  hypothetical protein CICLE_v10002540mg             203   6e-63   Citrus clementina [clementine]
ref|XP_006422808.1|  hypothetical protein CICLE_v10029316mg             203   7e-63   Citrus clementina [clementine]
gb|KDP41612.1|  hypothetical protein JCGZ_16019                         203   7e-63   Jatropha curcas
ref|XP_009375152.1|  PREDICTED: pollen-specific protein SF3-like        203   7e-63   Pyrus x bretschneideri [bai li]
ref|XP_003589058.1|  Transcription factor lim1                          203   7e-63   Medicago truncatula
gb|AGE09578.1|  LIM-like protein                                        203   7e-63   Eucalyptus cladocalyx
ref|XP_002442217.1|  hypothetical protein SORBIDRAFT_08g016450          203   8e-63   Sorghum bicolor [broomcorn]
ref|XP_010028358.1|  PREDICTED: pollen-specific protein SF3-like        203   8e-63   Eucalyptus grandis [rose gum]
emb|CDO97286.1|  unnamed protein product                                202   9e-63   Coffea canephora [robusta coffee]
ref|XP_006417487.1|  hypothetical protein EUTSA_v10008856mg             202   9e-63   Eutrema salsugineum [saltwater cress]
ref|XP_009765343.1|  PREDICTED: pollen-specific protein SF3-like        202   9e-63   Nicotiana sylvestris
ref|XP_009148339.1|  PREDICTED: pollen-specific protein SF3             202   1e-62   Brassica rapa
ref|XP_010059807.1|  PREDICTED: pollen-specific protein SF3-like        202   1e-62   Eucalyptus grandis [rose gum]
gb|AGE09584.1|  LIM1-like protein                                       202   1e-62   Eucalyptus cladocalyx
emb|CDX94916.1|  BnaC05g07550D                                          202   1e-62   
gb|ABY21316.1|  LIM1                                                    202   1e-62   Lilium longiflorum [Easter lily]
gb|ABW69660.1|  transcription factor LIM                                202   1e-62   Triticum aestivum [Canadian hard winter wheat]
ref|NP_001104937.2|  LOC541782                                          202   1e-62   
ref|XP_004501516.1|  PREDICTED: pollen-specific protein SF3-like        202   2e-62   Cicer arietinum [garbanzo]
ref|XP_008648273.1|  PREDICTED: LOC541782 isoform X1                    202   2e-62   
gb|ACG34183.1|  pollen-specific protein SF3                             202   2e-62   Zea mays [maize]
ref|XP_004498991.1|  PREDICTED: pollen-specific protein SF3-like        201   3e-62   Cicer arietinum [garbanzo]
dbj|BAB84584.1|  transcription factor LIM                               201   3e-62   Nicotiana tabacum [American tobacco]
dbj|BAJ94823.1|  predicted protein                                      201   4e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006304225.1|  hypothetical protein CARUB_v10010373mg             201   4e-62   Capsella rubella
ref|XP_010475882.1|  PREDICTED: LIM domain-containing protein WLI...    201   4e-62   Camelina sativa [gold-of-pleasure]
ref|NP_172491.1|  transcription factor lim1                             201   4e-62   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010490782.1|  PREDICTED: LIM domain-containing protein WLIM1     201   5e-62   Camelina sativa [gold-of-pleasure]
emb|CDY20647.1|  BnaC08g14110D                                          201   5e-62   Brassica napus [oilseed rape]
ref|XP_008811666.1|  PREDICTED: pollen-specific protein SF3             201   5e-62   Phoenix dactylifera
ref|XP_010458355.1|  PREDICTED: LIM domain-containing protein WLI...    201   5e-62   Camelina sativa [gold-of-pleasure]
ref|XP_009144466.1|  PREDICTED: pollen-specific protein SF3-like        201   5e-62   Brassica rapa
ref|XP_004238086.1|  PREDICTED: LIM domain-containing protein WLIM1     200   9e-62   Solanum lycopersicum
gb|AFV60741.1|  LIM domain protein LIM-2                                200   9e-62   Gossypium hirsutum [American cotton]
ref|XP_010942770.1|  PREDICTED: LIM domain-containing protein WLI...    200   1e-61   Elaeis guineensis
dbj|BAA82827.1|  transcription factor Ntlim1                            200   1e-61   Nicotiana tabacum [American tobacco]
ref|NP_001148027.1|  pollen-specific protein SF3                        200   1e-61   Zea mays [maize]
gb|KJB63466.1|  hypothetical protein B456_010G026100                    199   1e-61   Gossypium raimondii
ref|XP_002892554.1|  hypothetical protein ARALYDRAFT_471134             199   2e-61   
ref|XP_010938994.1|  PREDICTED: LIM domain-containing protein WLI...    199   2e-61   Elaeis guineensis
ref|XP_010274389.1|  PREDICTED: LIM domain-containing protein WLI...    199   2e-61   Nelumbo nucifera [Indian lotus]
gb|AII80544.1|  LIM-domain protein 10                                   199   2e-61   Gossypium hirsutum [American cotton]
gb|ABB51614.1|  LIM-domain protein                                      199   2e-61   Brassica napus [oilseed rape]
ref|XP_010091018.1|  Pollen-specific protein SF3                        199   3e-61   Morus notabilis
gb|KFK43312.1|  hypothetical protein AALP_AA1G108000                    197   6e-61   Arabis alpina [alpine rockcress]
ref|XP_007143127.1|  hypothetical protein PHAVU_007G046100g             194   1e-59   Phaseolus vulgaris [French bean]
ref|NP_001236461.1|  uncharacterized protein LOC100306027               194   2e-59   Glycine max [soybeans]
gb|EYU36386.1|  hypothetical protein MIMGU_mgv1a009946mg                197   4e-59   Erythranthe guttata [common monkey flower]
ref|XP_002965335.1|  hypothetical protein SELMODRAFT_143123             193   4e-59   Selaginella moellendorffii
gb|KHG30571.1|  Pollen-specific SF3                                     192   5e-59   Gossypium arboreum [tree cotton]
dbj|BAB84583.1|  transcription factor LIM                               192   2e-58   Nicotiana tabacum [American tobacco]
gb|ACA33852.1|  LIM2 transcription factor                               189   2e-58   Pinus taeda
sp|P29675.1|SF3_HELAN  RecName: Full=Pollen-specific protein SF3        192   3e-58   Helianthus annuus
gb|KHN06818.1|  Pollen-specific protein SF3                             191   3e-58   Glycine soja [wild soybean]
gb|AAD56957.1|AF187103_1  LIM domain protein PLIM1b                     192   3e-58   Helianthus annuus
ref|XP_004496871.1|  PREDICTED: pollen-specific protein SF3-like        191   4e-58   Cicer arietinum [garbanzo]
ref|XP_008793825.1|  PREDICTED: pollen-specific protein SF3-like ...    188   8e-58   
ref|XP_001765937.1|  predicted protein                                  186   2e-56   
gb|KJB63465.1|  hypothetical protein B456_010G026100                    183   5e-56   Gossypium raimondii
ref|XP_009389653.1|  PREDICTED: pollen-specific protein SF3-like        185   6e-56   Musa acuminata subsp. malaccensis [pisang utan]
gb|KCW55096.1|  hypothetical protein EUGRSUZ_I01055                     184   1e-55   Eucalyptus grandis [rose gum]
gb|KDP44510.1|  hypothetical protein JCGZ_16343                         184   2e-55   Jatropha curcas
gb|AAD32870.1|AC005489_8  F14N23.8                                      184   6e-55   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006848064.1|  hypothetical protein AMTR_s00029p00199510          182   8e-55   
ref|XP_008798954.1|  PREDICTED: pollen-specific protein SF3-like        182   1e-54   Phoenix dactylifera
ref|XP_001771340.1|  predicted protein                                  181   1e-54   
ref|XP_002969252.1|  hypothetical protein SELMODRAFT_146291             181   2e-54   Selaginella moellendorffii
ref|XP_010256708.1|  PREDICTED: LIM domain-containing protein WLI...    180   5e-54   Nelumbo nucifera [Indian lotus]
gb|EMT23508.1|  Pollen-specific protein SF3                             181   8e-54   
ref|XP_010928941.1|  PREDICTED: LIM domain-containing protein WLI...    179   2e-53   Elaeis guineensis
gb|KHN17859.1|  Pollen-specific protein SF3                             179   2e-53   Glycine soja [wild soybean]
ref|XP_003538442.1|  PREDICTED: pollen-specific protein SF3-like ...    179   2e-53   
ref|XP_006435557.1|  hypothetical protein CICLE_v10032838mg             178   2e-53   Citrus clementina [clementine]
ref|XP_007163504.1|  hypothetical protein PHAVU_001G239700g             179   2e-53   Phaseolus vulgaris [French bean]
ref|NP_001241110.1|  uncharacterized protein LOC100809121               179   3e-53   Glycine max [soybeans]
ref|XP_006827708.1|  hypothetical protein AMTR_s00009p00259550          178   5e-53   Amborella trichopoda
gb|AEA86290.1|  transcription factor LIM                                175   5e-53   Solanum nigrum
ref|XP_004138434.1|  PREDICTED: pollen-specific protein SF3-like        177   6e-53   Cucumis sativus [cucumbers]
ref|XP_008785448.1|  PREDICTED: pollen-specific protein SF3-like        177   7e-53   Phoenix dactylifera
ref|XP_010923152.1|  PREDICTED: LIM domain-containing protein WLI...    177   1e-52   Elaeis guineensis
gb|ACU17588.1|  unknown                                                 175   1e-52   Glycine max [soybeans]
ref|XP_002960609.1|  hypothetical protein SELMODRAFT_229974             176   1e-52   
gb|EEE65408.1|  hypothetical protein OsJ_20745                          178   2e-52   Oryza sativa Japonica Group [Japonica rice]
ref|XP_011093154.1|  PREDICTED: LIM domain-containing protein PLI...    177   2e-52   Sesamum indicum [beniseed]
gb|ABK58469.1|  LIM domain protein WLIM2a                               176   3e-52   Populus tremula x Populus alba [gray poplar]
ref|XP_010093495.1|  Pollen-specific protein SF3                        176   3e-52   Morus notabilis
ref|XP_003544136.1|  PREDICTED: pollen-specific protein SF3 isofo...    175   4e-52   Glycine max [soybeans]
ref|XP_004965094.1|  PREDICTED: microtubule-associated protein fu...    189   6e-52   Setaria italica
ref|XP_008392904.1|  PREDICTED: pollen-specific protein SF3-like ...    175   8e-52   Malus domestica [apple tree]
gb|KDP44835.1|  hypothetical protein JCGZ_01335                         174   8e-52   Jatropha curcas
ref|XP_009344420.1|  PREDICTED: pollen-specific protein SF3-like        175   9e-52   Pyrus x bretschneideri [bai li]
ref|XP_008381875.1|  PREDICTED: pollen-specific protein SF3-like        175   9e-52   Malus domestica [apple tree]
ref|XP_007218461.1|  hypothetical protein PRUPE_ppa011869mg             174   9e-52   Prunus persica
gb|ABK22125.1|  unknown                                                 174   1e-51   Picea sitchensis
ref|XP_007009106.1|  GATA type zinc finger transcription factor f...    174   1e-51   Theobroma cacao [chocolate]
gb|AFK39062.1|  unknown                                                 174   1e-51   Lotus japonicus
gb|ACX47456.1|  LIM1                                                    174   1e-51   Hevea brasiliensis [jebe]
ref|XP_002315180.1|  LIM domain-containing family protein               174   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_009421306.1|  PREDICTED: pollen-specific protein SF3-like        174   2e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004503222.1|  PREDICTED: pollen-specific protein SF3-like ...    174   2e-51   
ref|XP_009404566.1|  PREDICTED: pollen-specific protein SF3-like        173   3e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002530411.1|  Pollen-specific protein SF3, putative              173   3e-51   Ricinus communis
ref|XP_010255661.1|  PREDICTED: LIM domain-containing protein PLI...    173   4e-51   Nelumbo nucifera [Indian lotus]
ref|XP_002312139.1|  LIM domain-containing family protein               172   6e-51   Populus trichocarpa [western balsam poplar]
ref|XP_011040324.1|  PREDICTED: LIM domain-containing protein WLI...    172   7e-51   Populus euphratica
gb|AGJ83945.1|  lim protein 5                                           172   7e-51   Gossypium hirsutum [American cotton]
ref|XP_011076748.1|  PREDICTED: LIM domain-containing protein WLIM2b    172   8e-51   Sesamum indicum [beniseed]
ref|XP_008392902.1|  PREDICTED: pollen-specific protein SF3-like ...    172   1e-50   Malus domestica [apple tree]
gb|KHG27160.1|  Pollen-specific SF3                                     171   1e-50   Gossypium arboreum [tree cotton]
gb|KHG07853.1|  Pollen-specific SF3                                     171   1e-50   Gossypium arboreum [tree cotton]
gb|KJB67594.1|  hypothetical protein B456_010G199200                    171   2e-50   Gossypium raimondii
ref|XP_002283482.1|  PREDICTED: LIM domain-containing protein WLIM2a    172   2e-50   Vitis vinifera
ref|XP_002279922.1|  PREDICTED: LIM domain-containing protein WLIM2b    171   2e-50   Vitis vinifera
ref|XP_010067487.1|  PREDICTED: pollen-specific protein SF3             171   2e-50   Eucalyptus grandis [rose gum]
ref|XP_010534537.1|  PREDICTED: LIM domain-containing protein WLI...    171   2e-50   Tarenaya hassleriana [spider flower]
gb|KJB78800.1|  hypothetical protein B456_013G019800                    171   3e-50   Gossypium raimondii
ref|XP_004307607.1|  PREDICTED: LIM domain-containing protein WLIM2b    171   3e-50   Fragaria vesca subsp. vesca
ref|XP_009624528.1|  PREDICTED: pollen-specific protein SF3-like ...    171   3e-50   Nicotiana tomentosiformis
emb|CBL95262.1|  lim domain protein                                     170   4e-50   Pinus pinaster [cluster pine]
ref|XP_009762122.1|  PREDICTED: pollen-specific protein SF3-like        170   8e-50   Nicotiana sylvestris
gb|EYU19976.1|  hypothetical protein MIMGU_mgv1a014151mg                169   9e-50   Erythranthe guttata [common monkey flower]
ref|XP_009138785.1|  PREDICTED: pollen-specific protein SF3-like ...    169   1e-49   Brassica rapa
ref|XP_010523732.1|  PREDICTED: LIM domain-containing protein PLI...    170   1e-49   Tarenaya hassleriana [spider flower]
gb|ABK94608.1|  unknown                                                 169   1e-49   Populus trichocarpa [western balsam poplar]
gb|EEC80296.1|  hypothetical protein OsI_22314                          182   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_007009108.1|  GATA type zinc finger transcription factor f...    169   1e-49   
ref|XP_010273176.1|  PREDICTED: LIM domain-containing protein PLIM2c    169   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010227809.1|  PREDICTED: enolase-phosphatase E1-like             182   2e-49   Brachypodium distachyon [annual false brome]
ref|XP_009587504.1|  PREDICTED: pollen-specific protein SF3-like        168   2e-49   Nicotiana tomentosiformis
ref|XP_004150238.1|  PREDICTED: pollen-specific protein SF3-like ...    168   2e-49   Cucumis sativus [cucumbers]
ref|XP_004167859.1|  PREDICTED: LOW QUALITY PROTEIN: pollen-speci...    168   2e-49   
ref|XP_009139138.1|  PREDICTED: pollen-specific protein SF3-like        168   2e-49   Brassica rapa
ref|XP_006341718.1|  PREDICTED: pollen-specific protein SF3-like        169   2e-49   Solanum tuberosum [potatoes]
emb|CBI40313.3|  unnamed protein product                                168   3e-49   
ref|XP_009779198.1|  PREDICTED: pollen-specific protein SF3-like        169   3e-49   
ref|XP_004248581.1|  PREDICTED: LIM domain-containing protein PLI...    169   3e-49   
ref|NP_001057248.1|  Os06g0237300                                       181   3e-49   
ref|XP_009602682.1|  PREDICTED: pollen-specific protein SF3-like        167   3e-49   
ref|XP_010554627.1|  PREDICTED: LIM domain-containing protein WLIM2b    168   4e-49   
ref|XP_008463203.1|  PREDICTED: pollen-specific protein SF3-like        168   4e-49   
ref|XP_007009110.1|  GATA type zinc finger transcription factor f...    167   5e-49   
emb|CDX76073.1|  BnaA04g03370D                                          170   5e-49   
ref|XP_008649270.1|  PREDICTED: microtubule-associated protein fu...    180   6e-49   
ref|XP_002269537.1|  PREDICTED: LIM domain-containing protein PLIM2c    168   7e-49   
ref|XP_009143273.1|  PREDICTED: pollen-specific protein SF3             167   7e-49   
gb|EMT02506.1|  Pollen-specific protein SF3                             180   8e-49   
emb|CDY20498.1|  BnaC04g05460D                                          167   9e-49   
ref|XP_006411232.1|  hypothetical protein EUTSA_v10017249mg             167   1e-48   
ref|XP_009116783.1|  PREDICTED: pollen-specific protein SF3             167   1e-48   
gb|AAZ95169.1|  putative transcription factor LIM                       164   1e-48   
ref|XP_006403418.1|  hypothetical protein EUTSA_v10010740mg             167   1e-48   
ref|XP_010505685.1|  PREDICTED: LIM domain-containing protein WLI...    167   1e-48   
gb|EMS52970.1|  Pollen-specific protein SF3                             179   1e-48   
emb|CDX72203.1|  BnaC08g26710D                                          167   1e-48   
emb|CDY27267.1|  BnaA09g35350D                                          167   1e-48   
emb|CDY24943.1|  BnaC03g22290D                                          166   1e-48   
ref|XP_009624529.1|  PREDICTED: pollen-specific protein SF3-like ...    167   1e-48   
emb|CDY56926.1|  BnaAnng14450D                                          167   2e-48   
ref|XP_011091917.1|  PREDICTED: LIM domain-containing protein PLI...    167   2e-48   
ref|XP_009116276.1|  PREDICTED: pollen-specific protein SF3             166   2e-48   
ref|XP_009133391.1|  PREDICTED: pollen-specific protein SF3-like        166   2e-48   
ref|XP_009397610.1|  PREDICTED: pollen-specific protein SF3-like        166   2e-48   
emb|CDY60999.1|  BnaA03g56620D                                          166   2e-48   
ref|XP_002876333.1|  LIM domain-containing protein                      166   2e-48   
ref|XP_007009107.1|  GATA type zinc finger transcription factor f...    166   3e-48   
ref|NP_001047550.1|  Os02g0641000                                       166   3e-48   
ref|XP_006402504.1|  hypothetical protein EUTSA_v10006235mg             166   3e-48   
ref|XP_010544716.1|  PREDICTED: LIM domain-containing protein PLI...    167   3e-48   
emb|CDY02959.1|  BnaC04g25270D                                          168   3e-48   
emb|CAA62744.1|  transcription factor L2                                165   3e-48   
emb|CDX71757.1|  BnaC08g31170D                                          166   4e-48   
ref|XP_003600847.1|  LIM domain-containing protein                      165   4e-48   
ref|NP_001288583.1|  uncharacterized protein LOC101266456               166   5e-48   
ref|NP_191136.1|  actin bundler LIM family protein WLIM2b               165   6e-48   
ref|NP_191682.2|  GATA type zinc finger transcription factor fami...    165   6e-48   
gb|EPS71497.1|  hypothetical protein M569_03263                         165   7e-48   
ref|XP_009629648.1|  PREDICTED: pollen-specific protein SF3-like ...    165   7e-48   
ref|XP_006649807.1|  PREDICTED: pollen-specific protein SF3-like        164   7e-48   
gb|AFK34184.1|  unknown                                                 164   7e-48   
ref|XP_002970742.1|  hypothetical protein SELMODRAFT_441295             164   7e-48   
ref|XP_004239928.1|  PREDICTED: LIM domain-containing protein WLI...    164   8e-48   
gb|EYU32092.1|  hypothetical protein MIMGU_mgv1a013269mg                165   1e-47   
ref|XP_009138786.1|  PREDICTED: pollen-specific protein SF3-like ...    164   1e-47   
ref|XP_010508950.1|  PREDICTED: LIM domain-containing protein WLI...    164   1e-47   
ref|XP_010517368.1|  PREDICTED: LIM domain-containing protein WLIM2a    164   1e-47   
ref|XP_006647592.1|  PREDICTED: pollen-specific protein SF3-like        164   2e-47   
ref|XP_010671960.1|  PREDICTED: LIM domain-containing protein PLI...    164   2e-47   
gb|AAL38006.1|AF443117_1  LIM domain protein                            163   2e-47   
ref|XP_006656826.1|  PREDICTED: microtubule-associated protein fu...    176   2e-47   
ref|XP_006295906.1|  hypothetical protein CARUB_v10025036mg             163   2e-47   
ref|NP_181519.1|  protein WLIM2A                                        163   2e-47   
emb|CDP08845.1|  unnamed protein product                                164   2e-47   
gb|ACN26203.1|  unknown                                                 163   3e-47   
ref|XP_009387955.1|  PREDICTED: pollen-specific protein SF3-like        162   3e-47   
ref|XP_002452860.1|  hypothetical protein SORBIDRAFT_04g033700          163   4e-47   
gb|AGJ83942.1|  lim protein 2                                           162   4e-47   
ref|XP_004982687.1|  PREDICTED: pollen-specific protein SF3-like        163   4e-47   
gb|KJB74201.1|  hypothetical protein B456_011G279100                    162   4e-47   
ref|XP_006491462.1|  PREDICTED: pollen-specific protein SF3-like        163   4e-47   
ref|NP_182104.1|  protein PLIM2A                                        163   5e-47   
ref|XP_004953255.1|  PREDICTED: pollen-specific protein SF3-like        162   7e-47   
dbj|BAH20111.1|  AT3G55770                                              162   7e-47   
ref|XP_002882034.1|  LIM domain-containing protein                      163   7e-47   
ref|XP_002879831.1|  LIM domain-containing protein                      162   8e-47   
emb|CAB71053.1|  LIM domain protein                                     162   9e-47   
ref|XP_008374043.1|  PREDICTED: pollen-specific protein SF3-like        162   1e-46   
ref|XP_006339787.1|  PREDICTED: pollen-specific protein SF3-like        162   1e-46   
ref|XP_010504446.1|  PREDICTED: LIM domain-containing protein WLI...    162   1e-46   
ref|XP_010427370.1|  PREDICTED: LIM domain-containing protein WLIM2b    162   1e-46   
ref|XP_002878372.1|  LIM domain-containing protein                      162   1e-46   
ref|XP_001764074.1|  predicted protein                                  162   1e-46   
ref|XP_010544715.1|  PREDICTED: LIM domain-containing protein PLI...    162   1e-46   
ref|XP_006661927.1|  PREDICTED: pollen-specific protein SF3-like        162   2e-46   
ref|XP_010469046.1|  PREDICTED: LIM domain-containing protein PLI...    162   2e-46   
ref|XP_010413441.1|  PREDICTED: LIM domain-containing protein PLI...    161   2e-46   
ref|NP_001049655.1|  Os03g0266100                                       160   2e-46   
gb|EPS59684.1|  hypothetical protein M569_15118                         160   3e-46   
ref|XP_009369042.1|  PREDICTED: pollen-specific protein SF3-like        161   3e-46   
ref|XP_010512456.1|  PREDICTED: LIM domain-containing protein PLI...    161   3e-46   
ref|XP_010516165.1|  PREDICTED: LIM domain-containing protein WLI...    160   3e-46   
ref|XP_009629647.1|  PREDICTED: pollen-specific protein SF3-like ...    161   3e-46   
dbj|BAM13338.1|  LIM domain-containing protein                          160   3e-46   
ref|XP_009762983.1|  PREDICTED: pollen-specific protein SF3-like        160   3e-46   
dbj|BAM13339.1|  LIM domain-containing protein                          160   4e-46   
ref|XP_010518219.1|  PREDICTED: LIM domain-containing protein PLI...    161   4e-46   
ref|XP_008777895.1|  PREDICTED: pollen-specific protein SF3-like        160   5e-46   
dbj|BAM13335.1|  LIM domain-containing protein                          160   5e-46   
gb|EPS58831.1|  hypothetical protein M569_15983                         159   6e-46   
gb|KFK37370.1|  hypothetical protein AALP_AA4G247900                    161   6e-46   
dbj|BAM13341.1|  LIM domain-containing protein                          160   6e-46   
ref|XP_009601147.1|  PREDICTED: pollen-specific protein SF3-like        160   6e-46   
gb|KJB24709.1|  hypothetical protein B456_004G157300                    160   6e-46   
gb|EYU35073.1|  hypothetical protein MIMGU_mgv1a013171mg                160   7e-46   
ref|XP_010506557.1|  PREDICTED: LIM domain-containing protein PLIM2a    160   9e-46   
ref|XP_011469034.1|  PREDICTED: LIM domain-containing protein PLI...    160   9e-46   
ref|XP_010508108.1|  PREDICTED: LIM domain-containing protein PLI...    160   9e-46   
gb|EAY79118.1|  hypothetical protein OsI_34224                          160   1e-45   
dbj|BAM13340.1|  LIM domain-containing protein                          159   1e-45   
ref|NP_001064995.1|  Os10g0503100                                       160   1e-45   
ref|XP_008392559.1|  PREDICTED: pollen-specific protein SF3-like        160   1e-45   
ref|XP_009402055.1|  PREDICTED: pollen-specific protein SF3-like        159   1e-45   
ref|XP_010905119.1|  PREDICTED: LIM domain-containing protein WLI...    159   2e-45   
ref|XP_006296425.1|  hypothetical protein CARUB_v10025604mg             159   2e-45   
ref|XP_008232792.1|  PREDICTED: pollen-specific protein SF3             159   2e-45   
ref|NP_001147673.1|  pollen-specific protein SF3                        158   2e-45   
ref|XP_006292212.1|  hypothetical protein CARUB_v10018418mg             159   2e-45   
ref|XP_009391810.1|  PREDICTED: pollen-specific protein SF3-like        157   2e-45   
ref|XP_004240106.1|  PREDICTED: LIM domain-containing protein WLI...    159   3e-45   
ref|XP_007210077.1|  hypothetical protein PRUPE_ppa019584mg             159   3e-45   
ref|XP_010089139.1|  Pollen-specific protein SF3                        164   3e-45   
ref|XP_008238877.1|  PREDICTED: pollen-specific protein SF3-like        158   4e-45   
ref|XP_008796793.1|  PREDICTED: pollen-specific protein SF3-like        158   4e-45   
ref|XP_008677533.1|  PREDICTED: uncharacterized LOC100381874 isof...    158   4e-45   
emb|CDY01571.1|  BnaC07g35610D                                          158   4e-45   
ref|XP_010907367.1|  PREDICTED: LIM domain-containing protein WLI...    157   4e-45   
ref|XP_004306805.1|  PREDICTED: LIM domain-containing protein PLI...    158   5e-45   
ref|XP_004984674.1|  PREDICTED: pollen-specific protein SF3-like        157   5e-45   
ref|XP_002509768.1|  Pollen-specific protein SF3, putative              157   7e-45   
gb|KFK35321.1|  hypothetical protein AALP_AA5G269200                    157   9e-45   
ref|XP_009375790.1|  PREDICTED: pollen-specific protein SF3-like        157   1e-44   
ref|XP_002511828.1|  Pollen-specific protein SF3, putative              157   1e-44   
ref|XP_003569963.1|  PREDICTED: LIM domain-containing protein WLI...    157   1e-44   
ref|XP_008438078.1|  PREDICTED: pollen-specific protein SF3-like ...    156   2e-44   
ref|XP_009118834.1|  PREDICTED: pollen-specific protein SF3             156   2e-44   
ref|XP_006397773.1|  hypothetical protein EUTSA_v10001618mg             157   2e-44   
ref|XP_010469047.1|  PREDICTED: LIM domain-containing protein PLI...    157   2e-44   
ref|XP_002320783.2|  LIM domain-containing family protein               156   2e-44   
ref|XP_010479778.1|  PREDICTED: LIM domain-containing protein PLIM2b    156   2e-44   
emb|CDY38028.1|  BnaCnng08890D                                          156   2e-44   
ref|XP_006477522.1|  PREDICTED: pollen-specific protein SF3-like        156   2e-44   
ref|XP_010474800.1|  PREDICTED: LIM domain-containing protein PLI...    156   2e-44   
ref|XP_008438068.1|  PREDICTED: pollen-specific protein SF3-like        156   2e-44   
ref|XP_006304383.1|  hypothetical protein CARUB_v10010886mg             156   2e-44   
ref|XP_007051870.1|  GATA type zinc finger transcription factor f...    158   2e-44   
ref|XP_010413443.1|  PREDICTED: LIM domain-containing protein PLI...    156   2e-44   
ref|XP_010690195.1|  PREDICTED: LIM domain-containing protein WLIM2b    156   2e-44   
ref|XP_010523025.1|  PREDICTED: LIM domain-containing protein PLIM2b    156   2e-44   
gb|AGJ83944.1|  lim protein 4                                           156   2e-44   
gb|KJB63464.1|  hypothetical protein B456_010G026100                    154   2e-44   
ref|NP_171683.1|  LIM family protein                                    155   2e-44   
ref|XP_009119735.1|  PREDICTED: pollen-specific protein SF3-like        155   3e-44   
ref|XP_002468127.1|  hypothetical protein SORBIDRAFT_01g040050          155   3e-44   
gb|KJB41286.1|  hypothetical protein B456_007G097400                    156   3e-44   
gb|KHG24611.1|  Pollen-specific SF3                                     156   3e-44   
ref|XP_009389159.1|  PREDICTED: pollen-specific protein SF3-like        155   3e-44   
ref|XP_010512457.1|  PREDICTED: LIM domain-containing protein PLI...    155   4e-44   
gb|KDO76132.1|  hypothetical protein CISIN_1g041875mg                   155   4e-44   
emb|CDY15152.1|  BnaC05g00310D                                          155   4e-44   
gb|KJB25793.1|  hypothetical protein B456_004G209700                    155   4e-44   
ref|XP_009772727.1|  PREDICTED: pollen-specific protein SF3-like        153   4e-44   
dbj|BAK06966.1|  predicted protein                                      155   4e-44   
ref|XP_004134333.1|  PREDICTED: pollen-specific protein SF3-like        155   5e-44   
ref|XP_003574155.1|  PREDICTED: LIM domain-containing protein PLI...    155   5e-44   
ref|NP_001132843.1|  uncharacterized LOC100194335                       155   5e-44   
ref|XP_008438077.1|  PREDICTED: pollen-specific protein SF3-like ...    155   5e-44   
ref|XP_011035878.1|  PREDICTED: LIM domain-containing protein PLI...    155   6e-44   
gb|AAF78411.1|AC009273_17  Contains similarity to mRNA for transc...    156   7e-44   
gb|KGN56538.1|  hypothetical protein Csa_3G122620                       155   7e-44   
ref|XP_011023373.1|  PREDICTED: LIM domain-containing protein PLIM2b    154   7e-44   
ref|XP_006418457.1|  hypothetical protein EUTSA_v10008789mg             154   8e-44   
ref|XP_002302574.1|  LIM domain-containing family protein               154   1e-43   
ref|NP_001154680.1|  actin bundler LIM family protein WLIM2b            152   1e-43   
ref|XP_002892043.1|  LIM domain-containing protein                      154   1e-43   
ref|NP_001140551.1|  uncharacterized LOC100272616                       154   1e-43   
gb|EPS69807.1|  hypothetical protein M569_04956                         150   1e-43   
gb|KJB22346.1|  hypothetical protein B456_004G042300                    154   1e-43   
ref|XP_009118149.1|  PREDICTED: pollen-specific protein SF3-like        151   1e-43   
gb|ABK58466.1|  LIM domain protein PLIM2a                               153   2e-43   
gb|EMT25782.1|  Pollen-specific protein SF3                             154   2e-43   
ref|XP_003580212.1|  PREDICTED: LIM domain-containing protein PLI...    153   3e-43   
ref|XP_008376025.1|  PREDICTED: pollen-specific protein SF3-like        154   3e-43   
gb|KHN29376.1|  Pollen-specific protein SF3                             153   3e-43   
ref|XP_003533616.1|  PREDICTED: pollen-specific protein SF3-like        153   3e-43   
ref|XP_010055180.1|  PREDICTED: pollen-specific protein SF3-like        153   3e-43   
gb|EEC69362.1|  hypothetical protein OsI_38483                          150   3e-43   
emb|CDY18899.1|  BnaC04g04510D                                          154   3e-43   
gb|KHG08337.1|  Pollen-specific SF3                                     153   4e-43   
emb|CDY27358.1|  BnaC04g50470D                                          153   5e-43   
ref|XP_004976341.1|  PREDICTED: pollen-specific protein SF3-like ...    152   5e-43   
ref|XP_011022732.1|  PREDICTED: LIM domain-containing protein WLI...    152   6e-43   
ref|XP_006439594.1|  hypothetical protein CICLE_v10023761mg             152   6e-43   
ref|XP_009766754.1|  PREDICTED: pollen-specific protein SF3-like        152   7e-43   
gb|KDP25467.1|  hypothetical protein JCGZ_20623                         152   7e-43   
ref|XP_011029226.1|  PREDICTED: LIM domain-containing protein WLI...    152   7e-43   
gb|KEH18910.1|  GATA type zinc finger transcription factor family...    152   8e-43   
ref|XP_007139894.1|  hypothetical protein PHAVU_008G067500g             152   9e-43   
gb|KFK35322.1|  hypothetical protein AALP_AA5G269200                    152   9e-43   
ref|XP_003551659.1|  PREDICTED: pollen-specific protein SF3-like        152   1e-42   
ref|XP_002448228.1|  hypothetical protein SORBIDRAFT_06g023600          151   1e-42   
dbj|BAK04207.1|  predicted protein                                      151   1e-42   
gb|EMS67160.1|  Pollen-specific protein SF3                             151   1e-42   
emb|CDY37066.1|  BnaA04g26440D                                          152   1e-42   
ref|XP_004133874.1|  PREDICTED: pollen-specific protein SF3-like        151   1e-42   
ref|XP_009142366.1|  PREDICTED: pollen-specific protein SF3-like        152   1e-42   
ref|XP_006652565.1|  PREDICTED: pollen-specific protein SF3-like        151   1e-42   
ref|XP_007135026.1|  hypothetical protein PHAVU_010G095700g             152   2e-42   
ref|XP_006291888.1|  hypothetical protein CARUB_v10018065mg             150   2e-42   
ref|XP_007135027.1|  hypothetical protein PHAVU_010G095700g             152   2e-42   
ref|XP_010053293.1|  PREDICTED: pollen-specific protein SF3-like        151   2e-42   
ref|XP_008337059.1|  PREDICTED: pollen-specific protein SF3-like        151   2e-42   
gb|AII80545.1|  LIM-domain protein 11                                   151   2e-42   
ref|XP_004503760.1|  PREDICTED: pollen-specific protein SF3-like        151   2e-42   
ref|XP_009143175.1|  PREDICTED: pollen-specific protein SF3-like        151   2e-42   
ref|XP_002304483.2|  hypothetical protein POPTR_0003s12440g             151   2e-42   
gb|KHG24101.1|  Pollen-specific SF3                                     151   2e-42   
ref|XP_011071801.1|  PREDICTED: LIM domain-containing protein WLI...    149   2e-42   
ref|XP_007040178.1|  GATA type zinc finger transcription factor f...    151   2e-42   
ref|XP_003524464.1|  PREDICTED: pollen-specific protein SF3             151   3e-42   
ref|XP_007218397.1|  hypothetical protein PRUPE_ppa011395mg             150   3e-42   
ref|XP_010107618.1|  Pollen-specific protein SF3                        150   3e-42   
ref|XP_003532407.1|  PREDICTED: pollen-specific protein SF3             151   4e-42   
ref|XP_004245622.1|  PREDICTED: LIM domain-containing protein WLI...    149   5e-42   
gb|KHG00940.1|  Pollen-specific SF3                                     150   5e-42   
ref|XP_010037593.1|  PREDICTED: pollen-specific protein SF3-like ...    149   5e-42   



