BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B07

Length=563
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009351524.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    196   1e-59   Pyrus x bretschneideri [bai li]
gb|AHW50668.1|  cadmium resistance protein 2                            194   1e-58   Nicotiana tabacum [American tobacco]
ref|XP_004236941.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      193   1e-58   Solanum lycopersicum
ref|XP_009605116.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    193   2e-58   Nicotiana tomentosiformis
ref|XP_007045235.1|  Plant cadmium resistance 2, putative               192   2e-58   
ref|XP_002311520.1|  hypothetical protein POPTR_0008s13220g             192   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_011023892.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    192   3e-58   Populus euphratica
ref|XP_009762819.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    192   5e-58   Nicotiana sylvestris
ref|XP_006355072.1|  PREDICTED: cell number regulator 2-like            191   6e-58   Solanum tuberosum [potatoes]
gb|KJB30778.1|  hypothetical protein B456_005G159200                    190   2e-57   Gossypium raimondii
gb|KJB30777.1|  hypothetical protein B456_005G159200                    190   3e-57   Gossypium raimondii
gb|AIU80195.1|  fw2.2-like 1 protein                                    189   8e-57   Pyrus betulifolia
emb|CDP00825.1|  unnamed protein product                                188   2e-56   Coffea canephora [robusta coffee]
gb|KDP38095.1|  hypothetical protein JCGZ_04738                         187   3e-56   Jatropha curcas
ref|XP_002315866.1|  hypothetical protein POPTR_0010s11910g             187   3e-56   
ref|XP_011021803.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    187   3e-56   Populus euphratica
gb|KJB12051.1|  hypothetical protein B456_002G174500                    187   4e-56   Gossypium raimondii
ref|XP_011070591.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    186   6e-56   Sesamum indicum [beniseed]
ref|XP_002284819.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      186   1e-55   Vitis vinifera
ref|XP_008360029.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    186   1e-55   
ref|XP_010095722.1|  hypothetical protein L484_002694                   186   1e-55   Morus notabilis
gb|EYU30102.1|  hypothetical protein MIMGU_mgv1a024272mg                183   4e-55   Erythranthe guttata [common monkey flower]
ref|XP_010271282.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    183   2e-54   Nelumbo nucifera [Indian lotus]
ref|XP_008221439.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    182   5e-54   Prunus mume [ume]
ref|XP_004297454.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    182   6e-54   Fragaria vesca subsp. vesca
ref|XP_007223430.1|  hypothetical protein PRUPE_ppa011430mg             180   4e-53   Prunus persica
ref|XP_009351523.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    174   2e-51   
ref|XP_004297458.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    175   3e-51   Fragaria vesca subsp. vesca
ref|XP_004297478.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    174   9e-51   Fragaria vesca subsp. vesca
ref|XP_004297456.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    172   3e-50   Fragaria vesca subsp. vesca
ref|XP_002527778.1|  conserved hypothetical protein                     167   8e-49   
ref|XP_011070721.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    167   2e-48   
ref|XP_011078094.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    165   1e-47   Sesamum indicum [beniseed]
gb|KDO37146.1|  hypothetical protein CISIN_1g031629mg                   164   2e-47   Citrus sinensis [apfelsine]
gb|EYU17884.1|  hypothetical protein MIMGU_mgv1a023749mg                165   2e-47   Erythranthe guttata [common monkey flower]
gb|KDP38094.1|  hypothetical protein JCGZ_04737                         164   3e-47   Jatropha curcas
ref|XP_006469218.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    163   3e-47   Citrus sinensis [apfelsine]
ref|XP_010266998.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    163   4e-47   Nelumbo nucifera [Indian lotus]
gb|KFK30972.1|  hypothetical protein AALP_AA6G051700                    162   8e-47   Arabis alpina [alpine rockcress]
ref|XP_006448204.1|  hypothetical protein CICLE_v10017041mg             162   8e-47   Citrus clementina [clementine]
emb|CDP00822.1|  unnamed protein product                                162   1e-46   Coffea canephora [robusta coffee]
emb|CDP00823.1|  unnamed protein product                                162   2e-46   Coffea canephora [robusta coffee]