>ref|XP_009590601.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=189

 Score =   260 bits (664),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFK+TGSLDKSFEGAPKTVRER+ADQG ++SKVSSLF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKLTGSLDKSFEGAPKTVRERSADQGQSNSKVSSLFGGTQDKCVACKKTVYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHRACF
Sbjct  121  KVAVDGTSYHRACF  134


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC AC+KTVY ++++  D   YH+ACF+C H    +  SNY + E  LYC+ 
Sbjct  100  SLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEHKLYCRH  159

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  160  HHTQLFKERGNFSQ  173



>ref|XP_009803543.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=189

 Score =   259 bits (663),  Expect = 3e-85, Method: Compositional matrix adjust.
 Identities = 123/134 (92%), Positives = 128/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCK CEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFGGTTQKCKGCEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEGAPKTVRER+ADQG ++SKVSSLF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQGQSNSKVSSLFGGTQDKCVACKKTVYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHRACF
Sbjct  121  KVAVDGTSYHRACF  134


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 32/74 (43%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC AC+KTVY ++++  D   YH+ACF+C H    +  SNY + E  LYC+ 
Sbjct  100  SLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEHKLYCRH  159

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  160  HHTQLFKERGNFSQ  173



>ref|XP_010322559.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
 gb|AAX73300.1| putative pollen specific LIM domain-containing protein [Solanum 
lycopersicum]
Length=179

 Score =   253 bits (646),  Expect = 8e-83, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 128/134 (96%), Gaps = 1/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MASFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEGAPKTVRER+ADQG ++SKVSSLF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQG-SNSKVSSLFGGTQDKCVACKKTVYPLE  119

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHR CF
Sbjct  120  KVAVDGTSYHRPCF  133


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC AC+KTVY ++++  D   YH+ CF+C H    +  SNY + E  LYC+ 
Sbjct  99   SLFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHEHRLYCRH  158

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  159  HHTQLFKERGNFSQ  172



>ref|XP_009610584.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Nicotiana 
tomentosiformis]
Length=189

 Score =   253 bits (645),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 117/134 (87%), Positives = 129/134 (96%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL+AD+KVYHKACFRC HCKGTLKLSNYNS+EGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSL+KSFEGAP+T RER+ADQG ++SKVS+LF GTQDKCV+CKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLNKSFEGAPRTARERSADQGQSNSKVSALFGGTQDKCVSCKKTVYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHRACF
Sbjct  121  KVAVDGTSYHRACF  134


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F GT  KC +C+KTVY ++++  D   YH+ACF+C H    +  SNY + +  LYC+ 
Sbjct  100  ALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRH  159

Query  237  HFDQLFKMTGSL  272
            H  QLFK  G+ 
Sbjct  160  HHTQLFKQRGNF  171



>gb|KDP31140.1| hypothetical protein JCGZ_11516 [Jatropha curcas]
Length=191

 Score =   251 bits (640),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +++ADQ HT+SKVSS+FAGTQDKCVACKKTVYP+
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDKSADQVHTNSKVSSMFAGTQDKCVACKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH+ACF
Sbjct  121  EKVAVDGMSYHKACF  135


 Score = 75.9 bits (185),  Expect = 6e-14, Method: Compositional matrix adjust.
 Identities = 40/85 (47%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  101  SMFAGTQDKCVACKKTVYPLEKVAVDGMSYHKACFRCTHGGCVISPSNYVAHEQRLYCRH  160

Query  237  HFDQLFKMTGS---LDKSFEGAPKT  302
            H +QLFK  G+   LDK     P T
Sbjct  161  HHNQLFKQKGNFSQLDKQEHAKPVT  185



>ref|XP_002511450.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52052.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=190

 Score =   249 bits (637),  Expect = 3e-81, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 130/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +R+ADQ +++S+VSS+FAGTQDKCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRSADQFNSNSRVSSMFAGTQDKCVACKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  121  EKVAVDGTSYHKACF  135


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 55/92 (60%), Gaps = 5/92 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  101  SMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQRLYCRH  160

Query  237  HFDQLFKMTGS---LDKSFEGAPKTVRERAAD  323
            H +QLFK  G+   LDK     P  V E AA+
Sbjct  161  HHNQLFKQKGNFSQLDKHEHVKP--VTETAAE  190



>emb|CDP17006.1| unnamed protein product [Coffea canephora]
Length=190

 Score =   249 bits (636),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCK CEKTVYLVDQL+AD+KVYHK+CFRC HC+GTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKTCEKTVYLVDQLQADSKVYHKSCFRCHHCRGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEGAPKT R +R A+QG T+SKVSS+FAGTQDKCVACKKTVYP+
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTARADRVANQGQTNSKVSSMFAGTQDKCVACKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYHRACF
Sbjct  121  EKVAVDGTSYHRACF  135


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YH+ACFRC H    +  SNY + +  LYC+ 
Sbjct  101  SMFAGTQDKCVACKKTVYPLEKVAVDGTSYHRACFRCSHGGCMISPSNYIAHDHKLYCRH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  161  HHSQLFKKKGNFSQ  174



>ref|XP_010272036.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=183

 Score =   249 bits (635),  Expect = 5e-81, Method: Compositional matrix adjust.
 Identities = 120/135 (89%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLV+QL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVEQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEGAPK  R +R++DQG+ +SKVSSLF+GTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKVARTDRSSDQGNANSKVSSLFSGTQEKCVACKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYHRACF
Sbjct  121  EKVAVDGTSYHRACF  135


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/74 (42%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC AC+KTVY ++++  D   YH+ACF+C H    +  SNY + E  +YC+ 
Sbjct  101  SLFSGTQEKCVACKKTVYPIEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHEQRIYCRH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  161  HHSQLFKEKGNFSQ  174



>ref|XP_009610583.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Nicotiana 
tomentosiformis]
Length=190

 Score =   248 bits (633),  Expect = 1e-80, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL+AD+KVYHKACFRC HCKGTLKLSNYNS+EGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKACFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFE-GAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL+KSFE GAP+T RER+ADQG ++SKVS+LF GTQDKCV+CKKTVYP+
Sbjct  61   PHFDQLFKMTGSLNKSFEVGAPRTARERSADQGQSNSKVSALFGGTQDKCVSCKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYHRACF
Sbjct  121  EKVAVDGTSYHRACF  135


 Score = 66.6 bits (161),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F GT  KC +C+KTVY ++++  D   YH+ACF+C H    +  SNY + +  LYC+ 
Sbjct  101  ALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRH  160

Query  237  HFDQLFKMTGSL  272
            H  QLFK  G+ 
Sbjct  161  HHTQLFKQRGNF  172



>ref|XP_004299580.1| PREDICTED: LIM domain-containing protein WLIM1-like [Fragaria 
vesca subsp. vesca]
Length=188

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 2/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEG PK VR+R+ADQ   +SKVSS+FAGTQDKCVACKKTVYPIE
Sbjct  61   PHFDQLFKMTGSLDKSFEGNPKIVRDRSADQ--VNSKVSSMFAGTQDKCVACKKTVYPIE  118

Query  414  KVAVDGTSYHRACF  455
            KV VDGTSYH+ACF
Sbjct  119  KVGVDGTSYHKACF  132


 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 51/85 (60%), Gaps = 3/85 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYCK 
Sbjct  98   SMFAGTQDKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCKH  157

Query  237  HFDQLFKMTGS---LDKSFEGAPKT  302
            H +QLFK  G+   LDK  E    T
Sbjct  158  HHNQLFKQKGNFSQLDKHEEAKEVT  182



>gb|AAX95760.2| Pollen-specific protein SF3, putative [Solanum lycopersicum]
Length=184

 Score =   248 bits (632),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 122/139 (88%), Positives = 128/139 (92%), Gaps = 6/139 (4%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MASFGGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEGAPKTVRER+ADQG ++SKVSSLF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTVRERSADQG-SNSKVSSLFGGTQDKCVACKKTVYPLE  119

Query  414  K-----VAVDGTSYHRACF  455
            K     VAVDGTSYHR CF
Sbjct  120  KTRAEQVAVDGTSYHRPCF  138


 Score = 63.5 bits (153),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 45/79 (57%), Gaps = 5/79 (6%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRA-----DNKVYHKACFRCFHCKGTLKLSNYNSFEGV  221
            + F GT  KC AC+KTVY +++ RA     D   YH+ CF+C H    +  SNY + E  
Sbjct  99   SLFGGTQDKCVACKKTVYPLEKTRAEQVAVDGTSYHRPCFKCSHGGCVISPSNYVAHEHR  158

Query  222  LYCKPHFDQLFKMTGSLDK  278
            LYC+ H  QLFK  G+  +
Sbjct  159  LYCRHHHTQLFKERGNFSQ  177



>ref|XP_002283525.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI15078.3| unnamed protein product [Vitis vinifera]
Length=182

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 127/134 (95%), Gaps = 2/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVD+L ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDELTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEGAPKTV  R+ DQG T+SKVSS+FAGTQ+KCVACKKTVYPIE
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTV--RSVDQGQTNSKVSSMFAGTQEKCVACKKTVYPIE  118

Query  414  KVAVDGTSYHRACF  455
            KV VDGTSYH+ACF
Sbjct  119  KVGVDGTSYHKACF  132


 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 36/74 (49%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H   T+  SNY + E  LYC+ 
Sbjct  98   SMFAGTQEKCVACKKTVYPIEKVGVDGTSYHKACFRCTHGGCTISPSNYIAHEHRLYCRH  157

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  158  HHSQLFKEKGNFSQ  171



>ref|XP_009786244.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   247 bits (631),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 129/135 (96%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL+AD+KVYHK+CFRC HCKGTLKLSNYNS+EGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSKVYHKSCFRCHHCKGTLKLSNYNSYEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFE-GAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL+KSFE GAP+T RER+ADQG ++SKVS+LF GTQDKCV+CKKTVYP+
Sbjct  61   PHFDQLFKMTGSLNKSFEVGAPRTARERSADQGQSNSKVSALFGGTQDKCVSCKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYHRACF
Sbjct  121  EKVAVDGTSYHRACF  135


 Score = 66.6 bits (161),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F GT  KC +C+KTVY ++++  D   YH+ACF+C H    +  SNY + +  LYC+ 
Sbjct  101  ALFGGTQDKCVSCKKTVYPLEKVAVDGTSYHRACFKCSHGGCVISPSNYVAHDHKLYCRH  160

Query  237  HFDQLFKMTGSL  272
            H  QLFK  G+ 
Sbjct  161  HHTQLFKQRGNF  172



>ref|XP_010111544.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXC31177.1| Pollen-specific protein SF3 [Morus notabilis]
Length=201

 Score =   247 bits (630),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 118/134 (88%), Positives = 126/134 (94%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCK TLKLS+Y+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKRTLKLSDYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQL KMTGSLDKSFEG PKTVR+R+ADQ  T+S+VS LFAGTQ+KCVACKKTVYPIE
Sbjct  61   PHFDQLLKMTGSLDKSFEGTPKTVRDRSADQIQTNSRVSRLFAGTQEKCVACKKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYH+ACF
Sbjct  121  KVAVDGTSYHKACF  134


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/75 (52%), Positives = 48/75 (64%), Gaps = 3/75 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYCK H 
Sbjct  102  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEQRLYCKHHH  161

Query  243  DQLFKMTGS---LDK  278
             QLFK  G+   LDK
Sbjct  162  TQLFKAKGNFSQLDK  176



>ref|XP_007138113.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
 gb|ESW10107.1| hypothetical protein PHAVU_009G181200g [Phaseolus vulgaris]
Length=191

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNK+YHK+CFRC+HCKGTLKLSNY SFEGVLYCK
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ADQ HT+SKVS+LFAGTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLFKKTGSLDKSFEGIPRTARLERSADQVHTNSKVSNLFAGTQEKCVACKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  121  EKVAVDGTSYHKACF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  TQLFKQKGNFSQ  174



>ref|XP_006439752.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 ref|XP_006476731.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR52992.1| hypothetical protein CICLE_v10022413mg [Citrus clementina]
 gb|KDO69762.1| hypothetical protein CISIN_1g029735mg [Citrus sinensis]
Length=189

 Score =   245 bits (626),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 122/135 (90%), Positives = 128/135 (95%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY SFEGVLYCK
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR ER+ADQ  T+S+VSS+FAGTQDKCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVERSADQV-TNSRVSSMFAGTQDKCVACKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  120  EKVAVDGTSYHKACF  134


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  100  SMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRH  159

Query  237  HFDQLFKMTGSLDK  278
            H +QLFK  G+  +
Sbjct  160  HHNQLFKQKGNFSQ  173



>ref|XP_010254782.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=191

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 117/135 (87%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKAC+KTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACQKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEGAPK  R +++ DQG+ ++KVS+LFAGTQDKCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKVSRTDKSVDQGNANNKVSTLFAGTQDKCVACKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG+SYH+ACF
Sbjct  121  EKVAVDGSSYHKACF  135


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/76 (49%), Positives = 48/76 (63%), Gaps = 3/76 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC AC+KTVY ++++  D   YHKACF+C H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQDKCVACKKTVYPIEKVAVDGSSYHKACFKCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTGS---LDKS  281
             QLFK  G+   LDK+
Sbjct  163  SQLFKEKGNFSQLDKN  178



>ref|XP_011087164.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=188

 Score =   244 bits (622),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKV+HKACFRC HCKGTLKLSNY+S+EGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYSSYEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEGAPKT R ER+ + G T+SKVSSLFAGTQDKCVAC K VYP+
Sbjct  61   PHFDQLFKMTGSLDKSFEGAPKTARAERSVEPGVTNSKVSSLFAGTQDKCVACNKKVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYHRACF
Sbjct  121  EKVAVDGTSYHRACF  135


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 37/79 (47%), Positives = 48/79 (61%), Gaps = 3/79 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC AC K VY ++++  D   YH+ACF+C H   T+  SNY + E  LYC+ H 
Sbjct  103  FAGTQDKCVACNKKVYPLEKVAVDGTSYHRACFKCSHGGCTISPSNYVAHEHQLYCRHHH  162

Query  243  DQLFKMTGS---LDKSFEG  290
             QLFK  G+   LDK  +G
Sbjct  163  TQLFKQKGNFSQLDKHEQG  181



>ref|XP_011028613.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   243 bits (621),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 118/135 (87%), Positives = 128/135 (95%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKAC+KTVYLVDQL  DNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACDKTVYLVDQLTVDNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +R+ADQ  ++SKVSS+FAGTQ+KCVACKKTVYP+
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRGDRSADQVLSNSKVSSMFAGTQEKCVACKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  121  EKVAVDGTSYHKACF  135


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  101  SMFAGTQEKCVACKKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHSLYCRH  160

Query  237  HFDQLFKMTGSLDK  278
            H +QLFK  G+  +
Sbjct  161  HHNQLFKEKGNFSQ  174



>ref|XP_007209651.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
 ref|XP_008239721.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
 gb|EMJ10850.1| hypothetical protein PRUPE_ppa012024mg [Prunus persica]
Length=187

 Score =   243 bits (620),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 119/134 (89%), Positives = 124/134 (93%), Gaps = 2/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEG PKTVR+R+      +SKVSSLFAGTQDKCVACKKTVYPIE
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKTVRDRSEQV--NNSKVSSLFAGTQDKCVACKKTVYPIE  118

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYH+ CF
Sbjct  119  KVAVDGTSYHKPCF  132


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHK CFRC H    +  SNY + E  LYC+ 
Sbjct  98   SLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRLYCRH  157

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  158  HHSQLFKEKGNFSQ  171



>ref|XP_008393059.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   243 bits (620),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/134 (90%), Positives = 125/134 (93%), Gaps = 3/134 (2%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQ  ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQXTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEG PKTVRER +DQ  T+SKVSSLFAGTQDKCVACKKTVYPIE
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKTVRER-SDQ--TNSKVSSLFAGTQDKCVACKKTVYPIE  117

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYH+ CF
Sbjct  118  KVAVDGTSYHKPCF  131


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHK CFRC H    +  SNY + E  LYC+ 
Sbjct  97   SLFAGTQDKCVACKKTVYPIEKVAVDGTSYHKPCFRCTHGGCVISPSNYVAHEHRLYCRH  156

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  157  HHSQLFKEKGNFSQ  170



>gb|KHG14633.1| Pollen-specific SF3 [Gossypium arboreum]
Length=189

 Score =   243 bits (619),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 127/135 (94%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +R+ADQ  T+SK S LFAGTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRSADQV-TNSKFSGLFAGTQEKCVACKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  120  EKVAVDGTSYHKACF  134


 Score = 75.1 bits (183),  Expect = 9e-14, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 3/79 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  102  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  161

Query  243  DQLFKMTGS---LDKSFEG  290
            +QLFK  G+   LDK  E 
Sbjct  162  NQLFKQKGNFSQLDKHEEA  180



>gb|AII80542.1| LIM-domain protein 8 [Gossypium hirsutum]
 gb|KJB53229.1| hypothetical protein B456_008G297600 [Gossypium raimondii]
Length=189

 Score =   243 bits (619),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 121/135 (90%), Positives = 127/135 (94%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +R+ADQ  T+SK S LFAGTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRVDRSADQV-TNSKFSGLFAGTQEKCVACKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  120  EKVAVDGTSYHKACF  134


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  102  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  161

Query  243  DQLFKMTGSLDK  278
            +QLFK  G+  +
Sbjct  162  NQLFKQKGNFSQ  173



>ref|XP_008374471.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=188

 Score =   242 bits (617),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 120/134 (90%), Positives = 126/134 (94%), Gaps = 3/134 (2%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL ADNK+YHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADNKIYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSLDKSFEG PKTVRER +DQ  T+SKVS+LFAGTQDKCVACKKTVY IE
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPKTVRER-SDQ--TNSKVSNLFAGTQDKCVACKKTVYXIE  117

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYH+ CF
Sbjct  118  KVAVDGTSYHKPCF  131


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC AC+KTVY ++++  D   YHK CFRC H    +  SNY + E  LYC+ H 
Sbjct  99   FAGTQDKCVACKKTVYXIEKVAVDGTSYHKPCFRCSHGGCVISPSNYVAHEHRLYCRHHH  158

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  159  SQLFKEKGNFSQ  170



>gb|KHN16307.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   242 bits (617),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNK+YHK+CFRC+HCKGTLKLSNY SFEGVLYCK
Sbjct  2    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  61

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ADQ  T++KVS+LFAGTQ+KCVACKKTVYPI
Sbjct  62   PHFDQLFKKTGSLDKSFEGIPRTARLERSADQVQTNTKVSNLFAGTQEKCVACKKTVYPI  121

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  122  EKVAVDGTSYHKACF  136


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 57/96 (59%), Gaps = 8/96 (8%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVS  350
             QLFK  G+  +        + ++  D+G T ++++
Sbjct  164  TQLFKQKGNFSQ--------LDKQENDEGVTENRIT  191



>ref|NP_001238190.1| uncharacterized protein LOC100500444 [Glycine max]
 gb|ACU15531.1| unknown [Glycine max]
Length=192

 Score =   241 bits (616),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 127/135 (94%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNK+YHK+CFRC+HCKGTLKLSNY SFEGVLYCK
Sbjct  2    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  61

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ADQ  T++KVS+LFAGTQ+KCVACKKTVYPI
Sbjct  62   PHFDQLFKKTGSLDKSFEGIPRTARLERSADQVQTNTKVSNLFAGTQEKCVACKKTVYPI  121

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  122  EKVAVDGTSYHKACF  136


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  164  TQLFKQKGNFSQ  175



>gb|KHN19331.1| Pollen-specific protein SF3 [Glycine soja]
Length=192

 Score =   241 bits (616),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/135 (86%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNK+YHK+CFRC+HCKGTLKLSNY SFEGVLYCK
Sbjct  2    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  61

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ DQ  T+SKVS+LFAGTQ+KCVACKKTVYPI
Sbjct  62   PHFDQLFKKTGSLDKSFEGIPRTARLERSTDQVQTNSKVSNLFAGTQEKCVACKKTVYPI  121

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  122  EKVAVDGTSYHKACF  136


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  164  TQLFKQKGNFSQ  175



>ref|XP_007036121.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 ref|XP_007036122.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20622.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
 gb|EOY20623.1| GATA type zinc finger transcription factor family protein isoform 
2 [Theobroma cacao]
Length=189

 Score =   240 bits (613),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 119/135 (88%), Positives = 128/135 (95%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL AD+KVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG PKTVR +R+ADQ  T+S+VSSLFAGTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLFKRTGSLDKSFEGTPKTVRVDRSADQV-TNSRVSSLFAGTQEKCVACKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG+SYH+ACF
Sbjct  120  EKVAVDGSSYHKACF  134


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  100  SLFAGTQEKCVACKKTVYPIEKVAVDGSSYHKACFRCTHGGCVISPSNYVAHEQRLYCRH  159

Query  237  HFDQLFKMTGS---LDKSFE  287
            H +QLFK  G+   LDK  E
Sbjct  160  HHNQLFKQKGNFSQLDKHEE  179



>ref|XP_004236135.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=189

 Score =   240 bits (612),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL+AD++VYHKACFRC HCKGTLKL NYNS+EGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSRVYHKACFRCNHCKGTLKLGNYNSYEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSL+KSFEG P+TV+ER+ D+   ++KVS+LF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLNKSFEGGPRTVKERSLDKAQANNKVSALFGGTQDKCVACKKTVYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHR CF
Sbjct  121  KVAVDGTSYHRPCF  134


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F GT  KC AC+KTVY ++++  D   YH+ CF+C H    +  SNY + +  LYC+ 
Sbjct  100  ALFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCVISPSNYVAHDHKLYCRH  159

Query  237  HFDQLFKMTGSL  272
            H  QLFK  G+ 
Sbjct  160  HHTQLFKQRGNF  171



>ref|XP_006345025.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=189

 Score =   239 bits (609),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 109/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL+AD++VYHK+CFRC HCKGTLKL NYNS+EGVLYC+
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLKADSRVYHKSCFRCNHCKGTLKLGNYNSYEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSL+KSFEG P+TV+ER+ D+   ++KVS+LF GTQDKCVACKKTVYP+E
Sbjct  61   PHFDQLFKMTGSLNKSFEGGPRTVKERSLDKAQAANKVSALFGGTQDKCVACKKTVYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYHR CF
Sbjct  121  KVAVDGTSYHRPCF  134


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F GT  KC AC+KTVY ++++  D   YH+ CF+C H    +  SNY + +  LYC+ 
Sbjct  100  ALFGGTQDKCVACKKTVYPLEKVAVDGTSYHRPCFKCSHGGCIISPSNYVAHDHKLYCRH  159

Query  237  HFDQLFKMTGSL  272
            H  QLFK  G+ 
Sbjct  160  HHTQLFKQRGNF  171



>ref|XP_002321571.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
 gb|EEF05698.1| hypothetical protein POPTR_0015s08360g [Populus trichocarpa]
Length=191

 Score =   238 bits (608),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKAC+KTVYLVDQL  DNK YHKACFRC HCKGTLKLSNY+SFEGVLYC+
Sbjct  1    MATFAGTTQKCKACDKTVYLVDQLTVDNKFYHKACFRCHHCKGTLKLSNYSSFEGVLYCQ  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG PKTVR +R+ADQ  ++SKVSS+FAGTQ+KCVAC KTVYP+
Sbjct  61   PHFDQLFKMTGSLDKSFEGTPKTVRGDRSADQVLSNSKVSSMFAGTQEKCVACNKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  121  EKVAVDGTSYHKACF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  101  SMFAGTQEKCVACNKTVYPLEKVAVDGTSYHKACFRCAHGGCVISPSNYVAHEHRLYCRH  160

Query  237  HFDQLFKMTGSLDK  278
            H +QLFK  G+  +
Sbjct  161  HHNQLFKEKGNFSQ  174



>ref|NP_001235271.1| uncharacterized protein LOC100500501 [Glycine max]
 gb|ACU15600.1| unknown [Glycine max]
Length=192

 Score =   237 bits (605),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL ADNK+YHK+CFRC+HCKGTLKLSNY SFEGVLYCK
Sbjct  2    MASFAGTTQKCKACEKTVYLVDQLTADNKIYHKSCFRCYHCKGTLKLSNYCSFEGVLYCK  61

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ DQ  T++KVS+LFAGTQ+KCVACKKTVYPI
Sbjct  62   PHFDQLFKKTGSLDKSFEGIPRTARLERSTDQVQTNNKVSNLFAGTQEKCVACKKTVYPI  121

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGT YH+ACF
Sbjct  122  EKVAVDGTFYHKACF  136


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/96 (40%), Positives = 56/96 (58%), Gaps = 8/96 (8%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ H 
Sbjct  104  FAGTQEKCVACKKTVYPIEKVAVDGTFYHKACFRCTHGGCVISPSNYVAHEHRLYCRHHH  163

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVS  350
             QLFK  G+  +        + ++  D+G T + ++
Sbjct  164  TQLFKQKGNFSQ--------LDKQENDEGVTENTIT  191



>ref|XP_011044348.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=191

 Score =   235 bits (599),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGTTQKCK+CEKTVY VDQL ADNKVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MAPFAGTTQKCKSCEKTVYFVDQLTADNKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQL KMTGSLDKSF+G  KTVR +R+ADQ  ++SKVSS+FAGTQ+KCVACKKTVYP+
Sbjct  61   PHFDQLLKMTGSLDKSFKGTSKTVRGDRSADQVQSNSKVSSMFAGTQEKCVACKKTVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            E+VAVDGTSYH+ACF
Sbjct  121  ERVAVDGTSYHKACF  135


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 56/93 (60%), Gaps = 5/93 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SN+ + E  LYC+ 
Sbjct  101  SMFAGTQEKCVACKKTVYPLERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEHRLYCRH  160

Query  237  HFDQLFKMTGS---LDKSFEGAPKTVRERAADQ  326
            H +QLFK  G+    DK    AP  V E AA +
Sbjct  161  HHNQLFKQKGNFSQFDKHEHVAP--VNETAAAE  191



>ref|XP_010678700.1| PREDICTED: LIM domain-containing protein WLIM1-like [Beta vulgaris 
subsp. vulgaris]
Length=227

 Score =   236 bits (602),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GTTQKCKACEKTVYLVDQL AD KV+HKACFRC HCK TLKL N++SFEGVLYCK
Sbjct  1    MATFGGTTQKCKACEKTVYLVDQLTADGKVFHKACFRCHHCKSTLKLHNFSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHF QLFKMTGSLDKSFE AP+TVR+R+ +QG T+SKVSS+F GTQ+KCV+CKKTVYPIE
Sbjct  61   PHFAQLFKMTGSLDKSFEAAPRTVRDRSYEQGQTNSKVSSMFGGTQEKCVSCKKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KVAVDG SYH+ACF
Sbjct  121  KVAVDGDSYHKACF  134


 Score = 72.8 bits (177),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC +C+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  100  SMFGGTQEKCVSCKKTVYPIEKVAVDGDSYHKACFRCSHGGCVISPSNYVAHEHRLYCRH  159

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  160  HHSQLFKQKGNFSQ  173



>ref|XP_010027995.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW83415.1| hypothetical protein EUGRSUZ_B00345 [Eucalyptus grandis]
Length=182

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 115/135 (85%), Positives = 126/135 (93%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT FAGT QKCKAC+KTVYLVDQL ADNKV+HKACFRC HCKGTLKLSNY SFEGVLYC
Sbjct  1    MATAFAGTQQKCKACDKTVYLVDQLTADNKVFHKACFRCHHCKGTLKLSNYCSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            KPHF+QLFKMTGSLDKSFEG PKTV  R+++QG +++KVSS+FAGTQDKCVACKKTVYPI
Sbjct  61   KPHFNQLFKMTGSLDKSFEGTPKTVN-RSSEQGQSNAKVSSMFAGTQDKCVACKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTSYH+ACF
Sbjct  120  EKVAVDGTSYHKACF  134


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/74 (47%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  100  SMFAGTQDKCVACKKTVYPIEKVAVDGTSYHKACFRCTHGGCVISPSNYVAHEHRLYCRH  159

Query  237  HFDQLFKMTGSLDK  278
            H +QLFK  G+  +
Sbjct  160  HHNQLFKEKGNFSQ  173



>ref|XP_002318024.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
 gb|EEE96244.1| hypothetical protein POPTR_0012s07870g [Populus trichocarpa]
Length=191

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 125/135 (93%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGTTQKCK+CEKTVY VDQL AD+KVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MAPFAGTTQKCKSCEKTVYFVDQLTADDKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQL KMTGSLDKSF+G  KTVR +R+ADQ  ++SKVSS+FAGTQ+KCVACKKTVYPI
Sbjct  61   PHFDQLLKMTGSLDKSFKGTSKTVRVDRSADQVQSNSKVSSMFAGTQEKCVACKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+VAVDGTSYH+ACF
Sbjct  121  ERVAVDGTSYHKACF  135


 Score = 76.3 bits (186),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 42/91 (46%), Positives = 56/91 (62%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SN+ + E  LYC+ 
Sbjct  101  SMFAGTQEKCVACKKTVYPIERVAVDGTSYHKACFRCAHGGCVISPSNFVAHEHRLYCRH  160

Query  237  HFDQLFKMTGS---LDKSFEGAPKTVRERAA  320
            H +QLFK  G+   LDK     P  V+E AA
Sbjct  161  HHNQLFKQKGNFSQLDKHEHVTP--VKETAA  189



>ref|XP_007036120.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY20621.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=207

 Score =   232 bits (591),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 127/152 (84%), Gaps = 18/152 (12%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKCKACEKTVYLVDQL AD+KVYHKACFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFAGTTQKCKACEKTVYLVDQLTADSKVYHKACFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGH-----------------TSSKVSSLF  359
            PHFDQLFK TGSLDKSFEG PKTVR +R+AD                    T+S+VSSLF
Sbjct  61   PHFDQLFKRTGSLDKSFEGTPKTVRVDRSADHALKVVLPYLLLILSGTLQVTNSRVSSLF  120

Query  360  AGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            AGTQ+KCVACKKTVYPIEKVAVDG+SYH+ACF
Sbjct  121  AGTQEKCVACKKTVYPIEKVAVDGSSYHKACF  152


 Score = 75.5 bits (184),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 39/80 (49%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY + E  LYC+ 
Sbjct  118  SLFAGTQEKCVACKKTVYPIEKVAVDGSSYHKACFRCTHGGCVISPSNYVAHEQRLYCRH  177

Query  237  HFDQLFKMTGS---LDKSFE  287
            H +QLFK  G+   LDK  E
Sbjct  178  HHNQLFKQKGNFSQLDKHEE  197



>ref|XP_006836719.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
 gb|ERM99572.1| hypothetical protein AMTR_s00088p00121090 [Amborella trichopoda]
Length=192

 Score =   231 bits (589),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 122/133 (92%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC+ACEKTVYLVDQL ADN+VYHKACFRC HC GTLKLSNY+SFEGVLYCKPHF
Sbjct  3    FAGTTQKCQACEKTVYLVDQLTADNRVYHKACFRCHHCNGTLKLSNYSSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ +++ D +GH ++KVSSLFAGTQDKCVACKKTVYPIEK
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKADKSVDHEGHATNKVSSLFAGTQDKCVACKKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            VAVDGTSYHR CF
Sbjct  123  VAVDGTSYHRPCF  135


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC+KTVY ++++  D   YH+ CF+C H    +  SNY + EG LYCK 
Sbjct  101  SLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRPCFKCTHGGCVISPSNYVAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H +QLFK  G+  +
Sbjct  161  HHNQLFKEKGNFSQ  174



>ref|XP_010037591.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW49320.1| hypothetical protein EUGRSUZ_K02874 [Eucalyptus grandis]
Length=191

 Score =   231 bits (588),  Expect = 9e-74, Method: Compositional matrix adjust.
 Identities = 110/134 (82%), Positives = 122/134 (91%), Gaps = 2/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF+GTTQKCKACEKTVY V+QL ADNKVYH+ CFRC HCKGTLKLSNY+SFEGVLYCK
Sbjct  1    MATFSGTTQKCKACEKTVYFVEQLTADNKVYHRTCFRCHHCKGTLKLSNYSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHFDQLFKMTGSL+KSFEG P+TV +  +DQ  T+SKVS  F+GTQ+KCVACKKTVYPIE
Sbjct  61   PHFDQLFKMTGSLNKSFEGTPRTVNK--SDQVQTNSKVSRFFSGTQEKCVACKKTVYPIE  118

Query  414  KVAVDGTSYHRACF  455
            KVAVDGTSYH+ACF
Sbjct  119  KVAVDGTSYHKACF  132


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 41/92 (45%), Positives = 54/92 (59%), Gaps = 5/92 (5%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC AC+KTVY ++++  D   YHKACFRC H    +  SNY +    LYCK H 
Sbjct  100  FSGTQEKCVACKKTVYPIEKVAVDGTSYHKACFRCSHGGCVISPSNYITHLNRLYCKHHH  159

Query  243  DQLFKMTGS---LDK--SFEGAPKTVRERAAD  323
            +QLFK+ G+   LDK    E  PK      A+
Sbjct  160  NQLFKVKGNFSQLDKHAKIEEVPKLPVAEVAE  191



>ref|XP_011071800.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Sesamum indicum]
Length=182

 Score =   229 bits (584),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/135 (82%), Positives = 120/135 (89%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKCKACEKTVYLVDQL AD KVYHK CFRC HCKGTLKLSNY S+EGVLYCK
Sbjct  1    MASFAGTTQKCKACEKTVYLVDQLTADTKVYHKTCFRCHHCKGTLKLSNYCSYEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHF+QLFKMTGSLDKSFEGAP+T R +R+ +Q  T SK SSLFAGTQDKCVAC K VYP+
Sbjct  61   PHFNQLFKMTGSLDKSFEGAPRTARADRSTEQAPTYSKFSSLFAGTQDKCVACNKKVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG+SYHR CF
Sbjct  121  EKVAVDGSSYHRTCF  135


 Score = 66.2 bits (160),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC AC K VY ++++  D   YH+ CF+C H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQDKCVACNKKVYPLEKVAVDGSSYHRTCFKCSHSGCVISPSNYIAHEHRLYCRHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  TQLFKQKGNFSQ  174



>ref|XP_008453121.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
Length=186

 Score =   227 bits (579),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 119/132 (90%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKCKAC+KTVYLVDQL ADNKVYHKACFRC HCK TLKL NY+SFEGVLYCKPHF
Sbjct  5    FLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKPHF  64

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFKMTGSL+KSFEG P+TVR +R+ +Q  T+SK+SSLFAGTQDKCV CKKTVYPIEKV
Sbjct  65   DQLFKMTGSLEKSFEGTPRTVRTDRSTNQVQTNSKLSSLFAGTQDKCVTCKKTVYPIEKV  124

Query  420  AVDGTSYHRACF  455
            AVD  SYHRACF
Sbjct  125  AVDSKSYHRACF  136


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC  C+KTVY ++++  D+K YH+ACFRC H    +  SNY + E  LYC+ 
Sbjct  102  SLFAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRH  161

Query  237  HFDQLFKMTGS---LDKSFE  287
            H +QLFK  G+   LDK  E
Sbjct  162  HHNQLFKQKGNFSQLDKHEE  181



>ref|XP_003550749.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN18484.1| Pollen-specific protein SF3 [Glycine soja]
Length=209

 Score =   227 bits (579),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/135 (80%), Positives = 121/135 (90%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKC ACEK VY V+QL ADNKVYHK+CFRC HCKGTLKLSNY SFEGVLYCK
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG P++ R ER+ADQ  +++KVS LF+GTQ+KCV CKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGIPRSARVERSADQVQSNNKVSRLFSGTQEKCVGCKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH++CF
Sbjct  121  EKVAVDGKSYHKSCF  135


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C+KTVY ++++  D K YHK+CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  TQLFKQKGNFSQ  174



>ref|XP_004138126.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155009.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN63605.1| Pollen-specific protein SF3 [Cucumis sativus]
Length=186

 Score =   225 bits (574),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 118/132 (89%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKCKAC+KTVYLVDQL ADNKVYHKACFRC HCK TLKL NY+SFEGVLYCKPHF
Sbjct  5    FLGTTQKCKACDKTVYLVDQLTADNKVYHKACFRCHHCKSTLKLFNYSSFEGVLYCKPHF  64

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFKMTGSL+KSFE  P+TVR +R+ +Q  T+SK+SSLFAGTQDKCV CKKTVYPIEKV
Sbjct  65   DQLFKMTGSLEKSFEATPRTVRTDRSTNQVQTNSKLSSLFAGTQDKCVTCKKTVYPIEKV  124

Query  420  AVDGTSYHRACF  455
            AVD  SYHRACF
Sbjct  125  AVDSKSYHRACF  136


 Score = 73.9 bits (180),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 38/80 (48%), Positives = 51/80 (64%), Gaps = 3/80 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC  C+KTVY ++++  D+K YH+ACFRC H    +  SNY + E  LYC+ 
Sbjct  102  SLFAGTQDKCVTCKKTVYPIEKVAVDSKSYHRACFRCSHGGCVISPSNYIAHEHRLYCRH  161

Query  237  HFDQLFKMTGS---LDKSFE  287
            H +QLFK  G+   LDK  E
Sbjct  162  HHNQLFKQKGNFSQLDKHEE  181



>gb|EYU29934.1| hypothetical protein MIMGU_mgv1a014656mg [Erythranthe guttata]
Length=182

 Score =   223 bits (569),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/134 (79%), Positives = 115/134 (86%), Gaps = 1/134 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + + GTTQKCKACEKTVYLVDQL ADNKVYHK CFRC HC  TLKLSNY+S+EGVLYCKP
Sbjct  3    SLYGGTTQKCKACEKTVYLVDQLTADNKVYHKPCFRCHHCNATLKLSNYSSYEGVLYCKP  62

Query  237  HFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            HFDQLFKMTGSLDKSFEG PKT R +R+ D G  +SK SS+FAGTQDKCVAC KTVYP+E
Sbjct  63   HFDQLFKMTGSLDKSFEGGPKTSRIDRSTDHGAANSKFSSMFAGTQDKCVACSKTVYPLE  122

Query  414  KVAVDGTSYHRACF  455
            KV VDG SYHR CF
Sbjct  123  KVGVDGVSYHRPCF  136


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/80 (45%), Positives = 48/80 (60%), Gaps = 3/80 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC AC KTVY ++++  D   YH+ CF+C H    +  SNY + E  LYC+ 
Sbjct  102  SMFAGTQDKCVACSKTVYPLEKVGVDGVSYHRPCFKCSHGGCVISPSNYVAHEHQLYCRH  161

Query  237  HFDQLFKMTGS---LDKSFE  287
            H +QLFK  G+   LDK  E
Sbjct  162  HHNQLFKQKGNFSQLDKHEE  181



>gb|EYU42534.1| hypothetical protein MIMGU_mgv1a021971mg [Erythranthe guttata]
Length=188

 Score =   223 bits (568),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 116/135 (86%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA + GT QKCK C KTVYLVDQL ADNKVYH  CFRC HCKGTLKLSNY+S+EGVLYCK
Sbjct  1    MANYGGTNQKCKTCYKTVYLVDQLTADNKVYHNFCFRCHHCKGTLKLSNYSSYEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL+KSFEGAPKT R ER+ +QG T+SK SSLF GTQDKC+AC K VYP+
Sbjct  61   PHFDQLFKMTGSLNKSFEGAPKTARAERSNEQGPTNSKFSSLFGGTQDKCIACDKKVYPL  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGT YHR CF
Sbjct  121  EKVAVDGTLYHRCCF  135


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 44/74 (59%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC AC+K VY ++++  D  +YH+ CF+C H    +  SNY + E  LYC+ 
Sbjct  101  SLFGGTQDKCIACDKKVYPLEKVAVDGTLYHRCCFKCSHGGCVISPSNYIAHEHRLYCRH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLF+  G+  K
Sbjct  161  HHTQLFRQKGNFSK  174



>ref|XP_007155394.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
 gb|ESW27388.1| hypothetical protein PHAVU_003G197600g [Phaseolus vulgaris]
Length=204

 Score =   223 bits (569),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKC ACEK VY V+QL ADNK+YHK+CFRC HCKGTLKL NY SFEGVLYCK
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKLYHKSCFRCHHCKGTLKLGNYCSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL+KSFEG P+  R ER+ADQ  T++K+S LF+GTQ+KCV CKKTVYPI
Sbjct  61   PHFDQLFKMTGSLEKSFEGIPRIARVERSADQVQTNNKISRLFSGTQEKCVVCKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH++CF
Sbjct  121  EKVAVDGKSYHKSCF  135


 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 37/97 (38%), Positives = 55/97 (57%), Gaps = 0/97 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C+KTVY ++++  D K YHK+CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FSGTQEKCVVCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSS  353
             QLFK  G+  +  +     +  +   Q H S+  +S
Sbjct  163  TQLFKQKGNFSQLVKHENLQLTTQNTTQLHPSNGSAS  199



>ref|XP_003525489.1| PREDICTED: pollen-specific protein SF3-like [Glycine max]
 gb|KHN48618.1| Pollen-specific protein SF3 [Glycine soja]
Length=215

 Score =   224 bits (570),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 109/135 (81%), Positives = 120/135 (89%), Gaps = 2/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKC ACEK VY V+QL ADNKVYHK+CFRC HCKGTLKLSNY SFEGVLYCK
Sbjct  1    MASFAGTTQKCTACEKKVYWVEQLTADNKVYHKSCFRCHHCKGTLKLSNYCSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHF QLFKMTGSLDKSFEG P++VR ER+ADQ  T +KVS LF+GTQ+KCV CKKTVYPI
Sbjct  61   PHFHQLFKMTGSLDKSFEGVPRSVRVERSADQVQT-NKVSRLFSGTQEKCVGCKKTVYPI  119

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH++CF
Sbjct  120  EKVAVDGKSYHKSCF  134


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C+KTVY ++++  D K YHK+CFRC H    +  SNY + E  LYC+ H 
Sbjct  102  FSGTQEKCVGCKKTVYPIEKVAVDGKSYHKSCFRCTHGGCVISPSNYIAHEHRLYCRHHH  161

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  162  TQLFKQKGNFSQ  173



>ref|XP_004501954.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   221 bits (563),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 105/135 (78%), Positives = 119/135 (88%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            M +FAGTTQKCKACEK VYLVDQL ADNKVYHK+CFRC HCKGTLKLSN++SFEGVLYCK
Sbjct  1    MTSFAGTTQKCKACEKIVYLVDQLTADNKVYHKSCFRCHHCKGTLKLSNFSSFEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFK TGSLDKSFEG P+T R ER+ +Q  ++S+ S+LFAGTQ+KCVACK+TVYPI
Sbjct  61   PHFDQLFKKTGSLDKSFEGIPRTSRVERSTNQVQSNSQFSNLFAGTQEKCVACKRTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKV V G SYH+ CF
Sbjct  121  EKVGVYGISYHKGCF  135


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 38/91 (42%), Positives = 49/91 (54%), Gaps = 8/91 (9%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC AC++TVY ++++      YHK CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQEKCVACKRTVYPIEKVGVYGISYHKGCFRCNHGGCVISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTG---SLDKSFEGAPKTVRERAADQ  326
             QLFK  G    LDK     P  V E   + 
Sbjct  163  TQLFKQKGKFSQLDK-----PDNVEEGVTEN  188



>ref|XP_004508840.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=192

 Score =   216 bits (550),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/135 (76%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKCK CEK VY V+QL ADNKVYHK+CF+C HCKGTLKLSNY S+EGVLYCK
Sbjct  1    MASFTGTTQKCKVCEKKVYWVEQLTADNKVYHKSCFKCHHCKGTLKLSNYCSYEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSLDKSFEG  +  R ER+ADQ   + KVS LF GTQ+KCV CKKTVYPI
Sbjct  61   PHFDQLFKMTGSLDKSFEGIARIARFERSADQVQANKKVSRLFIGTQEKCVGCKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKV VDG SYH++CF
Sbjct  121  EKVGVDGKSYHKSCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  D K YHK+CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FIGTQEKCVGCKKTVYPIEKVGVDGKSYHKSCFRCTHGGCVISPSNYVTHEHSLYCRHHH  162

Query  243  DQLFKMTGSLDK  278
            +QLFK  G+  +
Sbjct  163  NQLFKHKGNFSQ  174



>gb|ABK23670.1| unknown [Picea sitchensis]
 gb|ABK26097.1| unknown [Picea sitchensis]
Length=191

 Score =   216 bits (549),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKCKACEKTVYLVDQL ADN VYHK+CFRC HC GTLKLSNY+SFEGVLYCKPHF
Sbjct  3    FAGTTQKCKACEKTVYLVDQLTADNSVYHKSCFRCHHCNGTLKLSNYSSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR--ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFE  P+  R  +   ++  T ++VS++F+GTQDKCVAC KTVYPIEK
Sbjct  63   DQLFKRTGSLDKSFEAIPRASRNDKTQENESKTPNRVSTMFSGTQDKCVACGKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            VAVDGTSYHR CF
Sbjct  123  VAVDGTSYHRPCF  135


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 37/89 (42%), Positives = 52/89 (58%), Gaps = 1/89 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT  KC AC KTVY ++++  D   YH+ CF+C H    +  SNY + EG LYC+ H 
Sbjct  103  FSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRHHS  162

Query  243  DQLFKMTGSLDKSFEGAP-KTVRERAADQ  326
             QLF+  G+  +  +G P K V E   D+
Sbjct  163  SQLFREKGNFSQLAKGTPTKGVTENTDDK  191



>ref|XP_011030325.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=196

 Score =   215 bits (548),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNY+SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHL  161

Query  243  DQLFKMTGS---LDKSFEGAPKTVRERAAD  323
             QLFK  G+   L+   E  P TV   A +
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVE  191



>ref|XP_002298780.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
 gb|EEE83585.2| hypothetical protein POPTR_0001s30020g [Populus trichocarpa]
Length=196

 Score =   215 bits (547),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNY+SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAPKTVRERAAD  323
             QLFK  G+   L+   E  P TV   A +
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVE  191



>gb|ABK94586.1| unknown [Populus trichocarpa]
Length=196

 Score =   215 bits (547),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNY+SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTQYHRSCF  134


 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 53/90 (59%), Gaps = 3/90 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTQYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAPKTVRERAAD  323
             QLFK  G+   L+   E  P TV   A +
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVE  191



>gb|AGJ83946.1| lim protein 6 [Gossypium hirsutum]
Length=196

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK  +     +   + KV +LF GT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIENENAQKVVNLFGGTKEKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV VDGTSYHR CF
Sbjct  121  KVTVDGTSYHRGCF  134


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C KTVY ++++  D   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FGGTKEKCVGCNKTVYPIEKVTVDGTSYHRGCFKCSHGGCTISPSNYVAHEGKLYCKHHH  161

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  162  VQLFKEKGN  170



>gb|KJB32231.1| hypothetical protein B456_005G230900 [Gossypium raimondii]
Length=196

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK  +     +   + KV +LF GT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIENENAQKVVNLFGGTKEKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV VDGTSYHR CF
Sbjct  121  KVTVDGTSYHRGCF  134


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C KTVY ++++  D   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FGGTKEKCVGCNKTVYPIEKVTVDGTSYHRGCFKCSHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  162  VQLFKEKGN  170



>ref|XP_009766668.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
 gb|AAD56950.1|AF184885_1 LIM domain protein PLIM1 [Nicotiana tabacum]
Length=191

 Score =   214 bits (545),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/134 (76%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC+HCK TLKLSN+NSFEGV+YC+PH
Sbjct  2    TFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK  + E+  D  + S SKVSSLFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKVTKPEKPVDNENGSGSKVSSLFAGTREKCVGCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YH+ACF
Sbjct  122  KVSVNGTAYHKACF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  163  IQLFKEKGNYSQLESDHETDP  183



>gb|ACA33841.1| LIM2 transcription factor [Pinus pinaster]
Length=182

 Score =   213 bits (543),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKCKACEKTVYLVDQL ADN V+HK+CFRC HC GTLKLSNY+SFEGVLYCKPHF
Sbjct  3    FAGTTQKCKACEKTVYLVDQLTADNSVFHKSCFRCHHCNGTLKLSNYSSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR--ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSF   P+  R  +   ++  T S+VS+LF+GTQDKCVAC KTVYPIEK
Sbjct  63   DQLFKRTGSLDKSFAAIPRASRNDKMHENENRTPSRVSALFSGTQDKCVACGKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            VAVDGTSYHR CF
Sbjct  123  VAVDGTSYHRPCF  135


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/81 (41%), Positives = 48/81 (59%), Gaps = 0/81 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F+GT  KC AC KTVY ++++  D   YH+ CF+C H    +  SNY + EG LYC+ 
Sbjct  101  ALFSGTQDKCVACGKTVYPIEKVAVDGTSYHRPCFKCCHGGCVISPSNYVAHEGRLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEGAPK  299
            H  QLF+  G+  +  +  P+
Sbjct  161  HSSQLFREKGNFSQLSKATPQ  181



>gb|KHN04435.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++ H ++KVSS+F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKTGEEKHAATKVSSMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/91 (40%), Positives = 49/91 (54%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG  +   E     G
Sbjct  160  HHIQLIKEKGNLSQ-LEGDHEKSTEEEKING  189



>ref|XP_011092491.1| PREDICTED: LIM domain-containing protein WLIM1-like [Sesamum 
indicum]
Length=194

 Score =   214 bits (544),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT QKC AC  TVYLVD+L ADN++YHKACFRC HC GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTNQKCTACNGTVYLVDKLAADNRIYHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+     +   +SKVSS+F GT+DKCV C KTVYPIEKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKPEKPLENENASKVSSMFGGTKDKCVGCNKTVYPIEKVS  122

Query  423  VDGTSYHRACF  455
            V+GT+YH+ACF
Sbjct  123  VNGTAYHKACF  133


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 49/86 (57%), Gaps = 3/86 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EGVLYCK 
Sbjct  99   SMFGGTKDKCVGCNKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGVLYCKH  158

Query  237  HFDQLFKMTGS---LDKSFEGAPKTV  305
            H  QL K  G+   L+   E  P  +
Sbjct  159  HHIQLVKAKGNYSQLESDSEKDPAAI  184



>gb|AAF13231.1| pollen specific LIM domain protein 1a [Nicotiana tabacum]
Length=191

 Score =   213 bits (542),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC+HCK TLKLSN+NSFEGV+YC+PH
Sbjct  2    TFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK  + E+  D  + S +KVSSLFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKVTKPEKPVDNENGSGTKVSSLFAGTREKCVGCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YH+ACF
Sbjct  122  KVSVNGTAYHKACF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  163  IQLFKEKGNYSQLESDHETDP  183



>dbj|BAO02514.1| predicted LIM domain-containing protein ortholog [Nicotiana alata]
Length=189

 Score =   213 bits (542),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 101/134 (75%), Positives = 118/134 (88%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC+HCK TLKLSN+NSFEGV+YC+PH
Sbjct  2    TFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK  + E+  D  + S SKVS+LFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKVTKPEKPVDNENGSGSKVSNLFAGTREKCVGCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YH+ACF
Sbjct  122  KVSVNGTAYHKACF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 38/81 (47%), Positives = 49/81 (60%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCTKTVYPIEKVSVNGTAYHKACFKCSHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  163  IQLFKEKGNYSQLESDHETDP  183



>gb|ABK58465.1| LIM domain protein GLIM1b [Populus tremula x Populus alba]
Length=196

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNY+SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYSSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK  +         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKPVDNENASKVSNLFAGTREKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR CF
Sbjct  121  KVTVNGTPYHRRCF  134


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 39/90 (43%), Positives = 52/90 (58%), Gaps = 3/90 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCNKTVYPIEKVTVNGTPYHRRCFKCTHGGCTVSPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAPKTVRERAAD  323
             QLFK  G+   L+   E  P TV   A +
Sbjct  162  IQLFKEKGNYSQLENEREKNPVTVNITAVE  191



>ref|XP_007042657.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOX98488.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=196

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+     +   + KV +LF GT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKHIENENAQKVVNLFGGTREKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YH++CF
Sbjct  121  KVTVNGTPYHKSCF  134


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 48/81 (59%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FGGTREKCVGCNKTVYPIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  162  IQLFKEKGNYSQLESDREKTP  182



>ref|XP_011457848.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X2 
[Fragaria vesca subsp. vesca]
 ref|XP_011457849.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X2 
[Fragaria vesca subsp. vesca]
 ref|XP_011457850.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X2 
[Fragaria vesca subsp. vesca]
Length=195

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 113/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT+QKC ACEKTVYLVD+L AD++ YHKACFRC HCKGTLKLSNY SFEGVLYC+
Sbjct  1    MATFAGTSQKCTACEKTVYLVDKLTADSRSYHKACFRCHHCKGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK ++     +   +  VSSLF GT+DKCV C+KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKPTENENTKAVSSLFGGTKDKCVGCEKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YHR CF
Sbjct  121  KVSVNGTAYHRRCF  134


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  CEKTVY ++++  +   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FGGTKDKCVGCEKTVYPIEKVSVNGTAYHRRCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  162  IQLFKEKGNYSQ  173



>ref|XP_010272870.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272878.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272885.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
 ref|XP_010272891.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=196

 Score =   212 bits (539),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC KTVYLVDQL ADN++YHK+CFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACAKTVYLVDQLTADNRIYHKSCFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+   +  T++KVS++F GT+DKC+ CKKTVYP+EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKPESENATTNKVSNMFGGTRDKCICCKKTVYPLEKV  122

Query  420  AVDGTSYHRACF  455
             VDG +YH+ CF
Sbjct  123  TVDGNAYHKICF  134


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 48/87 (55%), Gaps = 5/87 (6%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C+KTVY ++++  D   YHK CF+C H    +  SNY + EG LYC+ H 
Sbjct  102  FGGTRDKCICCKKTVYPLEKVTVDGNAYHKICFKCTHGGCVISPSNYIAHEGKLYCRHHH  161

Query  243  DQLFKMTGSL-----DKSFEGAPKTVR  308
             QLFK  G+      D   E A +TV 
Sbjct  162  TQLFKEKGNYSQLEGDNEKEPAKETVN  188



>ref|XP_007201308.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
 gb|EMJ02507.1| hypothetical protein PRUPE_ppa011881mg [Prunus persica]
Length=192

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 99/135 (73%), Positives = 117/135 (87%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKC ACEKTVYLVD+L AD++VYHKACFRC HC GTLKLSNY SFEGVLYC+
Sbjct  1    MATFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PH+DQLFK TGSLDKSFEG PK ++ E+++      + VS+LFAGT++KCV C+KTVYPI
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKSSTDKENGNSVSNLFAGTREKCVGCQKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKV+V+GT YHR+CF
Sbjct  121  EKVSVNGTPYHRSCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 47/72 (65%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCQKTVYPIEKVSVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_011002116.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=195

 Score =   211 bits (537),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HC+GTLKLSNY SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPIDNENASKVSNLFAGTREKCVGCDKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 46/69 (67%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHL  161

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  162  IQLFKEKGN  170



>ref|XP_002313186.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
 gb|ABK93559.1| unknown [Populus trichocarpa]
 gb|EEE87141.2| hypothetical protein POPTR_0009s09040g [Populus trichocarpa]
Length=195

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HC+GTLKLSNY SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCDKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  162  IQLFKEKGNYSQLENEREKNP  182



>ref|XP_009606069.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AAF13232.1| pollen specific LIM domain protein 1b [Nicotiana tabacum]
Length=181

 Score =   210 bits (535),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 116/134 (87%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC+HCK TLKLSN+NSFEGV+YC+PH
Sbjct  2    TFAGTTQKCSACEKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSF+G PK  +   +  ++  + SKVSSLFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFDGTPKVTKPEKSVENENGSGSKVSSLFAGTREKCVGCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YH+ CF
Sbjct  122  KVSVNGTAYHKGCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SLFAGTREKCVGCTKTVYPIEKVSVNGTAYHKGCFKCSHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  161  HHIQLFKEKGNYSQ  174



>gb|ABK95336.1| unknown [Populus trichocarpa]
Length=195

 Score =   211 bits (537),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA FAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HC+GTLKLSNY SFEGVLYC+
Sbjct  1    MAAFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCDKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 35/81 (43%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YH++CF+C H   T+  SNY + EG L+CK H 
Sbjct  102  FAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLHCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  162  IQLFKEKGNYSQLENEREKNP  182



>ref|XP_010928557.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=248

 Score =   213 bits (541),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 115/136 (85%), Gaps = 4/136 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GTTQKCKACEKTVYLVDQL AD +VYHKACFRC HCKGTLKLSNY+S +GVLYCKP
Sbjct  4    GAFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKP  63

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSS---KVSSLFAGTQDKCVACKKTVYP  407
            H+DQLFKMTGSLDKSFEG+ ++ +   ++ GH ++   + SS+F GTQDKCV CKKTVYP
Sbjct  64   HYDQLFKMTGSLDKSFEGSSRSAKADRSN-GHENTANRRFSSMFVGTQDKCVVCKKTVYP  122

Query  408  IEKVAVDGTSYHRACF  455
            IEKVAVDGTSYHR CF
Sbjct  123  IEKVAVDGTSYHRPCF  138


 Score = 65.5 bits (158),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/74 (41%), Positives = 42/74 (57%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY ++++  D   YH+ CF+C      +  SNY + EG LYCK 
Sbjct  104  SMFVGTQDKCVVCKKTVYPIEKVAVDGTSYHRPCFKCSRGGCVISPSNYIAHEGRLYCKH  163

Query  237  HFDQLFKMTGSLDK  278
            H  QLF   G+  +
Sbjct  164  HHSQLFMAKGNFSQ  177



>ref|XP_009408124.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=187

 Score =   210 bits (535),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFKMTGSLDKSFEG PK V+         ++KVSS FAGTQ+KCV C KTVYPIE+V 
Sbjct  63   DQLFKMTGSLDKSFEGTPKVVKPEKYVDNENANKVSSAFAGTQEKCVGCSKTVYPIERVT  122

Query  423  VDGTSYHRACF  455
            V+GT+YH++CF
Sbjct  123  VNGTAYHKSCF  133


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  99   SAFAGTQEKCVGCSKTVYPIERVTVNGTAYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  158

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  159  HHIQLFKEKGNYSQ  172



>ref|XP_009414770.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=193

 Score =   210 bits (535),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 96/131 (73%), Positives = 111/131 (85%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTT KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFKMTGSLDKSFEG PK V+     +   +SKVSS FAGT++KCV C KTVYPIE+V 
Sbjct  63   DQLFKMTGSLDKSFEGTPKIVKPEKHVENENASKVSSAFAGTREKCVGCNKTVYPIERVT  122

Query  423  VDGTSYHRACF  455
            V+GT+YH++CF
Sbjct  123  VNGTAYHKSCF  133


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/81 (42%), Positives = 47/81 (58%), Gaps = 0/81 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +   YHK+CF+C      +  SNY + EG LYCK 
Sbjct  99   SAFAGTREKCVGCNKTVYPIERVTVNGTAYHKSCFKCSRGGCVISPSNYIAHEGRLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPK  299
            H  QLFK  G+  +   G  K
Sbjct  159  HHIQLFKEKGNYSQLENGEEK  179



>ref|XP_004250748.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=193

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 117/134 (87%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC+HCK TLKLSN+NSF+GV+YC+PH
Sbjct  2    TFAGTTQKCNACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFDGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK  + E+  D +  TS+KVSSLFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKITKPEKTVDNENGTSNKVSSLFAGTREKCVCCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV V+G +YH+ACF
Sbjct  122  KVTVNGAAYHKACF  135


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 38/84 (45%), Positives = 50/84 (60%), Gaps = 5/84 (6%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EG LYCK 
Sbjct  101  SLFAGTREKCVCCTKTVYPIEKVTVNGAAYHKACFKCSHGGCTISPSNYIAHEGTLYCKH  160

Query  237  HFDQLFKMTGS-----LDKSFEGA  293
            H  QLFK  G+     +D   E A
Sbjct  161  HHIQLFKEKGNYSQLEIDHEIEPA  184



>ref|NP_001235758.1| uncharacterized protein LOC100305720 [Glycine max]
 gb|ACU13553.1| unknown [Glycine max]
Length=196

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAATKVSSMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  160  HHIQLIKEKGNLSQ-LEG  176



>ref|NP_001238580.1| uncharacterized protein LOC100499957 [Glycine max]
 gb|ACU14335.1| unknown [Glycine max]
 gb|KHN45139.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKTGEEKPAATKVSSMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 55/97 (57%), Gaps = 5/97 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKV  347
            H  QL K  G+L +  EG      E++A+Q   + +V
Sbjct  160  HHVQLIKEKGNLSQ-LEGD----HEKSAEQEKINGEV  191



>ref|XP_010548517.1| PREDICTED: LIM domain-containing protein WLIM1-like [Tarenaya 
hassleriana]
Length=186

 Score =   209 bits (533),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 115/132 (87%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC++TVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSL+KSFEG PK V+    D +   ++KVSS+FAGT++KCV C KTVYPIEKV
Sbjct  63   DQLFKRTGSLEKSFEGTPKIVKPEKPDGERPATNKVSSMFAGTREKCVGCDKTVYPIEKV  122

Query  420  AVDGTSYHRACF  455
            +V+GT YH++CF
Sbjct  123  SVNGTLYHKSCF  134


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 54/88 (61%), Gaps = 1/88 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  100  SMFAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            H  QL K  G+L +  EG   T    A+
Sbjct  160  HHVQLIKEKGNLSQ-LEGDNSTKENTAS  186



>gb|ABK58464.1| LIM domain protein GLIM1a [Populus tremula x Populus alba]
Length=195

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 112/134 (84%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA F+GT QKC AC+KTVYLVD+L ADN+V+HKACFRC HC+GTLKLSNY SFEGVLYC+
Sbjct  1    MAAFSGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCRGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK V+         +SKVS+LFAGT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIVKPEKPVDNENASKVSNLFAGTREKCVGCDKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YHR+CF
Sbjct  121  KVTVNGTPYHRSCF  134


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/81 (44%), Positives = 50/81 (62%), Gaps = 3/81 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FAGTREKCVGCDKTVYPIEKVTVNGTPYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAP  296
             QLFK  G+   L+   E  P
Sbjct  162  IQLFKEKGNYSQLENEREKNP  182



>ref|XP_002285355.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CAN72849.1| hypothetical protein VITISV_013939 [Vitis vinifera]
 emb|CBI19396.3| unnamed protein product [Vitis vinifera]
Length=197

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ E+  D +   ++KVSS+FAGT+DKCV CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPIDSEKPIANKVSSMFAGTRDKCVGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT+YH++CF
Sbjct  123  VTVNGTAYHKSCF  135


 Score = 70.1 bits (170),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFAGTRDKCVGCKNTVYPTEKVTVNGTAYHKSCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHTQLIKEKGNLSQ-LEG  177



>ref|XP_009418011.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=206

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKC+AC KTVYLVDQL AD ++YH+ACFRC HC+GTLK SNY+S EGVLYCKPH+
Sbjct  6    FGGTTQKCQACRKTVYLVDQLAADGRIYHRACFRCHHCRGTLKFSNYSSIEGVLYCKPHY  65

Query  243  DQLFKMTGSLDKSFEGAPKT--VRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFKMTGSLDKSFEGAPK+  +   +  QG  +S+ +S+F GT+DKCV CKKTVYPIEK
Sbjct  66   DQLFKMTGSLDKSFEGAPKSAKIDRSSGQQGVANSRYASIFLGTRDKCVECKKTVYPIEK  125

Query  417  VAVDGTSYHRACF  455
            VAVDG SYHR CF
Sbjct  126  VAVDGNSYHRPCF  138


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY ++++  D   YH+ CFRC H   T+  SN+ + EG LYCK 
Sbjct  104  SIFLGTRDKCVECKKTVYPIEKVAVDGNSYHRPCFRCTHGGCTISPSNFVTHEGRLYCKH  163

Query  237  HFDQLFKMTGSL  272
            H  QLF   G+ 
Sbjct  164  HHAQLFMTKGNF  175


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 22/36 (61%), Positives = 27/36 (75%), Gaps = 0/36 (0%)
 Frame = +3

Query  348  SSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            S LF GT  KC AC+KTVY ++++A DG  YHRACF
Sbjct  3    SMLFGGTTQKCQACRKTVYLVDQLAADGRIYHRACF  38



>gb|KJB32232.1| hypothetical protein B456_005G230900 [Gossypium raimondii]
Length=193

 Score =   209 bits (532),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 99/134 (74%), Positives = 111/134 (83%), Gaps = 3/134 (2%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK  +     +   + KV +LF GT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIE---NEKVVNLFGGTKEKCVGCNKTVYPIE  117

Query  414  KVAVDGTSYHRACF  455
            KV VDGTSYHR CF
Sbjct  118  KVTVDGTSYHRGCF  131


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C KTVY ++++  D   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  99   FGGTKEKCVGCNKTVYPIEKVTVDGTSYHRGCFKCSHGGCTISPSNYIAHEGKLYCKHHH  158

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  159  VQLFKEKGN  167



>ref|XP_008793824.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Phoenix 
dactylifera]
Length=214

 Score =   210 bits (534),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 101/136 (74%), Positives = 114/136 (84%), Gaps = 4/136 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GTTQKCKACEKTVYLVDQL AD +VYHKACFRC HCKGTLKLSNY+S +GVLYCKP
Sbjct  4    GAFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKP  63

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTS---SKVSSLFAGTQDKCVACKKTVYP  407
            H+DQLFKMTGSLDKSFEG+ ++ +   ++ GH S   S+  S+F GTQDKCV CKKTVYP
Sbjct  64   HYDQLFKMTGSLDKSFEGSSRSAKADRSN-GHESNANSRFLSMFVGTQDKCVVCKKTVYP  122

Query  408  IEKVAVDGTSYHRACF  455
            IEKVA+DGTSYHR CF
Sbjct  123  IEKVALDGTSYHRPCF  138


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 30/75 (40%), Positives = 44/75 (59%), Gaps = 0/75 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            ++ F GT  KC  C+KTVY ++++  D   YH+ CF+C H    +  SNY + +G LYCK
Sbjct  103  LSMFVGTQDKCVVCKKTVYPIEKVALDGTSYHRPCFKCSHGGCVISPSNYIAHDGRLYCK  162

Query  234  PHFDQLFKMTGSLDK  278
             H  QLF   G+  +
Sbjct  163  HHHSQLFMAKGNFSQ  177



>ref|XP_006342667.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=187

 Score =   208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+V+HKACFRC+HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+    D+   ++KVSS+F GT++KC  CK TVYP EKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPE-KDEKPQAAKVSSMFVGTREKCFGCKNTVYPTEKVS  121

Query  423  VDGTSYHRACF  455
            V+GT YH++CF
Sbjct  122  VNGTPYHKSCF  132


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  98   SMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  157

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  158  HHVQLIKEKGNLSQ-LEG  174



>ref|XP_009769329.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=190

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+    D+   ++KVSS+F GT++KC  CK TVYP EKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPE-KDEKPQAAKVSSMFVGTREKCFGCKNTVYPTEKVS  121

Query  423  VDGTSYHRACF  455
            V+GT YH++CF
Sbjct  122  VNGTPYHKSCF  132


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  98   SMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKH  157

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  158  HHIQLIKEKGNLSQ-LEG  174



>ref|XP_009598300.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
Length=187

 Score =   208 bits (530),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 98/131 (75%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+    D+   ++KVSS+F GT++KC  CK TVYP EKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPE-KDEKPQAAKVSSMFVGTREKCFGCKNTVYPTEKVS  121

Query  423  VDGTSYHRACF  455
            V+GT YH++CF
Sbjct  122  VNGTPYHKSCF  132


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  98   SMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGRLYCKH  157

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  158  HHIQLIKEKGNLSQ-LEG  174



>ref|XP_011074349.1| PREDICTED: LIM domain-containing protein WLIM1 [Sesamum indicum]
Length=193

 Score =   209 bits (531),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 117/133 (88%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + E+ AD +   ++KVSS+FAGT++KC+ACK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKPADIEKPLANKVSSMFAGTREKCLACKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 69.7 bits (169),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC AC+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFAGTREKCLACKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKEKGNLSQ-LEG  177



>ref|XP_004252738.1| PREDICTED: LIM domain-containing protein WLIM1-like [Solanum 
lycopersicum]
Length=187

 Score =   208 bits (530),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 113/131 (86%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+    ++ H ++KVSS+F GT++KC  CK TVYP EKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKDEKPH-AAKVSSMFVGTREKCFGCKNTVYPTEKVS  121

Query  423  VDGTSYHRACF  455
            V+GT YH++CF
Sbjct  122  VNGTPYHKSCF  132


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  98   SMFVGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  157

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  158  HHVQLIKEKGNLSQ-LEG  174



>ref|XP_006352087.1| PREDICTED: pollen-specific protein SF3-like [Solanum tuberosum]
Length=193

 Score =   208 bits (530),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 116/134 (87%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC+HCK TLKLSN+NSFEGV+YC+PH
Sbjct  2    TFAGTTQKCNACDKTVYLVDRLAADNRIYHKACFRCYHCKSTLKLSNFNSFEGVIYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK  + E++ D +  T +KVSSLFAGT++KCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKITKPEKSVDNENGTGAKVSSLFAGTREKCVCCTKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV V+G +YH+ CF
Sbjct  122  KVTVNGAAYHKTCF  135


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/84 (44%), Positives = 49/84 (58%), Gaps = 5/84 (6%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SLFAGTREKCVCCTKTVYPIEKVTVNGAAYHKTCFKCTHGGCTISPSNYIAHEGTLYCKH  160

Query  237  HFDQLFKMTGS-----LDKSFEGA  293
            H  QLFK  G+     +D   E A
Sbjct  161  HHIQLFKEKGNYSQLEIDHEIEPA  184



>ref|XP_006857164.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
 gb|ERN18631.1| hypothetical protein AMTR_s00065p00168710 [Amborella trichopoda]
Length=193

 Score =   208 bits (530),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+ +HKACFRC HCKGTLKLSNY SFEGVLYC+PH+
Sbjct  3    FAGTTQKCHACEKTVYLVDKLTADNRSFHKACFRCHHCKGTLKLSNYCSFEGVLYCRPHY  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  D     ++VS LFAGT+DKCV CKKTVYPIEKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKPIDSEGQGARVSGLFAGTRDKCVGCKKTVYPIEKV  122

Query  420  AVDGTSYHRACF  455
            AVDG++YH++CF
Sbjct  123  AVDGSAYHKSCF  134


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 42/86 (49%), Positives = 52/86 (60%), Gaps = 5/86 (6%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC  C+KTVY ++++  D   YHK+CF+C H    +  SNY + EG LYCK H 
Sbjct  102  FAGTRDKCVGCKKTVYPIEKVAVDGSAYHKSCFKCCHGGCVISPSNYIAHEGRLYCKHHH  161

Query  243  DQLFKMTGS---LDKSFEGAPKTVRE  311
             QLFK  G+   LDKS  G  K V E
Sbjct  162  SQLFKEKGNYSQLDKS--GNEKGVTE  185



>gb|KHN36972.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   208 bits (530),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAAKVSSMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG      E++A  G
Sbjct  160  HHVQLIKEKGNLSQ-LEGD----NEKSATNG  185



>gb|EYU25518.1| hypothetical protein MIMGU_mgv1a014425mg [Erythranthe guttata]
Length=190

 Score =   208 bits (529),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD L ADN+++HKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDMLTADNRIFHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR--ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+  + A  +   ++KVS++FAGT+DKC+ACK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKPDKPANIEKPNANKVSNMFAGTRDKCLACKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GTSYH+ CF
Sbjct  123  VSVNGTSYHKNCF  135


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 45/76 (59%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC AC+ TVY  +++  +   YHK CF+C H    +  SNY + EG LYCK H 
Sbjct  103  FAGTRDKCLACKNTVYPTEKVSVNGTSYHKNCFKCSHGGCVISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
             QL K  G+L +  EG
Sbjct  163  IQLIKEKGNLSQ-LEG  177



>ref|XP_009415386.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=202

 Score =   208 bits (530),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 112/135 (83%), Gaps = 2/135 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GTTQKC+AC+KTVYLVDQL AD ++YH+ACFRC HCKGTLK SNY+S +GVLYCKP
Sbjct  3    SMFGGTTQKCQACQKTVYLVDQLAADGRIYHRACFRCHHCKGTLKFSNYSSIDGVLYCKP  62

Query  237  HFDQLFKMTGSLDKSFEGAPKT--VRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            H+DQLFKMTGSLDK FEGAPK+  +      QG  +++ S++F GTQDKCV CKKTVYPI
Sbjct  63   HYDQLFKMTGSLDKIFEGAPKSSKIDRSIGQQGIANNRYSTIFLGTQDKCVECKKTVYPI  122

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYHR CF
Sbjct  123  EKVAVDGNSYHRPCF  137


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/103 (41%), Positives = 54/103 (52%), Gaps = 7/103 (7%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C+KTVY ++++  D   YH+ CFRC H   T+  SN+ + EG LYCK H 
Sbjct  105  FLGTQDKCVECKKTVYPIEKVAVDGNSYHRPCFRCSHGGCTISPSNFITHEGRLYCKHHH  164

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQ  371
             QLF   G+   SF      V E+  D    + KV  L  G Q
Sbjct  165  AQLFMTKGNFS-SFS----KVEEKNEDITLPADKV--LVEGVQ  200


 Score = 51.2 bits (121),  Expect = 3e-05, Method: Compositional matrix adjust.
 Identities = 21/37 (57%), Positives = 29/37 (78%), Gaps = 0/37 (0%)
 Frame = +3

Query  345  VSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            ++S+F GT  KC AC+KTVY ++++A DG  YHRACF
Sbjct  1    MASMFGGTTQKCQACQKTVYLVDQLAADGRIYHRACF  37



>ref|NP_001238429.1| uncharacterized protein LOC100499947 [Glycine max]
 gb|ACU14298.1| unknown [Glycine max]
Length=196

 Score =   208 bits (529),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKNLEERPAAAKVSSMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 51/91 (56%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG      E++A  G
Sbjct  160  HHVQLIKEKGNLSQ-LEGD----NEKSATNG  185



>gb|ABK93551.1| unknown [Populus trichocarpa]
 gb|ACN97187.1| LIM transcription factor [Populus trichocarpa]
Length=197

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC+GTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK ++      G    S+KVS++FAGT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKILKPEKPVDGEKPISTKVSTMFAGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GTSYH++CF
Sbjct  123  VSVNGTSYHKSCF  135


 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTRDKCFGCKNTVYPTEKVSVNGTSYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>ref|XP_002510088.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF52275.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=197

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ++ AD +   ++KVSS+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKTDKPADGEKPNAAKVSSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H +QL K  G+L +  EG
Sbjct  161  HHNQLIKEKGNLSQ-LEG  177



>gb|AFK42303.1| unknown [Medicago truncatula]
Length=181

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGT QKC  CEK VY V+QL ADNKV+HK+CFRC HCKGTLKLSNY SFE VLYCK
Sbjct  1    MASFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL KSFEG  +  R ER+ DQ    +KVS  FAGTQ+KCV CKKTVYPI
Sbjct  61   PHFDQLFKMTGSLYKSFEGITRIYRVERSTDQVQAYNKVSRFFAGTQEKCVGCKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH+ CF
Sbjct  121  EKVAVDGESYHKNCF  135


 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  D + YHK CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRRHH  162

Query  243  DQLFKMTGSLDK  278
             Q+FK  G+  +
Sbjct  163  TQIFKQKGNFSQ  174



>ref|XP_003608956.1| LIM domain protein [Medicago truncatula]
 gb|AES91153.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
Length=181

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 101/135 (75%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGT QKC  CEK VY V+QL ADNKV+HK+CFRC HCKGTLKLSNY SFE VLYCK
Sbjct  1    MASFAGTAQKCNTCEKKVYWVEQLTADNKVFHKSCFRCHHCKGTLKLSNYCSFESVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PHFDQLFKMTGSL KSFEG  +  R ER+ DQ    +KVS  FAGTQ+KCV CKKTVYPI
Sbjct  61   PHFDQLFKMTGSLYKSFEGITRIYRVERSTDQVQAYNKVSRFFAGTQEKCVGCKKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDG SYH+ CF
Sbjct  121  EKVAVDGESYHKNCF  135


 Score = 69.3 bits (168),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  D + YHK CFRC H    +  SNY + E  LYC+ H 
Sbjct  103  FAGTQEKCVGCKKTVYPIEKVAVDGESYHKNCFRCTHGGCIISPSNYVAHEHRLYCRHHH  162

Query  243  DQLFKMTGSLDK  278
             Q+FK  G+  +
Sbjct  163  TQIFKQKGNFSQ  174



>ref|XP_011457843.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011457844.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011457845.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011457846.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Fragaria vesca subsp. vesca]
 ref|XP_011457847.1| PREDICTED: LIM domain-containing protein WLIM1-like isoform X1 
[Fragaria vesca subsp. vesca]
Length=197

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/136 (72%), Positives = 113/136 (83%), Gaps = 2/136 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKL--SNYNSFEGVLY  227
            MATFAGT+QKC ACEKTVYLVD+L AD++ YHKACFRC HCKGTLKL  SNY SFEGVLY
Sbjct  1    MATFAGTSQKCTACEKTVYLVDKLTADSRSYHKACFRCHHCKGTLKLQLSNYCSFEGVLY  60

Query  228  CKPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYP  407
            C+PH+DQLFK TGSLDKSFEG PK ++     +   +  VSSLF GT+DKCV C+KTVYP
Sbjct  61   CRPHYDQLFKRTGSLDKSFEGTPKILKPEKPTENENTKAVSSLFGGTKDKCVGCEKTVYP  120

Query  408  IEKVAVDGTSYHRACF  455
            IEKV+V+GT+YHR CF
Sbjct  121  IEKVSVNGTAYHRRCF  136


 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/72 (46%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  CEKTVY ++++  +   YH+ CF+C H   T+  SNY + EG LYCK H 
Sbjct  104  FGGTKDKCVGCEKTVYPIEKVSVNGTAYHRRCFKCTHGGCTISPSNYIAHEGKLYCKHHH  163

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  164  IQLFKEKGNYSQ  175



>ref|XP_002266499.1| PREDICTED: LIM domain-containing protein WLIM1 [Vitis vinifera]
 emb|CBI22440.3| unnamed protein product [Vitis vinifera]
Length=194

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 96/134 (72%), Positives = 112/134 (84%), Gaps = 3/134 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HC+GTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDRLTADNRIYHKACFRCHHCRGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHT--SSKVSSLFAGTQDKCVACKKTVYPIE  413
            DQLFK TGSLDKSFEG PK V+ E+  D      ++KVS++F GT+DKCV C KT YP+E
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKTTDHSENAATNKVSNMFVGTKDKCVGCNKTAYPLE  122

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YH++CF
Sbjct  123  KVTVNGTPYHKSCF  136


 Score = 64.3 bits (155),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 42/69 (61%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C KT Y ++++  +   YHK+CF+C +   T+  SNY + EG LYCK H 
Sbjct  104  FVGTKDKCVGCNKTAYPLEKVTVNGTPYHKSCFKCTYGGCTISPSNYIAHEGKLYCKHHH  163

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  164  IQLFKEKGN  172



>ref|XP_002302405.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
 ref|XP_011017108.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
 gb|ABK58468.1| LIM domain protein WLIM1b [Populus tremula x Populus alba]
 gb|EEE81678.2| hypothetical protein POPTR_0002s11880g [Populus trichocarpa]
Length=197

 Score =   207 bits (527),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC+GTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDRLAADNRVYHKACFRCHHCRGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+      G    S+KVS++FAGT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPISTKVSTMFAGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 47/76 (62%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTRDKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>ref|XP_010913501.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=202

 Score =   207 bits (528),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 98/135 (73%), Positives = 112/135 (83%), Gaps = 2/135 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F  TTQKCKACEKTVYLVDQL AD ++YHKACFRC HCKGTL+LSNY+S +GVLYCKP
Sbjct  4    GAFGRTTQKCKACEKTVYLVDQLTADGRIYHKACFRCHHCKGTLRLSNYSSIDGVLYCKP  63

Query  237  HFDQLFKMTGSLDKSFEGAPKTVR--ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            H+DQLFKMTGSLDKSFE AP++ R    +  + + +S+ SS+F GTQDKCV CKKTVYPI
Sbjct  64   HYDQLFKMTGSLDKSFEDAPRSARADRSSGHESNANSRFSSMFVGTQDKCVVCKKTVYPI  123

Query  411  EKVAVDGTSYHRACF  455
            EKVAVDGTS HR CF
Sbjct  124  EKVAVDGTSCHRPCF  138


 Score = 64.3 bits (155),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 29/74 (39%), Positives = 43/74 (58%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY ++++  D    H+ CF+C H    +  SNY + EG +YCK 
Sbjct  104  SMFVGTQDKCVVCKKTVYPIEKVAVDGTSCHRPCFKCSHGGCVISPSNYVAHEGKVYCKH  163

Query  237  HFDQLFKMTGSLDK  278
            H  QLF + G+  +
Sbjct  164  HHSQLFMIKGNFSQ  177



>ref|XP_010544006.1| PREDICTED: LIM domain-containing protein WLIM1 [Tarenaya hassleriana]
Length=186

 Score =   207 bits (526),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC++TVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDRTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSL+KSFEG PK  +    D +   ++KVSS+FAGT++KCV C KTVYPIEKV
Sbjct  63   DQLFKRTGSLEKSFEGTPKIGKPEKPDGERPAANKVSSMFAGTREKCVGCDKTVYPIEKV  122

Query  420  AVDGTSYHRACF  455
            +V+GT YH++CF
Sbjct  123  SVNGTLYHKSCF  134


 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 55/88 (63%), Gaps = 1/88 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  100  SMFAGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYVAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            H  QL K  G+L +  EG   T  + AA
Sbjct  160  HHIQLIKEKGNLSQ-LEGDTATKEKMAA  186



>gb|AAD39103.1|AF116849_1 LIM domain protein WLIM-1 [Helianthus annuus]
Length=188

 Score =   206 bits (525),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HC GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V++     G    ++KVSS+F GT+DKC+ CK TVYP EK
Sbjct  63   DQLFKKTGSLDKSFEGTPKIVKQPKTIDGEKPMANKVSSMFVGTKDKCLGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT+YH++CF
Sbjct  123  VSVNGTAYHKSCF  135


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYC+ 
Sbjct  101  SMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAHEGHLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTS  338
            H  QL K  G+L +  EG      ER+A  G T+
Sbjct  161  HHTQLIKEKGNLSQ-LEG------ERSARVGETA  187



>ref|XP_004141291.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004163244.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN55277.1| hypothetical protein Csa_4G643070 [Cucumis sativus]
Length=179

 Score =   206 bits (524),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + E+  D +  T++KV+S+F GT+DKC+ C KTVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIGKPEKPGDSEKPTATKVASMFVGTKDKCLGCNKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GTSYH++CF
Sbjct  123  VSVNGTSYHKSCF  135


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFVGTKDKCLGCNKTVYPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGA  293
            H  QL K  G+L +  EG+
Sbjct  161  HHTQLIKEKGNLSQ-LEGS  178



>ref|XP_006595535.1| PREDICTED: uncharacterized protein LOC100527547 isoform X1 [Glycine 
max]
 ref|XP_006595536.1| PREDICTED: uncharacterized protein LOC100527547 isoform X2 [Glycine 
max]
 gb|KHN07659.1| Pollen-specific protein SF3 [Glycine soja]
Length=196

 Score =   207 bits (526),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/132 (73%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT++KC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKNLEEKPAAAKVSSMFGGTREKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG      E++A  G
Sbjct  160  HHVQLIKEKGNLTQ-LEGD----NEKSATNG  185



>ref|XP_008364385.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364386.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364387.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364388.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008364390.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   207 bits (526),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FA TTQKC ACEKTVYLVD+L AD+++YHKACFRC HCK TLKL NY SFEGVLYC+
Sbjct  1    MASFASTTQKCTACEKTVYLVDRLAADSRIYHKACFRCHHCKSTLKLINYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRE-RAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PH+DQLFK TGSLDKSFEG PK V+  R + +   +  VS+LFAGT+DKCV C+KTVYPI
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVVKPARPSTENENAKSVSNLFAGTRDKCVGCEKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKV+V+GT YH++CF
Sbjct  121  EKVSVNGTPYHKSCF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 35/72 (49%), Positives = 46/72 (64%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC  CEKTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTRDKCVGCEKTVYPIEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_004136935.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004155415.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN43845.1| hypothetical protein Csa_7G071340 [Cucumis sativus]
Length=201

 Score =   207 bits (526),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 111/134 (83%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F+GTTQKC ACEKTVYLVD+L ADN+V+HKACFRC+HCKGTLKLSNY SFEGVLYC+
Sbjct  1    MASFSGTTQKCMACEKTVYLVDKLTADNRVFHKACFRCYHCKGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK +R     +   +  VS++F GT+DKC  C KTVY IE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVMRSEKPSENENAKSVSNMFGGTRDKCSGCTKTVYLIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+G +YH++CF
Sbjct  121  KVTVNGNAYHKSCF  134


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/72 (44%), Positives = 44/72 (61%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C KTVYL++++  +   YHK+CF+C H   T+  S+Y + EG LYCK H 
Sbjct  102  FGGTRDKCSGCTKTVYLIEKVTVNGNAYHKSCFKCSHGGCTISPSSYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGSLDK  278
             QLF   G+  +
Sbjct  162  IQLFMEKGNYSQ  173



>ref|XP_008236308.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 114/135 (84%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGTTQKC ACEKTVYLVD+L AD++VYHKACFRC HC GTLKLSNY SFEGVLYC+
Sbjct  1    MATFAGTTQKCTACEKTVYLVDRLAADSRVYHKACFRCHHCTGTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PH+DQLFK TGSLDKSFEG PK ++ E+        + VS+LFAGT++KCV C+KTVYPI
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKILKPEKPPTDKENGNSVSNLFAGTREKCVGCQKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            EKV+V+G  YH++CF
Sbjct  121  EKVSVNGIPYHKSCF  135


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 53/86 (62%), Gaps = 1/86 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCQKTVYPIEKVSVNGIPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK-SFEGAPKTVRERA  317
             QLFK  G+  +   EG   ++ E+ 
Sbjct  163  IQLFKEKGNYSQLENEGEKHSMTEQV  188



>ref|XP_008452649.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cucumis 
melo]
Length=179

 Score =   206 bits (524),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 115/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + E+  D +  T++KV+S+F GT+DKC+ C KTVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIGKPEKPGDSEKPTATKVASMFIGTKDKCLGCNKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GTSYH++CF
Sbjct  123  VSVNGTSYHKSCF  135


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFIGTKDKCLGCNKTVYPTEKVSVNGTSYHKSCFKCCHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGA  293
            H  QL K  G+L +  EG+
Sbjct  161  HHTQLIKEKGNLSQ-LEGS  178



>dbj|BAM05591.1| LIM transcription factor [Eucalyptus pyrocarpa]
 dbj|BAM05592.1| LIM transcription factor [Eucalyptus globulus subsp. globulus]
Length=188

 Score =   206 bits (524),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++KVSS+F GT+DKCV CK TVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPIDGERPAATKVSSMFGGTRDKCVGCKSTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYC+ 
Sbjct  101  SMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHTQLIKEKGNLSQ-LEG  177



>gb|AAD02543.1| PGPS/D1 [Petunia x hybrida]
Length=195

 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 115/134 (86%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TFAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC+HCK TLKLSN+NSFEGV+YC+ H
Sbjct  2    TFAGTTQKCSACDKTVYLVDRLAADNRVYHKACFRCYHCKSTLKLSNFNSFEGVIYCRHH  61

Query  240  FDQLFKMTGSLDKSFEGAPK-TVRERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSFEG PK T  E+  D  + S +KVSSLF GT+DKCV C KTVYPIE
Sbjct  62   FDQLFKRTGSLDKSFEGTPKFTKPEKPVDNENGSGNKVSSLFGGTRDKCVGCSKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV+V+G +YH+ACF
Sbjct  122  KVSVNGAAYHKACF  135


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY ++++  +   YHKACF+C H   T+  SNY + EG LYCK 
Sbjct  101  SLFGGTRDKCVGCSKTVYPIEKVSVNGAAYHKACFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  161  HHIQLFKEKGNYSQ  174



>gb|EYU39077.1| hypothetical protein MIMGU_mgv1a014557mg [Erythranthe guttata]
Length=186

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC  TVYLVD+L ADN+++HKACFRC HCK TLKL N+NSFEGVLYC+PHF
Sbjct  3    FAGTTQKCTACSGTVYLVDRLAADNRIFHKACFRCHHCKSTLKLGNFNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+     +   +SKVSS+F GT+DKCV C KTVYPIEKV+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKTVENENASKVSSMFGGTRDKCVGCTKTVYPIEKVS  122

Query  423  VDGTSYHRACF  455
            V+G +YH++CF
Sbjct  123  VNGAAYHKSCF  133


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  99   SMFGGTRDKCVGCTKTVYPIEKVSVNGAAYHKSCFKCSHGGCTISPSNYIAHEGTLYCKH  158

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  159  HHIQLFKSKGNYSQ  172



>gb|ABK22236.1| unknown [Picea sitchensis]
Length=187

 Score =   206 bits (523),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT QKCKACEKTVY+VDQL AD  V+HKACFRC HC GTLKLSNY+SFEGVLYCKPHF
Sbjct  3    FAGTQQKCKACEKTVYVVDQLTADGSVFHKACFRCHHCNGTLKLSNYSSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+    + G   T S+VS+LF+GTQ+KC+AC  TVYPIEK
Sbjct  63   DQLFKRTGSLDKSFEGTPKAVKNEKLNDGEIKTPSRVSALFSGTQEKCLACGNTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+G  YH+ CF
Sbjct  123  VSVEGVGYHKQCF  135


 Score = 70.1 bits (170),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F+GT +KC AC  TVY ++++  +   YHK CF+C H    +  SNY + EG LYCK 
Sbjct  101  ALFSGTQEKCLACGNTVYPIEKVSVEGVGYHKQCFKCIHGGCVISPSNYIAIEGRLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QLFK  G+  +
Sbjct  161  HHAQLFKEKGNYSQ  174



>ref|XP_007225874.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
 gb|EMJ27073.1| hypothetical protein PRUPE_ppa011761mg [Prunus persica]
Length=197

 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ER  D    + +K SS+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVAKASSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH+ CF
Sbjct  123  VTVNGTPYHKMCF  135


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 51/90 (57%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPK--TVRERAA  320
            H  QL K  G+L +  EG  +  TV E A+
Sbjct  161  HHTQLIKEKGNLSQ-LEGDSEKNTVDENAS  189



>ref|XP_004962903.1| PREDICTED: pollen-specific protein SF3-like [Setaria italica]
Length=195

 Score =   206 bits (524),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 112/135 (83%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+     +   + KVSS+FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVENENAIKVSSVFAGTREKCVGCSKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SVFAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHIQLIKEKGNFSQ  174



>ref|XP_006664058.1| PREDICTED: pollen-specific protein SF3-like [Oryza brachyantha]
Length=195

 Score =   206 bits (523),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+     +   + KVSS FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPEKTVENENAMKVSSAFAGTREKCVGCNKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHIQLIKEKGNFSQ  174



>gb|AFK42495.1| unknown [Lotus japonicus]
Length=195

 Score =   206 bits (523),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + ER  D +   ++KVSS+F GT+DKC  C+KTVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKVAKPERNIDNEKPAAAKVSSMFGGTRDKCAGCQKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKEKGNLSQ-LEG  177



>gb|AFK47041.1| unknown [Lotus japonicus]
Length=195

 Score =   206 bits (523),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + ER  D +   ++KVSS+F GT+DKC  C+KTVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKVAKPERNIDNEKPAAAKVSSMFGGTRDKCAGCQKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKEKGNLSQ-LEG  177



>ref|XP_008220373.1| PREDICTED: pollen-specific protein SF3-like [Prunus mume]
Length=197

 Score =   206 bits (523),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/133 (74%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ER  D    + +K SS+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPERPVDSEKPAVAKASSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH+ CF
Sbjct  123  VTVNGTPYHKMCF  135


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 38/90 (42%), Positives = 50/90 (56%), Gaps = 3/90 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCSHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG--APKTVRERAA  320
            H  QL K  G+L +  EG     TV E A+
Sbjct  161  HHTQLIKEKGNLSQ-LEGDYEKNTVDENAS  189



>ref|XP_007160919.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 ref|XP_007160920.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32913.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
 gb|ESW32914.1| hypothetical protein PHAVU_001G028200g [Phaseolus vulgaris]
Length=196

 Score =   206 bits (523),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 113/132 (86%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + E+  ++   ++KVSS+F GT++KC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKTLEEKPGAAKVSSMFGGTREKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  160  HHIQLIKEKGNLSQ-LEG  176



>ref|XP_003576026.1| PREDICTED: LIM domain-containing protein WLIM1 [Brachypodium 
distachyon]
Length=196

 Score =   205 bits (522),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+     +   + KVSS FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVENENAIKVSSAFAGTREKCVGCNKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 73.2 bits (178),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/82 (43%), Positives = 51/82 (62%), Gaps = 0/82 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  101  SAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKT  302
            H  QL K  G+  +    + KT
Sbjct  161  HHIQLIKEKGNFSQLENDSEKT  182



>gb|ABA99040.1| Pollen-specific protein SF3, putative, expressed [Oryza sativa 
Japonica Group]
 gb|EAZ20639.1| hypothetical protein OsJ_36255 [Oryza sativa Japonica Group]
Length=195

 Score =   205 bits (522),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 111/135 (82%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+     +   + KVSS FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPEKTVENENAIKVSSAFAGTREKCVGCNKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCNKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHIQLIKEKGNFSQ  174



>gb|AAD56959.1|AF187105_1 LIM domain protein WLIM1 [Helianthus annuus]
Length=188

 Score =   205 bits (521),  Expect = 9e-64, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HC GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCNGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG P  V++     G    ++KVSS+F GT+DKC+ CK TVYP EK
Sbjct  63   DQLFKKTGSLDKSFEGTPNIVKQPKTIDGEKPMANKVSSMFVGTKDKCLGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT+YH++CF
Sbjct  123  VSVNGTAYHKSCF  135


 Score = 69.7 bits (169),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 38/94 (40%), Positives = 53/94 (56%), Gaps = 7/94 (7%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYC+ 
Sbjct  101  SMFVGTKDKCLGCKNTVYPTEKVSVNGTAYHKSCFKCSHGGCTISPSNYIAHEGHLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTS  338
            H  QL K  G+L +  EG      ER+A  G T+
Sbjct  161  HHTQLIKEKGNLSQ-LEG------ERSARVGETA  187



>ref|XP_008444540.1| PREDICTED: pollen-specific protein SF3 [Cucumis melo]
Length=198

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ+FK TGSLDKSFEG PK V+ E+  D +  T++KV+S+F GT+DKC+ C  TVYP EK
Sbjct  63   DQIFKRTGSLDKSFEGTPKIVKPEKPIDSEKPTANKVASMFGGTRDKCLGCDNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+G  YH++CF
Sbjct  123  VTVNGIPYHKSCF  135


 Score = 67.4 bits (163),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 50/91 (55%), Gaps = 1/91 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCLGCDNTVYPTEKVTVNGIPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG  + +  +    G
Sbjct  161  HHIQLIKEKGNLSQ-LEGDHEKITAKEKING  190



>ref|XP_010999890.1| PREDICTED: LIM domain-containing protein WLIM1-like [Populus 
euphratica]
Length=197

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+ YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+      G    S+KVS++FAGT++KC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPMSTKVSTMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 75.9 bits (185),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 36/76 (47%), Positives = 49/76 (64%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCKPH 
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKPHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>dbj|BAB84581.1| transcription factor LIM [Populus kitakamiensis]
Length=197

 Score =   205 bits (522),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+ YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+      G    S+KVS++FAGT++KC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVSTKVSTMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>ref|XP_002320687.1| transcription factor LIM family protein [Populus trichocarpa]
 dbj|BAB84582.1| transcription factor LIM [Populus kitakamiensis]
 gb|EEE99002.1| transcription factor LIM family protein [Populus trichocarpa]
 gb|ACN97188.1| LIM transcription factor [Populus trichocarpa]
 gb|ACT64134.1| transcription factor Lim1 [Populus deltoides]
 gb|ACT64135.1| transcription factor Lim1 [Populus deltoides]
Length=197

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+ YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+      G    S+KVS++FAGT++KC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVSTKVSTMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>ref|XP_002532425.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
 gb|EEF29966.1| Cysteine and glycine-rich protein, putative [Ricinus communis]
Length=196

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            TF GT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNY SFEGVLYC+PH
Sbjct  4    TFGGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYCSFEGVLYCRPH  63

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            +DQLFK+TGSLDKSFEG PK  +         +SKVS+ FAGT++KCV C KTVYPIE+V
Sbjct  64   YDQLFKLTGSLDKSFEGTPKVAKPEKPIDSENASKVSNKFAGTREKCVGCSKTVYPIERV  123

Query  420  AVDGTSYHRACF  455
             V+GT YHR+CF
Sbjct  124  TVNGTPYHRSCF  135


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 51/87 (59%), Gaps = 1/87 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C KTVY ++++  +   YH++CF+C +   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCVGCSKTVYPIERVTVNGTPYHRSCFKCTYGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK-SFEGAPKTVRERAA  320
             QLFK  G+  +   E  P T  +  A
Sbjct  163  IQLFKEKGNYSQLENERQPATTEKITA  189



>ref|XP_010094354.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB55842.1| Pollen-specific protein SF3 [Morus notabilis]
Length=198

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ E+  D    + +KV+S+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKAEKPLDSDKPAVAKVTSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 58/99 (59%), Gaps = 3/99 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSS  353
            H  QL K  G+L +  EG    V++ A++    +++V++
Sbjct  161  HHIQLIKEKGNLSQ-LEG--DHVKDAASENVTVATEVAA  196



>ref|XP_004142897.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004156385.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 gb|KGN62442.1| hypothetical protein Csa_2G354680 [Cucumis sativus]
Length=198

 Score =   205 bits (521),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ+FK TGSLDKSFEG PK V+ E+  D +  T++KV+S F GT+DKC+ C  TVYP EK
Sbjct  63   DQIFKRTGSLDKSFEGTPKIVKPEKPIDSERPTANKVASKFGGTRDKCLGCDNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 49/89 (55%), Gaps = 1/89 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTRDKCLGCDNTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQG  329
             QL K  G+L +  EG  + +  +    G
Sbjct  163  IQLIKEKGNLSQ-LEGDHEKITAKEKING  190



>emb|CDP01275.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   204 bits (520),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  + E+  D +   ++KVSS+F GT+DKCV C KTVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDFEKPLANKVSSMFVGTRDKCVGCSKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT+YH++CF
Sbjct  123  VSVNGTAYHKSCF  135


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFVGTRDKCVGCSKTVYPTEKVSVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKEKGNLSQ-LEG  177



>dbj|BAM05589.1| LIM transcription factor [Eucalyptus pilularis]
Length=188

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++K SS+F GT+DKCV CK TVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDGERPAATKASSMFGGTRDKCVGCKSTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYC+ 
Sbjct  101  SMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HXTQLIKEKGNLSQ-LEG  177



>ref|XP_010061652.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 dbj|BAD91878.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91879.1| transcription factor lim1 [Eucalyptus globulus]
 dbj|BAD91880.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAD91881.1| transcription factor lim1 [Eucalyptus camaldulensis]
 dbj|BAM05590.1| LIM transcription factor [Eucalyptus pilularis]
 gb|KCW68639.1| hypothetical protein EUGRSUZ_F02243 [Eucalyptus grandis]
Length=188

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++K SS+F GT+DKCV CK TVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDGERPAATKASSMFGGTRDKCVGCKSTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 65.5 bits (158),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 45/78 (58%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYC+ 
Sbjct  101  SMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGKLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHTQLIKEKGNLSQ-LEG  177



>gb|AAD56948.1|AF184109_1 LIM domain protein WLIM1 [Nicotiana tabacum]
Length=193

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KT YLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTAYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ++  D G    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPQKPIDSGKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L K  EG
Sbjct  161  HHIQLIKEKGNLSK-LEG  177



>ref|XP_007136766.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
 gb|ESW08760.1| hypothetical protein PHAVU_009G072200g [Phaseolus vulgaris]
Length=196

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG PK  + ++  ++   ++KV ++F GT+DKC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPDKTGEEKPAATKVLNMFGGTRDKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/98 (39%), Positives = 54/98 (55%), Gaps = 5/98 (5%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            +  F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + +G LYCK
Sbjct  99   LNMFGGTRDKCAGCQKTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHDGKLYCK  158

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKV  347
             H  QL K  G+L +  EG      E+ A Q  T+ +V
Sbjct  159  HHHIQLIKEKGNLSQ-LEGD----HEKNAIQEKTNGEV  191



>gb|KJB77631.1| hypothetical protein B456_012G147400 [Gossypium raimondii]
Length=208

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GT QKC AC KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFQGTQQKCNACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK VR        ++ KV + F GT++KC AC KT YPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVVRPERQIDSESALKVMNSFGGTREKCAACSKTAYPIE  120

Query  414  KVAVDGTSYHRACF  455
            +V V+GT YH++CF
Sbjct  121  RVTVNGTIYHKSCF  134


 Score = 75.1 bits (183),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 54/89 (61%), Gaps = 5/89 (6%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            M +F GT +KC AC KT Y ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK
Sbjct  99   MNSFGGTREKCAACSKTAYPIERVTVNGTIYHKSCFKCTHGGCTISPSNYIAHEGKLYCK  158

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAA  320
             H  QLFK  G+  +      +T RE+ A
Sbjct  159  HHHIQLFKEKGNYSQL-----ETEREKQA  182



>gb|AII80541.1| LIM-domain protein 7 [Gossypium hirsutum]
Length=208

 Score =   204 bits (520),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 108/134 (81%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATF GT QKC AC KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFQGTQQKCNACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK VR        ++ KV + F GT++KC AC KT YPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKVVRPERQIDSESALKVMNSFGGTREKCAACSKTAYPIE  120

Query  414  KVAVDGTSYHRACF  455
            +V V+GT YH++CF
Sbjct  121  RVTVNGTIYHKSCF  134


 Score = 75.9 bits (185),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 7/100 (7%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            M +F GT +KC AC KT Y ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK
Sbjct  99   MNSFGGTREKCAACSKTAYPIERVTVNGTIYHKSCFKCTHGGCTISPSNYIAHEGKLYCK  158

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSS  353
             H  QLFK  G+  +      +T RE+ A     +SKV S
Sbjct  159  HHHIQLFKEKGNYSQL-----ETEREKQAATA--ASKVPS  191



>ref|XP_004290976.1| PREDICTED: LIM domain-containing protein WLIM1 [Fragaria vesca 
subsp. vesca]
Length=191

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+++HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ER  D +   +SK S +F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPERPIDSEKPAASKASGMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH+ CF
Sbjct  123  VTVNGTPYHKMCF  135


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 33/79 (42%), Positives = 44/79 (56%), Gaps = 1/79 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  GMFGGTRDKCFGCKNTVYPTEKVTVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGA  293
            H  QL +  G+L +  EG 
Sbjct  161  HHTQLIREKGNLSQ-LEGG  178



>ref|XP_010687903.1| PREDICTED: LIM domain-containing protein WLIM1 [Beta vulgaris 
subsp. vulgaris]
Length=192

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 93/132 (70%), Positives = 107/132 (81%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            T   T  KCKAC+KTVYLVD+L ADNKV+HKACFRC HCKGTLKLSNYNSFEGVLYC+PH
Sbjct  4    TITSTNPKCKACDKTVYLVDKLTADNKVFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPH  63

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            FDQL+K TGSLDKSF+G PKT  ER  D     SK+SS+F GT+DKC  C KT YP EKV
Sbjct  64   FDQLYKQTGSLDKSFDGTPKTKPERHVDSEKPPSKISSMFGGTRDKCAGCSKTAYPTEKV  123

Query  420  AVDGTSYHRACF  455
             V+G++YH++CF
Sbjct  124  TVNGSAYHKSCF  135


 Score = 67.4 bits (163),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KT Y  +++  +   YHK+CF+C+    T+  SNY   EG LYCK 
Sbjct  101  SMFGGTRDKCAGCSKTAYPTEKVTVNGSAYHKSCFKCYQGGCTISPSNYIGHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHAQLIKEKGNLSQ-LEG  177



>ref|XP_007018479.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
 gb|EOY15704.1| GATA type zinc finger transcription factor family protein [Theobroma 
cacao]
Length=193

 Score =   204 bits (518),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYH+ACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHEACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  + E+ AD +   ++K S +FAGT+DKCV CK TVYP E+
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKQADAEKPAATKASGMFAGTRDKCVGCKNTVYPTER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 49/87 (56%), Gaps = 1/87 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK H 
Sbjct  103  FAGTRDKCVGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYVAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD  323
             QL K  G+L +  EG  +  R  A +
Sbjct  163  GQLIKEKGNLSQ-LEGEREKERVNATE  188



>ref|XP_008347599.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=197

 Score =   204 bits (518),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC+GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ E+  D    + +K SS+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPIDNEKPAVAKASSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH+ CF
Sbjct  123  VSVNGTPYHKMCF  135


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRE  311
            H  QL K  G+L +  EG  + + E
Sbjct  161  HHTQLIKEKGNLSQ-LEGDHERIAE  184



>ref|XP_009360821.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=195

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ER  D    + +K SS+F GT++KC  C+ TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVAKASSMFGGTREKCFGCRNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH+ CF
Sbjct  123  VSVNGTPYHKMCF  135


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 37/94 (39%), Positives = 49/94 (52%), Gaps = 5/94 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C  TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSL-----DKSFEGAPKTVRERAAD  323
            H  QL K  G+L     D       +  RE AA+
Sbjct  161  HHTQLIKEKGNLSQLEGDNEKMAVDENAREVAAE  194



>gb|ABK58467.1| LIM domain protein WLIM1a [Populus tremula x Populus alba]
Length=197

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+ YHKACFRC HCKG LKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRAYHKACFRCHHCKGALKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+      G    S+KVS++FAGT++KC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPEKPVDGEKPVSTKVSTMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 48/76 (63%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCIHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  163  NQLIKEKGNLSQ-LEG  177



>ref|NP_001237652.1| uncharacterized protein LOC100527547 [Glycine max]
 gb|ACU16643.1| unknown [Glycine max]
Length=196

 Score =   203 bits (517),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/132 (72%), Positives = 112/132 (85%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSLDKSFEG  K  + E+  ++   ++KVSS+F GT++KC  C+KTVYP EKV
Sbjct  63   DQLFKRTGSLDKSFEGTSKIAKPEKNLEEKPAAAKVSSMFGGTREKCAGCQKTVYPTEKV  122

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  123  TVNGTPYHKSCF  134


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/91 (41%), Positives = 52/91 (57%), Gaps = 5/91 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  100  SMFGGTREKCAGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQG  329
            H  QL K  G+L +  EG      E++A  G
Sbjct  160  HHVQLIKEKGNLTQ-LEGD----NEKSATNG  185



>ref|XP_008393720.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
 ref|XP_008351969.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=195

 Score =   203 bits (517),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HC+GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCRGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ER  D    + +K SS+F GT++KC  C+ TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPERPVDNEKPAVAKASSMFGGTREKCFGCRNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH+ CF
Sbjct  123  VSVNGTPYHKMCF  135


 Score = 67.8 bits (164),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 7/95 (7%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C  TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCRNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTV------RERAAD  323
            H  QL K  G+L +  EG  + +      RE AA+
Sbjct  161  HHTQLIKEKGNLSQ-LEGDNEKIAVDENGREVAAE  194



>ref|XP_009623970.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana tomentosiformis]
 gb|AFY06680.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   203 bits (516),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ +     +    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L K  EG
Sbjct  161  HHIQLIKEKGNLSK-LEG  177



>ref|XP_006433641.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 ref|XP_006472306.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR46881.1| hypothetical protein CICLE_v10002540mg [Citrus clementina]
 gb|KDO37193.1| hypothetical protein CISIN_1g029070mg [Citrus sinensis]
Length=199

 Score =   203 bits (517),  Expect = 6e-63, Method: Compositional matrix adjust.
 Identities = 94/135 (70%), Positives = 109/135 (81%), Gaps = 2/135 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A FAGT QKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+P
Sbjct  3    AAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRP  62

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSS--KVSSLFAGTQDKCVACKKTVYPI  410
            HFDQLFK TGSLDKSFEG PK  +      G   +  KVS++F GT++KCV CK TVYP 
Sbjct  63   HFDQLFKRTGSLDKSFEGTPKIAKPEKPIDGEKPNVAKVSTMFGGTREKCVGCKNTVYPT  122

Query  411  EKVAVDGTSYHRACF  455
            EKV+V+GT YH++CF
Sbjct  123  EKVSVNGTPYHKSCF  137


 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 33/76 (43%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK H 
Sbjct  105  FGGTREKCVGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKHHH  164

Query  243  DQLFKMTGSLDKSFEG  290
            +QL K  G+L +  EG
Sbjct  165  NQLIKEKGNLSQ-LEG  179


 Score = 48.5 bits (114),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 28/37 (76%), Gaps = 0/37 (0%)
 Frame = +3

Query  345  VSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            +++ FAGTQ KC+AC KTVY ++K+  D   YH+ACF
Sbjct  1    MAAAFAGTQQKCMACDKTVYLVDKLTADNRIYHKACF  37



>ref|XP_006422808.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 ref|XP_006486914.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR36048.1| hypothetical protein CICLE_v10029316mg [Citrus clementina]
 gb|KDO57910.1| hypothetical protein CISIN_1g029230mg [Citrus sinensis]
Length=197

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 109/133 (82%), Gaps = 0/133 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT QKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSN+NSFEGVLYC+P
Sbjct  3    SPFGGTQQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNFNSFEGVLYCRP  62

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            HFDQLFK TGSL+KSFEG PK V+     +   + KVS+ F GT+DKCV C +TVYP EK
Sbjct  63   HFDQLFKRTGSLEKSFEGTPKIVKPEKLVENENAQKVSNKFVGTRDKCVGCDRTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+G +YHR+CF
Sbjct  123  VSVNGAAYHRSCF  135


 Score = 67.0 bits (162),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 30/69 (43%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C++TVY  +++  +   YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FVGTRDKCVGCDRTVYPTEKVSVNGAAYHRSCFKCSHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGS  269
             QLF+  G+
Sbjct  163  IQLFREKGN  171


 Score = 48.1 bits (113),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/37 (54%), Positives = 27/37 (73%), Gaps = 0/37 (0%)
 Frame = +3

Query  345  VSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            ++S F GTQ KC+AC KTVY ++K+  D   YH+ACF
Sbjct  1    MASPFGGTQQKCMACDKTVYLVDKLTADNRVYHKACF  37



>gb|KDP41612.1| hypothetical protein JCGZ_16019 [Jatropha curcas]
Length=197

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 114/133 (86%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK V+ ++ AD +  +++KVSS+F GT++KC  CK TVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIVKPDKPADGEKPSAAKVSSMFGGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 53/89 (60%), Gaps = 3/89 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKNTVYPTEKVTVNGTPYHKSCFKCIHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPK--TVRERA  317
            H +QL K  G+L +  EG  +  +V E+A
Sbjct  161  HHNQLIKEKGNLSQ-LEGDNEKDSVNEKA  188



>ref|XP_009375152.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=197

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC+GTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCRGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTS-SKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ ++  D   ++ +K SS+F GT+DKC  CK TVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIVKPDKPIDNEKSAVAKASSMFGGTRDKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH+ CF
Sbjct  123  VSVNGTPYHKMCF  135


 Score = 67.8 bits (164),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 48/85 (56%), Gaps = 1/85 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+ TVY  +++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCFGCKNTVYPTEKVSVNGTPYHKMCFKCTHGGCTISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRE  311
            H  QL K  G+L +  EG  + + E
Sbjct  161  HHTQLIKEKGNLSQ-LEGDHEKIAE  184



>ref|XP_003589058.1| Transcription factor lim1 [Medicago truncatula]
 gb|ACJ84036.1| unknown [Medicago truncatula]
 gb|AES59309.1| GATA type zinc finger transcription factor family protein [Medicago 
truncatula]
 gb|AFK36922.1| unknown [Medicago truncatula]
Length=195

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC KTVYLVD+L ADN+++HKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACNKTVYLVDKLTADNRIFHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK V+ ER  D +   ++K SS+F GT+DKC  C+KTVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIVKPERNIDNEKPAAAKASSMFGGTRDKCSGCQKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKQKGNLSQ-LEG  177



>gb|AGE09578.1| LIM-like protein [Eucalyptus cladocalyx]
Length=192

 Score =   203 bits (516),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ+FK TGSL+KSFEG PK V+      G    ++KVS +FAGT++KC  CK TVYP EK
Sbjct  63   DQIFKRTGSLEKSFEGIPKIVKPERPLGGEKPAAAKVSGMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 67.0 bits (162),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  101  GMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCSHGGCTISPSNYIAHEGKLFCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL +  G+L +  EG
Sbjct  161  HHAQLIREKGNLSQ-LEG  177



>ref|XP_002442217.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
 gb|EES16055.1| hypothetical protein SORBIDRAFT_08g016450 [Sorghum bicolor]
Length=194

 Score =   203 bits (516),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         + KVSS FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENAVKVSSAFAGTREKCVGCSKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHIQLIKEKGNFSQ  174



>ref|XP_010028358.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
Length=195

 Score =   203 bits (516),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L A+++VYHKACFRC HC GTLKL N+NSFEGVLYC+PHF
Sbjct  3    FAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ+FK TGSLDKSFEG PK V+  A D  +  T+++VS+ FAGT+DKC +C KT YPIEK
Sbjct  63   DQIFKRTGSLDKSFEGTPKIVKPGATDNENAATANRVSAFFAGTRDKCASCNKTAYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH+ CF
Sbjct  123  VTVNGTGYHKRCF  135


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 6/95 (6%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A FAGT  KC +C KT Y ++++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  AFFAGTRDKCASCNKTAYPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSL------DKSFEGAPKTVRERAAD  323
            H  QLFK  G+       +K FE    T  E  A+
Sbjct  161  HHTQLFKEKGNYSQLDTSNKQFEATKVTAVEVLAE  195



>emb|CDO97286.1| unnamed protein product [Coffea canephora]
Length=193

 Score =   202 bits (515),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKC  CEKTVYLVD+L ADN++YHKACFRC HC+ TLKL N+NSF+GVLYC+PHF
Sbjct  3    FVGTTQKCTVCEKTVYLVDKLAADNRIYHKACFRCHHCQRTLKLGNFNSFDGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSLDKSFEG PK V+         ++KVSSLF GT+DKC+ C KTVYPIEKV 
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKPEKPVDHENATKVSSLFVGTRDKCIGCDKTVYPIEKVT  122

Query  423  VDGTSYHRACF  455
            V+G  YHR+CF
Sbjct  123  VNGKPYHRSCF  133


 Score = 70.1 bits (170),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/83 (41%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY ++++  + K YH++CF+C H   T+  SNY + EG LYCK 
Sbjct  99   SLFVGTRDKCIGCDKTVYPIEKVTVNGKPYHRSCFKCSHGGCTISPSNYIAHEGTLYCKH  158

Query  237  HFDQLFKMTGS---LDKSFEGAP  296
            H  QL K  G+   L+   +  P
Sbjct  159  HHAQLVKEKGNYSQLENDMDKEP  181



>ref|XP_006417487.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
 dbj|BAJ34608.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ35840.1| hypothetical protein EUTSA_v10008856mg [Eutrema salsugineum]
Length=189

 Score =   202 bits (515),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 52/86 (60%), Gaps = 1/86 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +  EG     RE+  
Sbjct  163  IQLIKEKGNLSQ-LEGGDNAAREKVV  187



>ref|XP_009765343.1| PREDICTED: pollen-specific protein SF3-like [Nicotiana sylvestris]
Length=193

 Score =   202 bits (515),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+       +    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPHKPIDSEKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/82 (44%), Positives = 49/82 (60%), Gaps = 1/82 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKT  302
            H  QL K  G+L K  EG  +T
Sbjct  161  HHIQLIKEKGNLSK-LEGDHET  181



>ref|XP_009148339.1| PREDICTED: pollen-specific protein SF3 [Brassica rapa]
 emb|CDX93448.1| BnaA06g06000D [Brassica napus]
Length=190

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YHR+CF
Sbjct  123  VSVNGTLYHRSCF  135


 Score = 73.2 bits (178),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/86 (38%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +++  
Sbjct  163  IQLIKEKGNLSQLEGGGENAAKDKVV  188



>ref|XP_010059807.1| PREDICTED: pollen-specific protein SF3-like [Eucalyptus grandis]
 gb|KCW66254.1| hypothetical protein EUGRSUZ_F00087 [Eucalyptus grandis]
Length=192

 Score =   202 bits (515),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 113/133 (85%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERA-ADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ+FK TGSL+KSFEG PK V+ ER    +   ++KVS +FAGT++KC  CK TVYP EK
Sbjct  63   DQIFKRTGSLEKSFEGIPKIVKPERPLGSEKPAAAKVSGMFAGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 67.4 bits (163),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 33/78 (42%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              FAGT +KC  C+ TVY  +++  +   YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  101  GMFAGTREKCFGCKNTVYPTEKVSVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLFCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL +  G+L +  EG
Sbjct  161  HHAQLIREKGNLSQ-LEG  177



>gb|AGE09584.1| LIM1-like protein [Eucalyptus cladocalyx]
Length=188

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L ADN++YHKACFRC HCKGTLKL N+NSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACEKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNFNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++KVS +F GT+DKCV CK TVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGNPKIAKPEKPVDGERPAATKVSGMFGGTRDKCVGCKSTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 65.1 bits (157),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/78 (41%), Positives = 44/78 (56%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYC+ 
Sbjct  101  GMFGGTRDKCVGCKSTVYPTEKVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGKLYCRH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHTQLIKEKGNLSQ-LEG  177



>emb|CDX94916.1| BnaC05g07550D [Brassica napus]
Length=189

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YHR+CF
Sbjct  123  VSVNGTLYHRSCF  135


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/85 (40%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YH++CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHRSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERA  317
             QL K  G+L +  EG     +++ 
Sbjct  163  IQLIKEKGNLSQ-LEGGDNAAKDKV  186



>gb|ABY21316.1| LIM1 [Lilium longiflorum]
Length=181

 Score =   202 bits (513),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 108/131 (82%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKC AC KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PH+
Sbjct  3    FQGTTQKCMACTKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHY  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQLFK TGSL+KSFEG PK V+         ++KVS  FAGT++KCV C+KTVYPIE+V 
Sbjct  63   DQLFKRTGSLEKSFEGTPKIVKPEKPIGTENANKVSGAFAGTKEKCVGCQKTVYPIERVT  122

Query  423  VDGTSYHRACF  455
            V+GT YH++CF
Sbjct  123  VNGTCYHKSCF  133


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 40/87 (46%), Positives = 53/87 (61%), Gaps = 4/87 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              FAGT +KC  C+KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  99   GAFAGTKEKCVGCQKTVYPIERVTVNGTCYHKSCFKCAHGGCTISPSNYIAHEGTLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERA  317
            H  QL K  G+L +  EG   TV E A
Sbjct  159  HHIQLIKEKGNLSQ-LEG---TVAETA  181



>gb|ABW69660.1| transcription factor LIM [Triticum aestivum]
Length=196

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         ++KVSS FAGT++KC  C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENATKVSSAFAGTREKCFGCSKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  101  SAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHTQLIKEKGNFSQ  174



>ref|NP_001104937.2| LOC541782 [Zea mays]
 gb|AAF67835.2|AF135591_1 LIM transcription factor homolog [Zea mays]
Length=197

 Score =   202 bits (514),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         ++KVSS FAGT++KCV C KTVYP 
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENATKVSSAFAGTREKCVGCSKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY  +++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGS  269
            H  QL K  G+
Sbjct  161  HHIQLIKERGT  171



>ref|XP_004501516.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=191

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC +C+KTVYLVD+L ADN++YHK CFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMSCDKTVYLVDKLTADNRIYHKGCFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK  +   +  ++   ++KVSS+F GT++KC  C+KTVYP EK
Sbjct  63   DQLFKRTGSLDKSFEGTPKIAKPEKSSYNEKPAAAKVSSMFGGTREKCSGCQKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 70.9 bits (172),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCSGCQKTVYPTEKVSVNGTPYHKSCFKCIHGGCVISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHVQLIKEKGNLSQ-LEG  177



>ref|XP_008648273.1| PREDICTED: LOC541782 isoform X1 [Zea mays]
 gb|ACG33608.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG42218.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG46790.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG47580.1| pollen-specific protein SF3 [Zea mays]
 gb|ACL54041.1| unknown [Zea mays]
 gb|AFW74663.1| putative LIM-type zinc finger domain family protein [Zea mays]
 gb|AIB05891.1| LIM transcription factor, partial [Zea mays]
Length=195

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         ++KVSS FAGT++KCV C KTVYP 
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENATKVSSAFAGTREKCVGCSKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 36/90 (40%), Positives = 53/90 (59%), Gaps = 0/90 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY  +++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQ  326
            H  QL K  G+  +      KT +  + ++
Sbjct  161  HHIQLIKEKGNFSQLENDHEKTSQAGSLEE  190



>gb|ACG34183.1| pollen-specific protein SF3 [Zea mays]
Length=195

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         ++KVSS FAGT++KCV C KTVYP 
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENATKVSSAFAGTREKCVGCSKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 46/74 (62%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY  +++  +N +YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCSKTVYPTERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  Q  K  G+  +
Sbjct  161  HHIQXIKEKGNFSQ  174



>ref|XP_004498991.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=195

 Score =   201 bits (512),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYCKPHF
Sbjct  3    FAGTTQKCMACNKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSS-KVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  + ER  D    ++ K SS+F GT+DKC  C+KTVYP EK
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPERNNDNEKPAAVKASSMFGGTRDKCSGCQKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/78 (44%), Positives = 46/78 (59%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTRDKCSGCQKTVYPTEKVTVNGTPYHKSCFKCCHGGCVISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L +  EG
Sbjct  161  HHIQLIKEKGNLSQ-LEG  177



>dbj|BAB84584.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   201 bits (512),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+  ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKFTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ +     +    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L K  EG
Sbjct  161  HHIQLIKEKGNLSK-LEG  177



>dbj|BAJ94823.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=196

 Score =   201 bits (511),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSFEG PK V+         + KVSS FAGT++KC  C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFEGTPKVVKPERNVGNENAIKVSSAFAGTREKCFGCSKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH++CF
Sbjct  121  ERVTVNNTMYHKSCF  135


 Score = 71.6 bits (174),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  101  SAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHTQLIKEKGNFSQ  174



>ref|XP_006304225.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
 gb|EOA37123.1| hypothetical protein CARUB_v10010373mg [Capsella rubella]
Length=190

 Score =   201 bits (510),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 75.1 bits (183),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +E+  
Sbjct  163  IQLIKEKGNLSQLEGGGDNATKEKVV  188



>ref|XP_010475882.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   201 bits (511),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGA  293
             QL K  G+L +  EG 
Sbjct  163  LQLIKEKGNLSQ-LEGG  178



>ref|NP_172491.1| transcription factor lim1 [Arabidopsis thaliana]
 sp|Q94JX5.1|WLIM1_ARATH RecName: Full=LIM domain-containing protein WLIM1; AltName: Full=Widely-expressed 
LIM protein 1; Short=AtWLIM1 [Arabidopsis 
thaliana]
 gb|AAK49575.1|AF370569_1 similar to transcription factor SF3 (pir|IS37656) [Arabidopsis 
thaliana]
 gb|AAM62606.1| putative transcription factor [Arabidopsis thaliana]
 gb|AEE28552.1| transcription factor lim1 [Arabidopsis thaliana]
Length=190

 Score =   201 bits (510),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +++  
Sbjct  163  IQLIKEKGNLSQLEGGGENAAKDKVV  188



>ref|XP_010490782.1| PREDICTED: LIM domain-containing protein WLIM1 [Camelina sativa]
Length=190

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 74.7 bits (182),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 35/86 (41%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +E+  
Sbjct  163  LQLIKEKGNLSQLEGGGDNAAKEKVV  188



>emb|CDY20647.1| BnaC08g14110D [Brassica napus]
Length=189

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDKPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERA  317
             QL K  G+L +  EG     +++ 
Sbjct  163  IQLIKEKGNLSQ-LEGGDNAAKDKV  186



>ref|XP_008811666.1| PREDICTED: pollen-specific protein SF3 [Phoenix dactylifera]
Length=195

 Score =   201 bits (511),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 112/133 (84%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC AC KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ E+  D +  T+++VSS FAGT++KCV C KTVYPIE+
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKPEKPVDTEKPTANRVSSSFAGTREKCVGCMKTVYPIER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT+YH++CF
Sbjct  123  VTVNGTAYHKSCF  135


 Score = 72.4 bits (176),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 52/95 (55%), Gaps = 0/95 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            ++FAGT +KC  C KTVY ++++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SSFAGTREKCVGCMKTVYPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSS  341
            H  QLFK  G+  +      K   E  A  G   S
Sbjct  161  HHIQLFKEKGNYSQLETDQDKMGNEAPASAGELVS  195



>ref|XP_010458355.1| PREDICTED: LIM domain-containing protein WLIM1-like [Camelina 
sativa]
Length=191

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 72.4 bits (176),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 35/77 (45%), Positives = 49/77 (64%), Gaps = 1/77 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGA  293
             QL K  G+L +  EG 
Sbjct  163  LQLIKEKGNLSQ-LEGG  178



>ref|XP_009144466.1| PREDICTED: pollen-specific protein SF3-like [Brassica rapa]
 emb|CDY31040.1| BnaA08g25900D [Brassica napus]
Length=189

 Score =   201 bits (510),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/85 (41%), Positives = 52/85 (61%), Gaps = 1/85 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERA  317
             QL K  G+L +  EG     +++ 
Sbjct  163  IQLIKEKGNLSQ-LEGGDNAAKDKV  186



>ref|XP_004238086.1| PREDICTED: LIM domain-containing protein WLIM1 [Solanum lycopersicum]
Length=193

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 109/133 (82%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ +     +    +KV+S+F GT++KC  CK TVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPQKLIDSEKPQVAKVTSMFGGTREKCFGCKNTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH+ CF
Sbjct  123  VSVNGTPYHKNCF  135


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 49/83 (59%), Gaps = 1/83 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+ TVY  +++  +   YHK CF+C H    + LSNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKNTVYPTEKVSVNGTPYHKNCFKCSHGGCVISLSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTV  305
            H  QL K  G+L K  EG  +T+
Sbjct  161  HHIQLIKEKGNLSK-LEGDHETI  182



>gb|AFV60741.1| LIM domain protein LIM-2 [Gossypium hirsutum]
 gb|KJB63463.1| hypothetical protein B456_010G026100 [Gossypium raimondii]
Length=190

 Score =   200 bits (508),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++KVS +F GT+DKC  CK TVYP E+
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDGEKPIATKVSGMFGGTRDKCFGCKNTVYPTER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 65.9 bits (159),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  GMFGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAAD  323
            H  QL K  G+L +      K   E AA+
Sbjct  161  HHGQLIKEKGNLSQLEGDREKDGTEVAAE  189



>ref|XP_010942770.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 93/133 (70%), Positives = 108/133 (81%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC AC KTVYLVD+L ADN++YHKACF+C HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTQTKCTACSKTVYLVDKLTADNRIYHKACFKCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRER--AADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFKMTGSLDKSFEG PK V+       +   + KVSS FAGT++KCV C+KTVYP E+
Sbjct  63   DQLFKMTGSLDKSFEGTPKIVKPEKPVITEKPAAHKVSSAFAGTREKCVGCRKTVYPTER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT+YHR+CF
Sbjct  123  VTVNGTAYHRSCF  135


 Score = 68.2 bits (165),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 36/95 (38%), Positives = 49/95 (52%), Gaps = 0/95 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY  +++  +   YH++CF+C H    +  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCRKTVYPTERVTVNGTAYHRSCFKCTHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSS  341
            H  QL K  G+  +      K   E  A  G   S
Sbjct  161  HHIQLIKEKGNYSQLETDQEKMGSEAPASAGELVS  195



>dbj|BAA82827.1| transcription factor Ntlim1 [Nicotiana tabacum]
Length=200

 Score =   200 bits (509),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCKGT+KL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTVKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ +     +    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   DQLFKQTGSLDKSFEGTPKIVKPQKPIDSEKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+ +GT YH++CF
Sbjct  123  VSANGTPYHKSCF  135


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 36/78 (46%), Positives = 48/78 (62%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++ A+   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSANGTPYHKSCFQCSHGGCVISPSNYTAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L K  EG
Sbjct  161  HHIQLIKEKGNLSK-LEG  177



>ref|NP_001148027.1| pollen-specific protein SF3 [Zea mays]
 gb|ACG29494.1| pollen-specific protein SF3 [Zea mays]
 tpg|DAA55370.1| TPA: putative LIM-type zinc finger domain family protein [Zea 
mays]
 gb|AIB05750.1| LIM transcription factor, partial [Zea mays]
Length=196

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 95/135 (70%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSF+GVLYC
Sbjct  1    MATSFQGTTTKCTACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFDGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            +PHFDQLFK TGSLDKSF+G PK V+         ++KVSS FAGT++KCV C KTVYPI
Sbjct  61   RPHFDQLFKRTGSLDKSFQGTPKVVKPERNVGNENATKVSSAFAGTREKCVGCSKTVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+ T YH+ CF
Sbjct  121  ERVTVNNTMYHKCCF  135


 Score = 72.0 bits (175),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/74 (46%), Positives = 47/74 (64%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  101  SAFAGTREKCVGCSKTVYPIERVTVNNTMYHKCCFKCCHGGCTISPSNYIAHEGKLYCKH  160

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  161  HHVQLIKEKGNFSQ  174



>gb|KJB63466.1| hypothetical protein B456_010G026100 [Gossypium raimondii]
Length=185

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 109/132 (83%), Gaps = 5/132 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            DQLFK TGSL+KSFEG PK  + E+  D    ++KVS +F GT+DKC  CK TVYP E+V
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVD----ATKVSGMFGGTRDKCFGCKNTVYPTERV  118

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  119  TVNGTPYHKSCF  130


 Score = 65.9 bits (159),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 47/89 (53%), Gaps = 0/89 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  96   GMFGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHEGRLYCKH  155

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAAD  323
            H  QL K  G+L +      K   E AA+
Sbjct  156  HHGQLIKEKGNLSQLEGDREKDGTEVAAE  184



>ref|XP_002892554.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68813.1| hypothetical protein ARALYDRAFT_471134 [Arabidopsis lyrata subsp. 
lyrata]
Length=190

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FVGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +++  
Sbjct  163  IQLIKEKGNLSQLEGGGENAAKDKVV  188



>ref|XP_010938994.1| PREDICTED: LIM domain-containing protein WLIM1-like [Elaeis guineensis]
Length=195

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 111/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC AC KTVYLVD+L ADN++YHKACFRC HC+GTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTQTKCTACSKTVYLVDKLTADNRIYHKACFRCHHCQGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVR-ERAADQGHT-SSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSFEG PK V+ E+  D   T +++VSS FAGT++KC  CKKTVYPIE+
Sbjct  63   DQLFKRTGSLDKSFEGTPKVVKPEKPVDTEKTAANRVSSQFAGTREKCFGCKKTVYPIER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT+YH++CF
Sbjct  123  VTVNGTAYHKSCF  135


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/96 (39%), Positives = 58/96 (60%), Gaps = 5/96 (5%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C+KTVY ++++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SQFAGTREKCFGCKKTVYPIERVTVNGTAYHKSCFKCTHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSK  344
            H  QLFK  G+  +      +T +E+  ++  TS++
Sbjct  161  HHIQLFKEKGNYSQL-----ETDQEKMENEAPTSAE  191



>ref|XP_010274389.1| PREDICTED: LIM domain-containing protein WLIM1-like [Nelumbo 
nucifera]
Length=186

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 112/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +FAGTTQKC+AC KTV+LVDQL ADN+++HK+CFRC HC GTLKL N++SFEGVLYC+PH
Sbjct  2    SFAGTTQKCQACNKTVHLVDQLTADNRIFHKSCFRCHHCNGTLKLGNFSSFEGVLYCRPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            +DQLFK TG LDKSFEGAPK  + E+  D Q   S++VS++F GTQ+KCV CKKTVYP+E
Sbjct  62   YDQLFKRTGRLDKSFEGAPKVAKSEKPVDSQSVGSNRVSNMFGGTQEKCVGCKKTVYPLE  121

Query  414  KVAVDGTSYHRACF  455
            KV VDG  YH+ CF
Sbjct  122  KVTVDGNVYHKICF  135


 Score = 69.7 bits (169),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  D  VYHK CFRC      L  S+Y + EG LYC+ H 
Sbjct  103  FGGTQEKCVGCKKTVYPLEKVTVDGNVYHKICFRCVRGGCVLSTSSYIAHEGKLYCRHHH  162

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  163  TQLFKEKGN  171



>gb|AII80544.1| LIM-domain protein 10 [Gossypium hirsutum]
Length=190

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 107/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQ+C AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQRCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++KVS +F GT+DKC  CK TVYP E+
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDGEKPIATKVSGMFGGTRDKCFGCKNTVYPTER  122

Query  417  VAVDGTSYHRACF  455
            V V+GT YH++CF
Sbjct  123  VTVNGTPYHKSCF  135


 Score = 62.4 bits (150),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 33/82 (40%), Positives = 45/82 (55%), Gaps = 1/82 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GT  KC  C+ TVY  +++  +   YHK+CF+C H    +  SNY + E  LYCK 
Sbjct  101  GMFGGTRDKCFGCKNTVYPTERVTVNGTPYHKSCFKCTHGGCVISPSNYIAHECRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEGAPKT  302
            H  QL K  G+L +  EG  +T
Sbjct  161  HHGQLIKEKGNLSQ-LEGDRET  181



>gb|ABB51614.1| LIM-domain protein [Brassica napus]
 gb|ABB51648.1| LIM domain protein [Brassica napus]
Length=189

 Score =   199 bits (506),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEG LYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGALYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KCV C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCVGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 35/84 (42%), Positives = 52/84 (62%), Gaps = 1/84 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRER  314
             QL K  G+L +  EG     +++
Sbjct  163  IQLIKEKGNLSQ-LEGGDNAAKDK  185



>ref|XP_010091018.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB41829.1| Pollen-specific protein SF3 [Morus notabilis]
Length=196

 Score =   199 bits (506),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/134 (69%), Positives = 106/134 (79%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKC AC KTVYLVD+L AD + YHKACFRC HC+ TLKLS+Y SFEGVLYC+
Sbjct  1    MASFAGTTQKCTACNKTVYLVDKLTADTRAYHKACFRCHHCRNTLKLSSYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSL+KSFEG PK  +         +  VSSLF GT+DKCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLEKSFEGTPKISKPEKPTTSENAKIVSSLFGGTRDKCVGCNKTVYPIE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+GT YH++CF
Sbjct  121  KVTVNGTPYHKSCF  134


 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/76 (46%), Positives = 46/76 (61%), Gaps = 1/76 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  102  FGGTRDKCVGCNKTVYPIEKVTVNGTPYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  161

Query  243  DQLFKMTGSLDKSFEG  290
             QLFK  G+  +  EG
Sbjct  162  IQLFKEKGNYSQ-LEG  176



>gb|KFK43312.1| hypothetical protein AALP_AA1G108000 [Arabis alpina]
Length=186

 Score =   197 bits (502),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 94/133 (71%), Positives = 110/133 (83%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQ FK TGSL+KSFEG PK  +     +G     +KVS++F GT++KC  C KTVYPIEK
Sbjct  63   DQNFKRTGSLEKSFEGTPKIGKPDRPLEGERPAGTKVSNMFGGTREKCHGCDKTVYPIEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTLYHKSCF  135


 Score = 73.9 bits (180),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 50/79 (63%), Gaps = 1/79 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FGGTREKCHGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDKSFEGAPK  299
             QL K  G+L +  EG  K
Sbjct  163  LQLIKEKGNLSQ-LEGGDK  180



>ref|XP_007143127.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
 gb|ESW15121.1| hypothetical protein PHAVU_007G046100g [Phaseolus vulgaris]
Length=187

 Score =   194 bits (494),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKC AC+KTVYLVD+L AD +VYHKACFRC HC+ TLKLSNY SFEGVLYC+
Sbjct  1    MASFGGTTQKCMACDKTVYLVDKLTADGRVYHKACFRCHHCRNTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PH+DQL+K TGSLDKSFEG PK  + E+   +   S  ++++F GT+DKCV CKKTVYP 
Sbjct  61   PHYDQLYKRTGSLDKSFEGTPKVQKPEKPITENENSKGLANVFLGTRDKCVCCKKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V ++GT YH++CF
Sbjct  121  ERVTINGTPYHKSCF  135


 Score = 62.4 bits (150),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 43/69 (62%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C+KTVY  +++  +   YHK+CF+C +   T+  SN+ + EG LYCK H 
Sbjct  103  FLGTRDKCVCCKKTVYPTERVTINGTPYHKSCFKCTYGGCTISSSNFITHEGKLYCKHHH  162

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  163  IQLFKEKGN  171



>ref|NP_001236461.1| uncharacterized protein LOC100306027 [Glycine max]
 gb|ACU14005.1| unknown [Glycine max]
Length=179

 Score =   194 bits (492),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 110/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKC AC KTVYLVD+L AD++VYHKACFRC+HC+ TLKLSNY SFEGVLYC+
Sbjct  1    MASFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCYHCRNTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKV-SSLFAGTQDKCVACKKTVYPI  410
            PH+DQL+K TGSLDKSFEG PK  +      G+ ++KV +++F GT+DKCV C KTVYP 
Sbjct  61   PHYDQLYKRTGSLDKSFEGIPKIQKPEKPVTGNENTKVLANVFLGTRDKCVCCNKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+GT YH+ CF
Sbjct  121  ERVTVNGTPYHKGCF  135


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C KTVY  +++  +   YHK CF+C +   T+  SN+ + EG LYCK H 
Sbjct  103  FLGTRDKCVCCNKTVYPTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>gb|EYU36386.1| hypothetical protein MIMGU_mgv1a009946mg [Erythranthe guttata]
Length=326

 Score =   197 bits (502),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 90/134 (67%), Positives = 113/134 (84%), Gaps = 2/134 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +  GTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HC GTLKL+NYNSFEGVLYC+PH
Sbjct  141  SIQGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCNGTLKLANYNSFEGVLYCRPH  200

Query  240  FDQLFKMTGSLDKSFEGAPKTVR-ERAAD-QGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK TGSLDKSF+G PK  + E+ +D +   ++K+  +F GT++KC+ACK TVYP E
Sbjct  201  FDQLFKRTGSLDKSFDGTPKIAKPEKPSDTEKPQANKMIGMFVGTREKCLACKNTVYPTE  260

Query  414  KVAVDGTSYHRACF  455
            KV+V+GT+YH++CF
Sbjct  261  KVSVNGTAYHKSCF  274


 Score = 69.3 bits (168),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 47/79 (59%), Gaps = 1/79 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            +  F GT +KC AC+ TVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK
Sbjct  239  IGMFVGTREKCLACKNTVYPTEKVSVNGTAYHKSCFKCSHGGCVISPSNYIAHEGRLYCK  298

Query  234  PHFDQLFKMTGSLDKSFEG  290
             H  QL K  G+L +  EG
Sbjct  299  HHHLQLIKEKGNLSQ-LEG  316



>ref|XP_002965335.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
 ref|XP_002977179.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ21788.1| hypothetical protein SELMODRAFT_271232 [Selaginella moellendorffii]
 gb|EFJ34173.1| hypothetical protein SELMODRAFT_143123 [Selaginella moellendorffii]
Length=185

 Score =   193 bits (490),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 98/134 (73%), Positives = 107/134 (80%), Gaps = 5/134 (4%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +FAGT QKCKAC+KTVYLVDQL AD  VYHKACFRC HCKGTLKLSNY S EGVLYCKPH
Sbjct  5    SFAGTQQKCKACDKTVYLVDQLTADGVVYHKACFRCHHCKGTLKLSNYASLEGVLYCKPH  64

Query  240  FDQLFKMTGSLDKSFEGA--PKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            FDQLFK+TGS DKSFE     K V E A+    T SK S LF+GTQ+KC AC KTVYPIE
Sbjct  65   FDQLFKLTGSFDKSFESGLLHKPVGEEASK---TPSKTSLLFSGTQEKCFACGKTVYPIE  121

Query  414  KVAVDGTSYHRACF  455
            KV V+ TSYH++CF
Sbjct  122  KVTVENTSYHKSCF  135


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 38/86 (44%), Positives = 52/86 (60%), Gaps = 4/86 (5%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC AC KTVY ++++  +N  YHK+CF+C H   T+  SNY + EG LYC+ H+
Sbjct  103  FSGTQEKCFACGKTVYPIEKVTVENTSYHKSCFKCSHGGCTISPSNYQAHEGRLYCRHHY  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G     F    KT  + AA
Sbjct  163  AQLVKEKG----DFSNLSKTPGKAAA  184



>gb|KHG30571.1| Pollen-specific SF3 [Gossypium arboreum]
Length=151

 Score =   192 bits (487),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MATFAGT QKC AC+KTVYLVD+L ADN+V+HKACFRC HCKGTLKLSNYNSFEGVLYC+
Sbjct  1    MATFAGTQQKCMACDKTVYLVDKLTADNRVFHKACFRCHHCKGTLKLSNYNSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PH+DQLFK TGSLDKSFEG PK  +     +   + KV +LF GT++KCV C KTVYPIE
Sbjct  61   PHYDQLFKRTGSLDKSFEGTPKIAKPEKHIENENAQKVVNLFGGTKEKCVGCNKTVYPIE  120

Query  414  K  416
            K
Sbjct  121  K  121


 Score = 47.0 bits (110),  Expect = 5e-04, Method: Compositional matrix adjust.
 Identities = 19/33 (58%), Positives = 25/33 (76%), Gaps = 0/33 (0%)
 Frame = +3

Query  357  FAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            FAGTQ KC+AC KTVY ++K+  D   +H+ACF
Sbjct  4    FAGTQQKCMACDKTVYLVDKLTADNRVFHKACF  36



>dbj|BAB84583.1| transcription factor LIM [Nicotiana tabacum]
Length=193

 Score =   192 bits (487),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 90/133 (68%), Positives = 106/133 (80%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN++YHKACFRC HCK TLKL N NSFEGVLYC+PH 
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRIYHKACFRCHHCKATLKLGNSNSFEGVLYCRPHL  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
              LFK TGSLDKSFEG PK VR +     +    +KV+S+F GT++KC  CKKTVYP EK
Sbjct  63   IGLFKQTGSLDKSFEGTPKIVRPQKPIDSEKPQVAKVTSMFGGTREKCFGCKKTVYPTEK  122

Query  417  VAVDGTSYHRACF  455
            V+V+GT YH++CF
Sbjct  123  VSVNGTPYHKSCF  135


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/78 (45%), Positives = 47/78 (60%), Gaps = 1/78 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT +KC  C+KTVY  +++  +   YHK+CF+C H    +  SNY + EG LYCK 
Sbjct  101  SMFGGTREKCFGCKKTVYPTEKVSVNGTPYHKSCFKCSHGGCVISPSNYIAHEGRLYCKH  160

Query  237  HFDQLFKMTGSLDKSFEG  290
            H  QL K  G+L K  EG
Sbjct  161  HHIQLIKEKGNLSK-LEG  177



>gb|ACA33852.1| LIM2 transcription factor [Pinus taeda]
Length=122

 Score =   189 bits (479),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 2/120 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKCKACEKTVYLVDQL ADN V+HK+CFRC HC GTLKLSNY+SFEGVLYCKPHF
Sbjct  3    FAGTTQKCKACEKTVYLVDQLTADNSVFHKSCFRCHHCNGTLKLSNYSSFEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSLDKSF   P+  R      ++  T S+VS+LF+GTQDKCVAC KTVYPIEK
Sbjct  63   DQLFKRTGSLDKSFAAIPRASRNDKMHENENRTPSRVSALFSGTQDKCVACGKTVYPIEK  122



>sp|P29675.1|SF3_HELAN RecName: Full=Pollen-specific protein SF3 [Helianthus annuus]
 gb|AAD56958.1|AF187104_1 LIM domain protein PLIM1a [Helianthus annuus]
 emb|CAA45731.1| Transcription factor SF3 [Helianthus annuus]
Length=219

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            M +F GTTQKC  CEKTVYLVD+L A+ +VYHKACFRC HC  TLKLSN+NSF+GV+YC+
Sbjct  1    MKSFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERA-ADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
             HFDQLFK TGSL+KSF+G PK   ER  + +  +++++SS F GT+DKC AC K VYPI
Sbjct  61   HHFDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSANRLSSFFEGTRDKCNACAKIVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V VDGT+YHRACF
Sbjct  121  ERVKVDGTAYHRACF  135


 Score = 72.8 bits (177),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 34/72 (47%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC AC K VY +++++ D   YH+ACF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FEGTRDKCNACAKIVYPIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKKKGNYSQ  174



>gb|KHN06818.1| Pollen-specific protein SF3 [Glycine soja]
Length=179

 Score =   191 bits (484),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 108/135 (80%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GTTQKC AC KTVYLVD+L AD++VYHKACFRC HC  TLKLSNY SFEGVLYC+
Sbjct  1    MASFGGTTQKCMACAKTVYLVDKLTADSRVYHKACFRCHHCGNTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKV-SSLFAGTQDKCVACKKTVYPI  410
            PH+DQL+K TGSLDKSFEG PK  +      G+ ++KV +++F GT+DKCV C KTVYP 
Sbjct  61   PHYDQLYKRTGSLDKSFEGIPKIQKPEKPVTGNENTKVLANVFLGTRDKCVCCNKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+GT YH+ CF
Sbjct  121  ERVTVNGTPYHKGCF  135


 Score = 61.6 bits (148),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 42/72 (58%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC  C KTVY  +++  +   YHK CF+C +   T+  SN+ + EG LYCK H 
Sbjct  103  FLGTRDKCVCCNKTVYPTERVTVNGTPYHKGCFKCTYGGCTVSSSNFITHEGKLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>gb|AAD56957.1|AF187103_1 LIM domain protein PLIM1b [Helianthus annuus]
Length=214

 Score =   192 bits (487),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 109/135 (81%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            M +F GTTQKC  CEKTVYLVD+L A+ +VYHKACFRC HC  TLKLSN+NSF+GV+YC+
Sbjct  1    MKSFTGTTQKCTVCEKTVYLVDKLVANQRVYHKACFRCHHCNSTLKLSNFNSFDGVVYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERA-ADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
             HFDQLFK TGSL+KSF+G PK   ER  + +  +++++SS F GT+DKC AC K VYPI
Sbjct  61   HHFDQLFKRTGSLEKSFDGTPKFKPERTFSQETQSANRLSSFFEGTRDKCNACAKIVYPI  120

Query  411  EKVAVDGTSYHRACF  455
            E+V VDGT+YHRACF
Sbjct  121  ERVKVDGTAYHRACF  135


 Score = 72.8 bits (177),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 59/112 (53%), Gaps = 5/112 (4%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT  KC AC K VY +++++ D   YH+ACF+C H   T+  SNY + EG LYCK H 
Sbjct  103  FEGTRDKCNACAKIVYPIERVKVDGTAYHRACFKCCHGGCTISPSNYIAHEGRLYCKHHH  162

Query  243  DQLFKMTGS-----LDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCV  383
             QLFK  G+     ++++     ++  + A  Q   +    +    TQ+  V
Sbjct  163  IQLFKKKGNYSQLEVEETVAAPAESETQNAETQNAETQNADTQNTDTQNAAV  214



>ref|XP_004496871.1| PREDICTED: pollen-specific protein SF3-like [Cicer arietinum]
Length=181

 Score =   191 bits (484),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/135 (64%), Positives = 107/135 (79%), Gaps = 1/135 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+FAGTTQKC ACEKTVYLVD+L AD + YH ACFRC HC+ TLKLSNY SFEGVLYC+
Sbjct  1    MASFAGTTQKCTACEKTVYLVDKLTADGRTYHMACFRCHHCRNTLKLSNYCSFEGVLYCR  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            PH+DQL+K TGSLDKSF+G PK  + E+   +   +  ++++F GT DKC+ CKKTVYP 
Sbjct  61   PHYDQLYKRTGSLDKSFDGTPKIQKAEKQTSENENAKTLANVFVGTTDKCMCCKKTVYPT  120

Query  411  EKVAVDGTSYHRACF  455
            E+V V+GT YH+ CF
Sbjct  121  ERVTVNGTPYHKGCF  135


 Score = 61.2 bits (147),  Expect = 6e-09, Method: Compositional matrix adjust.
 Identities = 30/72 (42%), Positives = 43/72 (60%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTT KC  C+KTVY  +++  +   YHK CF+C +   T+  +N+ + E  LYCK H 
Sbjct  103  FVGTTDKCMCCKKTVYPTERVTVNGTPYHKGCFKCTYGGCTISSANFVTHETKLYCKHHH  162

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  163  IQLFKEKGNYSQ  174



>ref|XP_008793825.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Phoenix 
dactylifera]
Length=133

 Score =   188 bits (477),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 91/124 (73%), Positives = 103/124 (83%), Gaps = 4/124 (3%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              F GTTQKCKACEKTVYLVDQL AD +VYHKACFRC HCKGTLKLSNY+S +GVLYCKP
Sbjct  4    GAFGGTTQKCKACEKTVYLVDQLTADGRVYHKACFRCHHCKGTLKLSNYSSIDGVLYCKP  63

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTS---SKVSSLFAGTQDKCVACKKTVYP  407
            H+DQLFKMTGSLDKSFEG+ ++ +   ++ GH S   S+  S+F GTQDKCV CKKTVYP
Sbjct  64   HYDQLFKMTGSLDKSFEGSSRSAKADRSN-GHESNANSRFLSMFVGTQDKCVVCKKTVYP  122

Query  408  IEKV  419
            IEKV
Sbjct  123  IEKV  126



>ref|XP_001765937.1| predicted protein [Physcomitrella patens]
 gb|EDQ69258.1| predicted protein [Physcomitrella patens]
Length=191

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 104/132 (79%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GTTQKCKACEKTVYLV+QL AD  VYHK+CFRC HCKGTLKL+NY S EGVLYCKPHF
Sbjct  3    FSGTTQKCKACEKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLANYASLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAP-KTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            +QL K+TGS DKSFE  P + +++    +    SK S +F+GTQ+KC+AC KTVYPIEK 
Sbjct  63   EQLLKVTGSFDKSFEHKPSEGLKKAEKGENKAPSKASLMFSGTQEKCIACSKTVYPIEKT  122

Query  420  AVDGTSYHRACF  455
             V+G  YH+ CF
Sbjct  123  TVEGLPYHKQCF  134


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 42/93 (45%), Positives = 55/93 (59%), Gaps = 3/93 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC AC KTVY +++   +   YHK CF+C H   T+  SNY + EG LYCKPH+
Sbjct  102  FSGTQEKCIACSKTVYPIEKTTVEGLPYHKQCFKCVHGGCTISPSNYAALEGRLYCKPHY  161

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSS  341
             QLFK  G+  +    AP    + AA Q  T S
Sbjct  162  SQLFKEKGNYSQ-LTKAP--ALKVAASQAITES  191



>gb|KJB63465.1| hypothetical protein B456_010G026100 [Gossypium raimondii]
 gb|KJB63467.1| hypothetical protein B456_010G026100 [Gossypium raimondii]
Length=127

 Score =   183 bits (465),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH--TSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLFK TGSL+KSFEG PK  +      G    ++KVS +F GT+DKC  CK TVYP E+
Sbjct  63   DQLFKRTGSLEKSFEGTPKIAKPEKPVDGEKPIATKVSGMFGGTRDKCFGCKNTVYPTER  122

Query  417  VAV  425
            V +
Sbjct  123  VNI  125



>ref|XP_009389653.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=195

 Score =   185 bits (470),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 109/131 (83%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GTT KC AC KTVYLV++L ADN+VYHKACFRC HCKGTLKL NYNSFEGVLYC+PHF
Sbjct  3    FQGTTTKCTACTKTVYLVEKLTADNRVYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQ++K TGSLDKSFEG PK V+         ++KVSS FAGT++KCV CKKTVYPIE+V 
Sbjct  63   DQIYKSTGSLDKSFEGTPKVVKPEKFVDNENANKVSSAFAGTREKCVGCKKTVYPIERVT  122

Query  423  VDGTSYHRACF  455
            V+GT+YH++CF
Sbjct  123  VNGTAYHKSCF  133


 Score = 76.3 bits (186),  Expect = 5e-14, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 53/88 (60%), Gaps = 0/88 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C+KTVY ++++  +   YHK+CF+C H   T+  SNY + EG LYCK 
Sbjct  99   SAFAGTREKCVGCKKTVYPIERVTVNGTAYHKSCFKCSHGGCTISPSNYIAHEGTLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            H  QL K  G+  K  +   KT  E A+
Sbjct  159  HHIQLIKQKGNYSKLEDEKEKTSDEAAS  186



>gb|KCW55096.1| hypothetical protein EUGRSUZ_I01055 [Eucalyptus grandis]
Length=177

 Score =   184 bits (466),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/131 (66%), Positives = 102/131 (78%), Gaps = 16/131 (12%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC ACEKTVYLVD+L A+++VYHKACFRC HC GTLKL N+NSFEGVLYC+PHF
Sbjct  3    FAGTTQKCTACEKTVYLVDKLTANSRVYHKACFRCHHCNGTLKLGNFNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            DQ+FK TGSLDKSFE                +++VS+ FAGT+DKC +C KT YPIEKV 
Sbjct  63   DQIFKRTGSLDKSFE----------------ANRVSAFFAGTRDKCASCNKTAYPIEKVT  106

Query  423  VDGTSYHRACF  455
            V+GT YH+ CF
Sbjct  107  VNGTGYHKRCF  117


 Score = 71.2 bits (173),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 52/95 (55%), Gaps = 6/95 (6%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A FAGT  KC +C KT Y ++++  +   YHK CF+C H   T+  SNY + EG LYCK 
Sbjct  83   AFFAGTRDKCASCNKTAYPIEKVTVNGTGYHKRCFKCAHGGCTISPSNYIAHEGKLYCKH  142

Query  237  HFDQLFKMTGSL------DKSFEGAPKTVRERAAD  323
            H  QLFK  G+       +K FE    T  E  A+
Sbjct  143  HHTQLFKEKGNYSQLDTSNKQFEATKVTAVEVLAE  177



>gb|KDP44510.1| hypothetical protein JCGZ_16343 [Jatropha curcas]
Length=191

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 102/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKC ACEKTVYLVD+L ADN++YH+ CF+C HCK TLKL NY SFEGVLYC+PH
Sbjct  6    SFGGTQQKCMACEKTVYLVDKLAADNRIYHRTCFKCHHCKNTLKLGNYCSFEGVLYCRPH  65

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            +DQLFK TG L+KSFEG PK  +         ++KVS+ F GT+++CV C KT YPIE+V
Sbjct  66   YDQLFKRTGCLNKSFEGIPKIAKPGKPIDVEVANKVSNKFGGTRERCVGCSKTAYPIERV  125

Query  420  AVDGTSYHRACF  455
             V+GT YH++CF
Sbjct  126  TVNGTPYHKSCF  137


 Score = 70.5 bits (171),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/72 (43%), Positives = 45/72 (63%), Gaps = 0/72 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT ++C  C KT Y ++++  +   YHK+CF+C H   T+  SNY ++EG LYCK H 
Sbjct  105  FGGTRERCVGCSKTAYPIERVTVNGTPYHKSCFKCIHGGCTISPSNYIAYEGKLYCKHHH  164

Query  243  DQLFKMTGSLDK  278
             QLFK  G+  +
Sbjct  165  IQLFKERGNYSQ  176



>gb|AAD32870.1|AC005489_8 F14N23.8 [Arabidopsis thaliana]
Length=223

 Score =   184 bits (466),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 95/166 (57%), Positives = 111/166 (67%), Gaps = 35/166 (21%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FAGTTQKC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKLSNYNSFEGVLYC+PHF
Sbjct  3    FAGTTQKCMACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLSNYNSFEGVLYCRPHF  62

Query  243  DQLFKMTGSLDKSFEG---------------------------------APKTVRERAAD  323
            DQ FK TGSL+KSFEG                                  PK  +     
Sbjct  63   DQNFKRTGSLEKSFEGKLPKTDQNVKSFVSGDFKFGIIYLKFDSYICTGTPKIGKPDRPL  122

Query  324  QGH--TSSKVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            +G     +KVS++F GT++KCV C KTVYPIEKV+V+GT YH++CF
Sbjct  123  EGERPAGTKVSNMFGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCF  168


 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/86 (40%), Positives = 51/86 (59%), Gaps = 0/86 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT +KC  C+KTVY ++++  +  +YHK+CF+C H   T+  SNY + EG LYCK H 
Sbjct  136  FGGTREKCVGCDKTVYPIEKVSVNGTLYHKSCFKCTHGGCTISPSNYIAHEGKLYCKHHH  195

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAA  320
             QL K  G+L +   G     +++  
Sbjct  196  IQLIKEKGNLSQLEGGGENAAKDKVV  221



>ref|XP_006848064.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
 gb|ERN09645.1| hypothetical protein AMTR_s00029p00199510 [Amborella trichopoda]
Length=189

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKACEKTVY++DQL AD  +YHK+CF+C HCKGTLKL NY+S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACEKTVYVMDQLSADGVLYHKSCFKCNHCKGTLKLGNYSSMEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+   K+V +   +   + SK +S+F+GTQDKC  C KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQSPAKSVEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKVT  122

Query  423  VDGTSYHRACF  455
            V+  SYH++CF
Sbjct  123  VESQSYHKSCF  133


 Score = 73.6 bits (179),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 55/88 (63%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  +++ YHK+CF+C H    +  S Y + EG+LYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESQSYHKSCFKCSHGGCPITPSTYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            HF QLFK  GS +   + A  T++ +AA
Sbjct  159  HFSQLFKEKGSYNHLIKCA--TMKRQAA  184



>ref|XP_008798954.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   182 bits (461),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 82/131 (63%), Positives = 103/131 (79%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKAC KTVYL+DQL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACNKTVYLMDQLSADGVSYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+   K+  +   +   + SK + +F+GTQ+KCVAC KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCVACGKTAYPLEKVT  122

Query  423  VDGTSYHRACF  455
            V+G +YH++CF
Sbjct  123  VEGQAYHKSCF  133


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC AC KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK HF
Sbjct  101  FSGTQEKCVACGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLD  275
             QLFK  GS +
Sbjct  161  SQLFKEKGSYN  171



>ref|XP_001771340.1| predicted protein [Physcomitrella patens]
 gb|EDQ63900.1| predicted protein [Physcomitrella patens]
Length=185

 Score =   181 bits (460),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/132 (64%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKAC+KTVYLV+QL AD  VYHK+CFRC HCKGTLKL++Y S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACDKTVYLVEQLTADGVVYHKSCFRCNHCKGTLKLASYASLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGH-TSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            +QL K+TGS DKSFE  P    ++  ++G    SK S +F+GTQDKC+AC KTVYPI+K 
Sbjct  63   EQLLKLTGSFDKSFEHKPSEGLKKLPEKGEKVPSKASLMFSGTQDKCIACSKTVYPIDKT  122

Query  420  AVDGTSYHRACF  455
             V+G  YH+ CF
Sbjct  123  TVEGLPYHKHCF  134


 Score = 79.0 bits (193),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 36/69 (52%), Positives = 45/69 (65%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT  KC AC KTVY +D+   +   YHK CF+C H   T+  SNY + EG LYCKPH+
Sbjct  102  FSGTQDKCIACSKTVYPIDKTTVEGLPYHKHCFKCVHGGCTISPSNYAALEGRLYCKPHY  161

Query  243  DQLFKMTGS  269
             QLFK  G+
Sbjct  162  SQLFKEKGN  170



>ref|XP_002969252.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
 gb|EFJ29340.1| hypothetical protein SELMODRAFT_146291 [Selaginella moellendorffii]
Length=194

 Score =   181 bits (460),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 91/138 (66%), Positives = 105/138 (76%), Gaps = 7/138 (5%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FA   QKCK+CEKTVYLVDQL AD  +YHKACFRC HCKGTLKLSNY S EGVLYCKPH 
Sbjct  3    FAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKPHL  62

Query  243  DQLFKMTGSLDKSFE--GAPKTV----RER-AADQGHTSSKVSSLFAGTQDKCVACKKTV  401
            +QLF+ TGS DKSF+  G PK      RER         SK+S LF+GTQ+KCV+C KTV
Sbjct  63   EQLFRKTGSFDKSFDSVGTPKNSLKQERERETVPSKPVVSKLSRLFSGTQEKCVSCSKTV  122

Query  402  YPIEKVAVDGTSYHRACF  455
            YP+EKV+V+G SYH++CF
Sbjct  123  YPLEKVSVEGQSYHKSCF  140


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC +C KTVY ++++  + + YHK+CF+C H    +  SNY + EG+LYCK H+
Sbjct  108  FSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLYCKHHY  167

Query  243  DQLFKMTGS  269
             QLF   G+
Sbjct  168  SQLFMEKGN  176



>ref|XP_010256708.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256709.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256710.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256711.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256712.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
 ref|XP_010256713.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Nelumbo 
nucifera]
Length=192

 Score =   180 bits (457),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 102/134 (76%), Gaps = 0/134 (0%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA F GT QKCKACEKTVY+VDQL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCK
Sbjct  1    MAFFGGTQQKCKACEKTVYVVDQLSADGVTYHKSCFKCSHCKGTLKLSNYSSMEGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHF+QLFK TGS  K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+E
Sbjct  61   PHFEQLFKETGSFKKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLE  120

Query  414  KVAVDGTSYHRACF  455
            KV V+  +YH++CF
Sbjct  121  KVTVESQAYHKSCF  134


 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 49/73 (67%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  100  SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  159

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  160  HFSQLFKEKGSYN  172



>gb|EMT23508.1| Pollen-specific protein SF3 [Aegilops tauschii]
Length=240

 Score =   181 bits (460),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 96/179 (54%), Positives = 114/179 (64%), Gaps = 45/179 (25%)
 Frame = +3

Query  54   MAT-FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYC  230
            MAT F GTT KC AC+KTVYLVD+L ADN+VYHKACFRC HCKGTLKL+NYNSFEGVLYC
Sbjct  1    MATSFQGTTTKCNACDKTVYLVDKLTADNRVYHKACFRCHHCKGTLKLANYNSFEGVLYC  60

Query  231  KPHFDQLFKMTGSLDKSFEGA---------------------------PKTVRERA----  317
            +PHFDQLFK TGSLDKSFE +                           PK +++      
Sbjct  61   RPHFDQLFKRTGSLDKSFEESNGGMLIQALQRLSSQKGMLGMRWSTIVPKMIQKHTPKII  120

Query  318  -------------ADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
                         A + H ++KVSS FAGT++KC  C KTVYPIE+V V+ T YH++CF
Sbjct  121  QNIHRFFFFFSNHATELHNATKVSSAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCF  179


 Score = 71.6 bits (174),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/74 (45%), Positives = 48/74 (65%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + FAGT +KC  C KTVY ++++  +N +YHK+CF+C H   T+  SNY + EG L+CK 
Sbjct  145  SAFAGTREKCFGCSKTVYPIERVTVNNTMYHKSCFKCCHGGCTISPSNYIAHEGKLFCKH  204

Query  237  HFDQLFKMTGSLDK  278
            H  QL K  G+  +
Sbjct  205  HHTQLIKEKGNFSQ  218



>ref|XP_010928941.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Elaeis 
guineensis]
Length=189

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKAC KTVYL+DQL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACNKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+   K+  +   +   + SK + +F+GTQ+KC  C KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKVT  122

Query  423  VDGTSYHRACF  455
            V+G +YH++CF
Sbjct  123  VEGQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 33/71 (46%), Positives = 47/71 (66%), Gaps = 0/71 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPISPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLD  275
             QLFK  GS +
Sbjct  161  SQLFKEKGSYN  171



>gb|KHN17859.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK +GS  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  159  HFSQLFKEKGSYN  171



>ref|XP_003538442.1| PREDICTED: pollen-specific protein SF3-like isoformX1 [Glycine 
max]
 ref|XP_006591370.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Glycine 
max]
 ref|XP_006591371.1| PREDICTED: pollen-specific protein SF3-like isoform X3 [Glycine 
max]
Length=200

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 82/132 (62%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK +GS  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKESGSFSKNFQSPAKLADKTTHELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  159  HFSQLFKEKGSYN  171



>ref|XP_006435557.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006435558.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 ref|XP_006486459.1| PREDICTED: pollen-specific protein SF3-like [Citrus sinensis]
 gb|ESR48797.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|ESR48798.1| hypothetical protein CICLE_v10032838mg [Citrus clementina]
 gb|KDO69271.1| hypothetical protein CISIN_1g029695mg [Citrus sinensis]
Length=189

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 103/132 (78%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCK CEKTVY V+QL AD  VYHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKVCEKTVYPVEQLSADGVVYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK +G+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC +C KTVYP+EKV
Sbjct  62   FEQLFKESGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCASCSKTVYPLEKV  121

Query  420  AVDGTSYHRACF  455
            AV+  +YH+ CF
Sbjct  122  AVENQAYHKTCF  133


 Score = 83.2 bits (204),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 53/79 (67%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC +C KTVY ++++  +N+ YHK CF+C H   ++  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCASCSKTVYPLEKVAVENQAYHKTCFKCSHGGCSISPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_007163504.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 ref|XP_007163505.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|AGV54419.1| pollen-specific protein SF3-like isoform 1 [Phaseolus vulgaris]
 gb|ESW35498.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
 gb|ESW35499.1| hypothetical protein PHAVU_001G239700g [Phaseolus vulgaris]
Length=194

 Score =   179 bits (453),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK TG+  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   YEQLFKETGTFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  159  HFSQLFKEKGSYN  171



>ref|NP_001241110.1| uncharacterized protein LOC100809121 [Glycine max]
 ref|XP_006601833.1| PREDICTED: uncharacterized protein LOC100809121 isoform X1 [Glycine 
max]
 ref|XP_006601834.1| PREDICTED: uncharacterized protein LOC100809121 isoform X2 [Glycine 
max]
 gb|ACU23614.1| unknown [Glycine max]
 gb|KHN07635.1| Pollen-specific protein SF3 [Glycine soja]
Length=198

 Score =   179 bits (453),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/132 (61%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTAYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK +GS  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   YEQLFKESGSFSKNFQSPAKLADKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133


 Score = 77.0 bits (188),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 48/73 (66%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  159  HFSQLFKEKGSYN  171



>ref|XP_006827708.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
 gb|ERM95124.1| hypothetical protein AMTR_s00009p00259550 [Amborella trichopoda]
Length=195

 Score =   178 bits (451),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 102/131 (78%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCK C+KTVY+VD L AD   YHK+CF+C HCKGTL +SNY+S EGVLYCKPHF
Sbjct  3    FSGTLQKCKMCDKTVYVVDLLSADGVNYHKSCFKCSHCKGTLSISNYSSLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+  PK+  ++  D     SK+SSLF+GTQDKC  C KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQLPPKSA-DKQHDLARAPSKLSSLFSGTQDKCATCYKTAYPLEKVT  121

Query  423  VDGTSYHRACF  455
            V+G SYH++CF
Sbjct  122  VEGESYHKSCF  132


 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/73 (42%), Positives = 46/73 (63%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  + + YHK+CF+C H    L  S Y + +G+LYCK 
Sbjct  98   SLFSGTQDKCATCYKTAYPLEKVTVEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKH  157

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  G+ +
Sbjct  158  HFAQLFKEKGNYN  170



>gb|AEA86290.1| transcription factor LIM [Solanum nigrum]
Length=119

 Score =   175 bits (444),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/119 (69%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +3

Query  81   KCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHFDQLFKM  260
            KC AC+KTVYLVD+L ADN++YHKACFRC HCKGTLKL NYNSFEGVLYC+PHFDQLFK 
Sbjct  1    KCMACDKTVYLVDKLTADNRIYHKACFRCHHCKGTLKLGNYNSFEGVLYCRPHFDQLFKQ  60

Query  261  TGSLDKSFEGAPKTVRERAA--DQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVAVDG  431
            TGSLDKSFEG PK V+ +     +    +KV+S+F GT++KC  CK TVYP EKV+V+G
Sbjct  61   TGSLDKSFEGTPKIVKPQKLIDSEKPQVAKVTSMFGGTREKCFGCKNTVYPTEKVSVNG  119



>ref|XP_004138434.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_004165359.1| PREDICTED: pollen-specific protein SF3-like [Cucumis sativus]
 ref|XP_008441430.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441431.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 ref|XP_008441432.1| PREDICTED: pollen-specific protein SF3-like [Cucumis melo]
 gb|KGN45769.1| hypothetical protein Csa_6G009480 [Cucumis sativus]
Length=189

 Score =   177 bits (449),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V+QL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK + +F+GTQDKC  C KTVYP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQDKCATCGKTVYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  SYH++CF
Sbjct  122  TVESQSYHKSCF  133


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT  KC  C KTVY ++++  +++ YHK+CF+C H    L  SNY + EG+LYCK HF
Sbjct  101  FSGTQDKCATCGKTVYPLEKVTVESQSYHKSCFKCSHGGCALSPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLDKSFEGA  293
             QLFK  GS +   + A
Sbjct  161  SQLFKEKGSYNHLIKSA  177



>ref|XP_008785448.1| PREDICTED: pollen-specific protein SF3-like [Phoenix dactylifera]
Length=189

 Score =   177 bits (449),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKAC+KTVYL+DQL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+   K   +   +   + SK + +F+GTQ+KC  C KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQSPAKPAEKPTPELTRSRSKAAGMFSGTQEKCATCGKTAYPLEKVT  122

Query  423  VDGTSYHRACF  455
            V+G +YH+ CF
Sbjct  123  VEGQAYHKFCF  133


 Score = 78.2 bits (191),  Expect = 9e-15, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  + + YHK CFRC H   ++  SNY + EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVEGQAYHKFCFRCSHGGCSISPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD  323
             QLFK  GS +   + A  +++  AA 
Sbjct  161  SQLFKEKGSYNHLIKSA--SIKRTAAS  185



>ref|XP_010923152.1| PREDICTED: LIM domain-containing protein WLIM2b isoform X1 [Elaeis 
guineensis]
Length=189

 Score =   177 bits (448),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 101/131 (77%), Gaps = 0/131 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT QKCKAC+KTVYL+DQL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPHF
Sbjct  3    FSGTQQKCKACDKTVYLMDQLSADGIAYHKSCFKCNHCKGTLKLSNYSSLEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK TGS +KSF+   K+  +   +   + SK + +F+GT +KC  C KT YP+EKV 
Sbjct  63   EQLFKETGSFNKSFQSPAKSAEKSNPELTRSRSKAAGMFSGTLEKCATCGKTAYPLEKVT  122

Query  423  VDGTSYHRACF  455
            V+G +YH++CF
Sbjct  123  VEGQAYHKSCF  133


 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 37/87 (43%), Positives = 54/87 (62%), Gaps = 2/87 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  + + YHK+CFRC H    +  SNY + EG+LYCK HF
Sbjct  101  FSGTLEKCATCGKTAYPLEKVTVEGQAYHKSCFRCSHGGCPISPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD  323
             QLFK  GS +   + A  +++  AA 
Sbjct  161  SQLFKEKGSYNHLIKSA--SIKRTAAS  185



>gb|ACU17588.1| unknown [Glycine max]
Length=139

 Score =   175 bits (443),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKC+AC+KTVY VDQL AD   YHKACF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK TGS  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   YEQLFKETGSFKKNFQSPAKQAVKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133



>ref|XP_002960609.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
 gb|EFJ38148.1| hypothetical protein SELMODRAFT_229974 [Selaginella moellendorffii]
Length=180

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 100/131 (76%), Gaps = 7/131 (5%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            FA   QKCK+CEKTVYLVDQL AD  +YHKACFRC HCKGTLKLSNY S EGVLYCKPH 
Sbjct  3    FAVRQQKCKSCEKTVYLVDQLSADGVLYHKACFRCQHCKGTLKLSNYASLEGVLYCKPHL  62

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLF+ TGS DKSF+      +          SK+S LF+GTQ+KCV+C KTVYP+EKV+
Sbjct  63   EQLFRKTGSFDKSFDSGKVPSKP-------VVSKLSRLFSGTQEKCVSCSKTVYPLEKVS  115

Query  423  VDGTSYHRACF  455
            V+G SYH++CF
Sbjct  116  VEGQSYHKSCF  126


 Score = 72.8 bits (177),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 31/69 (45%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC +C KTVY ++++  + + YHK+CF+C H    +  SNY + EG+LYCK H+
Sbjct  94   FSGTQEKCVSCSKTVYPLEKVSVEGQSYHKSCFKCTHGGCVISPSNYAALEGMLYCKHHY  153

Query  243  DQLFKMTGS  269
             QLF   G+
Sbjct  154  SQLFMEKGN  162



>gb|EEE65408.1| hypothetical protein OsJ_20745 [Oryza sativa Japonica Group]
Length=268

 Score =   178 bits (452),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 104/134 (78%), Gaps = 1/134 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A + GTTQKC +C +TVY V++L AD +VYH+ CFRC HCK TL+ SNY+S EGVLYCKP
Sbjct  4    AAWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCFRCTHCKATLQFSNYSSVEGVLYCKP  63

Query  237  HFDQLFKMTGSLDKSFEGAPKTVR-ERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            H+DQ+ K TGSL+KSFEG  K+ + E++       ++ SS+F GTQDKCV C KTVYP+E
Sbjct  64   HYDQILKSTGSLEKSFEGTSKSAKAEKSNGNKGQPNRFSSMFVGTQDKCVVCNKTVYPLE  123

Query  414  KVAVDGTSYHRACF  455
            KV ++G+SYH++CF
Sbjct  124  KVNLNGSSYHKSCF  137


 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/80 (43%), Positives = 45/80 (56%), Gaps = 0/80 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY ++++  +   YHK+CFRC H   TL  SN  + EG LYCK 
Sbjct  103  SMFVGTQDKCVVCNKTVYPLEKVNLNGSSYHKSCFRCTHGGCTLSPSNNVTHEGKLYCKT  162

Query  237  HFDQLFKMTGSLDKSFEGAP  296
            H  QLF + G+     +  P
Sbjct  163  HHSQLFMVKGNFSNFEDSTP  182


 Score = 48.1 bits (113),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 18/37 (49%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  345  VSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
             ++ + GT  KC +C +TVYP+E++A DG  YHR CF
Sbjct  2    AAAAWGGTTQKCDSCGRTVYPVEELAADGRVYHRPCF  38



>ref|XP_011093154.1| PREDICTED: LIM domain-containing protein PLIM2c-like [Sesamum 
indicum]
Length=218

 Score =   177 bits (448),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 80/134 (60%), Positives = 106/134 (79%), Gaps = 2/134 (1%)
 Frame = +3

Query  54   MATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCK  233
            MA+F GT  KCKAC+KTVY VD L AD  ++H++CF+C HCKGTL +SNY+S +GVLYCK
Sbjct  1    MASFTGTLDKCKACDKTVYFVDLLSADGAIFHRSCFKCSHCKGTLVMSNYSSMDGVLYCK  60

Query  234  PHFDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIE  413
            PHF+QLFK +G+  K+F+   K+ RE +  +  T SK+S+LF+GTQDKC AC KTVYP+E
Sbjct  61   PHFEQLFKESGNFSKNFQTGAKSERENSLTR--TPSKLSALFSGTQDKCPACNKTVYPLE  118

Query  414  KVAVDGTSYHRACF  455
            KV ++G S+HR+CF
Sbjct  119  KVTMEGESFHRSCF  132


 Score = 70.9 bits (172),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 32/79 (41%), Positives = 49/79 (62%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            A F+GT  KC AC KTVY ++++  + + +H++CF+C H    L  S+Y + +G+LYCK 
Sbjct  98   ALFSGTQDKCPACNKTVYPLEKVTMEGESFHRSCFKCAHGGCPLTHSSYAALDGILYCKH  157

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLF   G+     + A
Sbjct  158  HFQQLFMEKGNYQHVLKAA  176



>gb|ABK58469.1| LIM domain protein WLIM2a [Populus tremula x Populus alba]
Length=189

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L AD   YHK+CF+CFHCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            FDQLFK TG+ +K+F+   KT  +   +   + SK + +F+GTQ+KC  C KT YP+EKV
Sbjct  62   FDQLFKETGNFNKNFQSPAKTAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 50/77 (65%), Gaps = 0/77 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  S+Y + EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSSYAALEGVLYCKHHF  160

Query  243  DQLFKMTGSLDKSFEGA  293
             QLFK  GS +   + A
Sbjct  161  SQLFKEKGSYNHLIKSA  177



>ref|XP_010093495.1| Pollen-specific protein SF3 [Morus notabilis]
 gb|EXB54148.1| Pollen-specific protein SF3 [Morus notabilis]
Length=192

 Score =   176 bits (445),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKAC+KTVY V+QL AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACDKTVYPVEQLSADGVSYHKSCFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TGS +K+F+   K+  +   +   + SK +S+F+GTQDKC  C KT YP+EKV
Sbjct  62   FEQLFKETGSFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESLTYHKSCF  133


 Score = 74.3 bits (181),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 38/93 (41%), Positives = 53/93 (57%), Gaps = 8/93 (9%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  ++  YHK+CF+C H    +  SNY + EGVLYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESLTYHKSCFKCSHGGCAITPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLD--------KSFEGAPKTVRE  311
            HF QLFK  G+ +        K    AP +V E
Sbjct  159  HFAQLFKEKGNYNHVLRSASSKRTAAAPPSVPE  191



>ref|XP_003544136.1| PREDICTED: pollen-specific protein SF3 isoform X1 [Glycine max]
 ref|XP_006595876.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Glycine max]
 ref|XP_006595877.1| PREDICTED: pollen-specific protein SF3 isoform X3 [Glycine max]
 gb|KHN20876.1| Pollen-specific protein SF3 [Glycine soja]
Length=189

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKC+AC+KTVY VDQL AD   YHKACF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCEACDKTVYPVDQLSADGTAYHKACFKCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK TGS  K+F+   K   +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   YEQLFKETGSFKKNFQSPAKQAVKTTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  122  TVEGQAYHKSCF  133


 Score = 78.2 bits (191),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EGVLYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQAYHKSCFKCSHGSCPITPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_004965094.1| PREDICTED: microtubule-associated protein futsch-like [Setaria 
italica]
Length=1441

 Score =   189 bits (479),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 81/135 (60%), Positives = 106/135 (79%), Gaps = 2/135 (1%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
              + GTTQKC +C +TVY V++L AD +VYH+ CFRC HCK TL+ SNY+S EGVLYCKP
Sbjct  3    GAWGGTTQKCASCGRTVYPVEELAADGRVYHRPCFRCNHCKSTLQFSNYSSVEGVLYCKP  62

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAAD--QGHTSSKVSSLFAGTQDKCVACKKTVYPI  410
            H+DQ+ K TGSLDKSFEGA ++ +   ++  +G   S+ SS+F GTQDKC+ C KTVYP+
Sbjct  63   HYDQILKSTGSLDKSFEGASRSAKPEKSNGHKGQQRSRFSSMFVGTQDKCIVCNKTVYPL  122

Query  411  EKVAVDGTSYHRACF  455
            EKVA+DG+SYH++CF
Sbjct  123  EKVALDGSSYHKSCF  137


 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 34/74 (46%), Positives = 45/74 (61%), Gaps = 0/74 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F GT  KC  C KTVY ++++  D   YHK+CFRC H   TL  SN+ + EG LYCK 
Sbjct  103  SMFVGTQDKCIVCNKTVYPLEKVALDGSSYHKSCFRCTHGGCTLSPSNHITHEGKLYCKT  162

Query  237  HFDQLFKMTGSLDK  278
            H  QLF + G+  +
Sbjct  163  HHSQLFMVKGNFSQ  176


 Score = 50.4 bits (119),  Expect = 2e-04, Method: Composition-based stats.
 Identities = 19/37 (51%), Positives = 26/37 (70%), Gaps = 0/37 (0%)
 Frame = +3

Query  345  VSSLFAGTQDKCVACKKTVYPIEKVAVDGTSYHRACF  455
            +S  + GT  KC +C +TVYP+E++A DG  YHR CF
Sbjct  1    MSGAWGGTTQKCASCGRTVYPVEELAADGRVYHRPCF  37



>ref|XP_008392904.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Malus 
domestica]
 ref|XP_009351067.1| PREDICTED: pollen-specific protein SF3 isoform X2 [Pyrus x bretschneideri]
Length=199

 Score =   175 bits (443),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V++L AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQDKC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>gb|KDP44835.1| hypothetical protein JCGZ_01335 [Jatropha curcas]
Length=189

 Score =   174 bits (442),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L AD   YHK+CF+CFHCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGISYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 36/79 (46%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H   +L  SNY + EGVLYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_009344420.1| PREDICTED: pollen-specific protein SF3-like [Pyrus x bretschneideri]
Length=199

 Score =   175 bits (443),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V++L AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQDKC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_008381875.1| PREDICTED: pollen-specific protein SF3-like [Malus domestica]
Length=199

 Score =   175 bits (443),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V++L AD   YHK+CF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGISYHKSCFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQDKC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 76.3 bits (186),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_007218461.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_007218462.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 ref|XP_008233707.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 ref|XP_008233708.1| PREDICTED: pollen-specific protein SF3 [Prunus mume]
 gb|EMJ19660.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
 gb|EMJ19661.1| hypothetical protein PRUPE_ppa011869mg [Prunus persica]
Length=192

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V++L AD   YHKACF+C HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVEELSADGVSYHKACFKCTHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>gb|ABK22125.1| unknown [Picea sitchensis]
Length=197

 Score =   174 bits (442),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/133 (61%), Positives = 101/133 (76%), Gaps = 2/133 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT QKCKAC+KTVY VDQL AD   YHK+CFRC HCKGTLKLSNY+S EGVLYCKPHF
Sbjct  3    FTGTQQKCKACDKTVYFVDQLSADGVSYHKSCFRCNHCKGTLKLSNYSSMEGVLYCKPHF  62

Query  243  DQLFKMTGSLDKSFEG--APKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            DQLF+ +G+ +K+F+   + K +   + +   + SKVS +F+GTQDKC  C KT YP+EK
Sbjct  63   DQLFRESGNFNKNFQSQRSSKVIDGLSPELTRSPSKVSMMFSGTQDKCATCGKTAYPLEK  122

Query  417  VAVDGTSYHRACF  455
            V V+  SYH++CF
Sbjct  123  VTVESLSYHKSCF  135


 Score = 75.5 bits (184),  Expect = 7e-14, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 57/98 (58%), Gaps = 3/98 (3%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT  KC  C KT Y ++++  ++  YHK+CF+C H   ++  SNY + EG+LYCK HF
Sbjct  103  FSGTQDKCATCGKTAYPLEKVTVESLSYHKSCFKCSHGGCSISPSNYAALEGILYCKHHF  162

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSL  356
             QLFK  GS +   + A     +RAA     +S V  +
Sbjct  163  SQLFKEKGSYNHLIKTA---TMKRAAAVPEVASAVPEI  197



>ref|XP_007009106.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 ref|XP_007009109.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17916.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
 gb|EOY17919.1| GATA type zinc finger transcription factor family protein isoform 
1 [Theobroma cacao]
Length=189

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY V+ L AD   YHK+CF+C HCKGTLKL NY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPVELLSADGVPYHKSCFKCSHCKGTLKLGNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+G SYH++CF
Sbjct  122  TVEGQSYHKSCF  133


 Score = 77.4 bits (189),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/89 (40%), Positives = 55/89 (62%), Gaps = 2/89 (2%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVEGQSYHKSCFKCSHGGCPISPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAAD  323
            HF QLFK  GS +   + A  +++  AA 
Sbjct  159  HFSQLFKEKGSYNHLIKSA--SIKRAAAS  185



>gb|AFK39062.1| unknown [Lotus japonicus]
 gb|AFK48743.1| unknown [Lotus japonicus]
Length=189

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 79/132 (60%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFLGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK TG+  K+F+   K   +   +   + SK + +F+GTQ+KC  C KT YP+EKV
Sbjct  62   YEQLFKETGTFKKNFQSPAKLADKNTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/87 (41%), Positives = 55/87 (63%), Gaps = 2/87 (2%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKHHF  160

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAAD  323
             QLFK  GS +   + A  +++  AA 
Sbjct  161  SQLFKEKGSYNHLIKSA--SIKRAAAS  185



>gb|ACX47456.1| LIM1 [Hevea brasiliensis]
Length=189

 Score =   174 bits (441),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L AD   YHK+CF+CFHCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 79.3 bits (194),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/73 (48%), Positives = 50/73 (68%), Gaps = 0/73 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H   +L  SNY + EGVLYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSLSPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLD  275
            HF QLFK  GS +
Sbjct  159  HFSQLFKEKGSYN  171



>ref|XP_002315180.1| LIM domain-containing family protein [Populus trichocarpa]
 ref|XP_011036022.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 ref|XP_011036023.1| PREDICTED: LIM domain-containing protein WLIM2b-like [Populus 
euphratica]
 gb|ABK96192.1| unknown [Populus trichocarpa]
 gb|EEF01351.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/132 (58%), Positives = 100/132 (76%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L AD   YHK CF+CFHCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVAYHKTCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLNPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 78.6 bits (192),  Expect = 6e-15, Method: Compositional matrix adjust.
 Identities = 38/89 (43%), Positives = 56/89 (63%), Gaps = 2/89 (2%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EGVLYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAAD  323
            HF QLFK  GS +   + A  T++  AA 
Sbjct  159  HFSQLFKEKGSYNHLIKSA--TMKRAAAS  185



>ref|XP_009421306.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 78/131 (60%), Positives = 104/131 (79%), Gaps = 1/131 (1%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F GT QKCKAC+KTVYL+DQL AD  V+HK+CF+C HCKGTL LS Y+S EGVLYCKPHF
Sbjct  5    FTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPHF  64

Query  243  DQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKVA  422
            +QLFK +G+ +K+F+ +P    E+A +   ++SK +S+F+GTQ+KC  C KT YP+EKV 
Sbjct  65   EQLFKESGNFNKNFQ-SPAKSAEKAPELTRSTSKAASMFSGTQEKCATCTKTAYPLEKVT  123

Query  423  VDGTSYHRACF  455
            V+G +YH++CF
Sbjct  124  VEGQAYHKSCF  134


 Score = 77.8 bits (190),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H   ++  SNY + EG+LYCK 
Sbjct  100  SMFSGTQEKCATCTKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            HF QLFK  GS +   + A  +++  AA
Sbjct  160  HFSQLFKEKGSYNHLIKSA--SIKRAAA  185



>ref|XP_004503222.1| PREDICTED: pollen-specific protein SF3-like isoform X1 [Cicer 
arietinum]
 ref|XP_004503223.1| PREDICTED: pollen-specific protein SF3-like isoform X2 [Cicer 
arietinum]
Length=189

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 80/132 (61%), Positives = 98/132 (74%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY VDQL AD   YHKACFRC HCKGTLKLS+Y+S EGVLYCKPH
Sbjct  2    SFIGTQQKCKACEKTVYPVDQLSADGTSYHKACFRCSHCKGTLKLSSYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            ++QLFK TG+  K+F    K   +   +   + SK +S+F+GTQDKC  C KT YP+EKV
Sbjct  62   YEQLFKETGTFKKNFTSPAKLADKTTPELTRSPSKAASMFSGTQDKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 76.6 bits (187),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 50/79 (63%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EG+LYCK 
Sbjct  99   SMFSGTQDKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCPITPSNYAALEGILYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_009404566.1| PREDICTED: pollen-specific protein SF3-like [Musa acuminata subsp. 
malaccensis]
Length=190

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/132 (59%), Positives = 103/132 (78%), Gaps = 1/132 (1%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
             F GT QKCKAC+KTVYL+DQL AD  V+HK+CF+C HCKGTL LS Y+S EGVLYCKPH
Sbjct  4    NFTGTQQKCKACDKTVYLMDQLTADGVVFHKSCFKCNHCKGTLTLSTYSSMEGVLYCKPH  63

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK +G+ +K+F+ +P    E+A +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  64   FEQLFKESGNFNKNFQ-SPAKSAEKAPELTRSPSKAASMFSGTQEKCATCAKTAYPLEKV  122

Query  420  AVDGTSYHRACF  455
             V+G +YH++CF
Sbjct  123  TVEGQAYHKSCF  134


 Score = 78.2 bits (191),  Expect = 7e-15, Method: Compositional matrix adjust.
 Identities = 36/88 (41%), Positives = 56/88 (64%), Gaps = 2/88 (2%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  + + YHK+CF+C H   ++  SNY + EG+LYCK 
Sbjct  100  SMFSGTQEKCATCAKTAYPLEKVTVEGQAYHKSCFKCSHGGCSITPSNYAALEGILYCKH  159

Query  237  HFDQLFKMTGSLDKSFEGAPKTVRERAA  320
            HF QLFK  GS +   + A  +++  AA
Sbjct  160  HFSQLFKEKGSYNHLIKSA--SIKRSAA  185



>ref|XP_002530411.1| Pollen-specific protein SF3, putative [Ricinus communis]
 gb|EEF31981.1| Pollen-specific protein SF3, putative [Ricinus communis]
Length=189

 Score =   173 bits (438),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 101/132 (77%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L AD   YHK+CF+CFHCKGTLKLSNY+S EGV+YCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSADGVPYHKSCFKCFHCKGTLKLSNYSSMEGVVYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            F+QLFK TG+ +K+F+   K+  +   +   + SK +S+F+GTQ+KC  C KT YP+EKV
Sbjct  62   FEQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAASMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 79.0 bits (193),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 35/79 (44%), Positives = 52/79 (66%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT +KC  C KT Y ++++  +++ YHK+CF+C H   ++  SNY + EGVLYCK 
Sbjct  99   SMFSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCSISPSNYAALEGVLYCKH  158

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  GS +   + A
Sbjct  159  HFSQLFKEKGSYNHLIKSA  177



>ref|XP_010255661.1| PREDICTED: LIM domain-containing protein PLIM2a-like [Nelumbo 
nucifera]
Length=199

 Score =   173 bits (438),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/133 (62%), Positives = 103/133 (77%), Gaps = 4/133 (3%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F+GT QKCKAC+KTVY+VD L AD   YHK+CF+C HCKGTL +SNY+S +GVLYCKPH
Sbjct  2    SFSGTLQKCKACDKTVYVVDLLSADGVAYHKSCFKCSHCKGTLVMSNYSSMDGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQ-GHTSSKVSSLFAGTQDKCVACKKTVYPIEK  416
            F+QLFK TGS  K+F+       E+  DQ     SK+SS+F+GTQDKC ACKKT YP+EK
Sbjct  62   FEQLFKETGSFSKNFQTGK---SEKQNDQLARAPSKLSSMFSGTQDKCAACKKTAYPLEK  118

Query  417  VAVDGTSYHRACF  455
            V ++G SYH++CF
Sbjct  119  VTLEGESYHKSCF  131


 Score = 73.6 bits (179),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 34/79 (43%), Positives = 51/79 (65%), Gaps = 0/79 (0%)
 Frame = +3

Query  57   ATFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKP  236
            + F+GT  KC AC+KT Y ++++  + + YHK+CF+C H    L  S Y + +G+LYCK 
Sbjct  97   SMFSGTQDKCAACKKTAYPLEKVTLEGESYHKSCFKCSHGGCPLTPSTYAALDGILYCKH  156

Query  237  HFDQLFKMTGSLDKSFEGA  293
            HF QLFK  G+ +   +GA
Sbjct  157  HFAQLFKEKGNYNHLAKGA  175



>ref|XP_002312139.1| LIM domain-containing family protein [Populus trichocarpa]
 gb|ABK94456.1| unknown [Populus trichocarpa]
 gb|EEE89506.1| LIM domain-containing family protein [Populus trichocarpa]
Length=189

 Score =   172 bits (436),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 99/132 (75%), Gaps = 0/132 (0%)
 Frame = +3

Query  60   TFAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPH  239
            +F GT QKCKACEKTVY ++ L  D   YHK+CF+CFHCKGTLKLSNY+S EGVLYCKPH
Sbjct  2    SFTGTQQKCKACEKTVYPMELLSTDGVAYHKSCFKCFHCKGTLKLSNYSSMEGVLYCKPH  61

Query  240  FDQLFKMTGSLDKSFEGAPKTVRERAADQGHTSSKVSSLFAGTQDKCVACKKTVYPIEKV  419
            FDQLFK TG+ +K+F+   K+  +   +   + SK + +F+GTQ+KC  C KT YP+EKV
Sbjct  62   FDQLFKETGNFNKNFQSPAKSAEKLTPELTRSPSKAAGMFSGTQEKCATCGKTAYPLEKV  121

Query  420  AVDGTSYHRACF  455
             V+  +YH++CF
Sbjct  122  TVESQAYHKSCF  133


 Score = 77.4 bits (189),  Expect = 2e-14, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 48/71 (68%), Gaps = 0/71 (0%)
 Frame = +3

Query  63   FAGTTQKCKACEKTVYLVDQLRADNKVYHKACFRCFHCKGTLKLSNYNSFEGVLYCKPHF  242
            F+GT +KC  C KT Y ++++  +++ YHK+CF+C H    +  SNY + EGVLYCK HF
Sbjct  101  FSGTQEKCATCGKTAYPLEKVTVESQAYHKSCFKCSHGGCAITPSNYAALEGVLYCKHHF  160

Query  243  DQLFKMTGSLD  275
             QLFK  GS +
Sbjct  161  SQLFKEKGSYN  171



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 550993649940