ref|XP_009117865.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      161   2e-46   Brassica rapa
emb|CDY33732.1|  BnaA09g45380D                                          160   3e-46   Brassica napus [oilseed rape]
emb|CDX81680.1|  BnaC08g39210D                                          160   4e-46   
ref|XP_007045231.1|  Plant cadmium resistance 2                         159   1e-45   Theobroma cacao [chocolate]
emb|CDY33731.1|  BnaA09g45370D                                          158   2e-45   Brassica napus [oilseed rape]
ref|XP_009117864.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    158   2e-45   Brassica rapa
ref|XP_003631187.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      160   3e-45   Vitis vinifera
ref|XP_010909567.1|  PREDICTED: cell number regulator 2-like            159   3e-45   Elaeis guineensis
emb|CDY71864.1|  BnaAnng39070D                                          157   3e-45   Brassica napus [oilseed rape]
gb|KJB12060.1|  hypothetical protein B456_002G175300                    157   3e-45   Gossypium raimondii
ref|XP_009615155.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    158   4e-45   Nicotiana tomentosiformis
ref|XP_006416962.1|  hypothetical protein EUTSA_v10009008mg             157   5e-45   Eutrema salsugineum [saltwater cress]
ref|XP_010535733.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    157   6e-45   Tarenaya hassleriana [spider flower]
ref|XP_008780573.1|  PREDICTED: cell number regulator 2-like            157   9e-45   
ref|XP_004503375.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    159   1e-44   Cicer arietinum [garbanzo]
ref|XP_009793964.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    157   1e-44   Nicotiana sylvestris
ref|NP_172940.1|  cadmium resistance protein 2                          156   2e-44   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009117863.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    155   2e-44   Brassica rapa
ref|XP_006354110.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    156   3e-44   Solanum tuberosum [potatoes]
ref|XP_006826804.1|  hypothetical protein AMTR_s00010p00034340          157   3e-44   
ref|XP_003611770.1|  hypothetical protein MTR_5g017650                  157   3e-44   Medicago truncatula
ref|XP_002284811.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      155   4e-44   Vitis vinifera
gb|AFK33509.1|  unknown                                                 156   5e-44   Medicago truncatula
ref|XP_002529141.1|  conserved hypothetical protein                     156   5e-44   
ref|XP_002892834.1|  predicted protein                                  154   6e-44   Arabidopsis lyrata subsp. lyrata
ref|XP_011015518.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    156   6e-44   Populus euphratica
ref|XP_002315950.2|  hypothetical protein POPTR_0010s13780g             156   6e-44   Populus trichocarpa [western balsam poplar]
ref|XP_004503374.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    155   7e-44   Cicer arietinum [garbanzo]
ref|XP_010916802.1|  PREDICTED: cell number regulator 2-like            155   7e-44   
ref|XP_010090019.1|  hypothetical protein L484_027249                   154   8e-44   
ref|XP_009148875.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    154   9e-44   Brassica rapa
ref|XP_004228721.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    154   9e-44   Solanum lycopersicum
emb|CBI26855.3|  unnamed protein product                                156   9e-44   Vitis vinifera
gb|KFK40702.1|  hypothetical protein AALP_AA2G030200                    154   1e-43   Arabis alpina [alpine rockcress]
ref|XP_010266790.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    155   1e-43   Nelumbo nucifera [Indian lotus]
ref|NP_001236652.1|  uncharacterized protein LOC100306298               155   1e-43   Glycine max [soybeans]
ref|XP_006448197.1|  hypothetical protein CICLE_v10016920mg             153   1e-43   
ref|XP_010090017.1|  hypothetical protein L484_027247                   153   1e-43   
gb|AEZ52398.1|  hypothetical protein                                    154   2e-43   Wolffia australiana
ref|XP_010932615.1|  PREDICTED: cell number regulator 2-like            154   2e-43   
emb|CAN63010.1|  hypothetical protein VITISV_005303                     156   2e-43   Vitis vinifera
emb|CDX81681.1|  BnaC08g39200D                                          153   3e-43   
ref|XP_002527777.1|  conserved hypothetical protein                     154   3e-43   Ricinus communis
ref|XP_006448196.1|  hypothetical protein CICLE_v10016920mg             153   3e-43   Citrus clementina [clementine]
ref|XP_003524373.1|  PREDICTED: cell number regulator 2-like            153   4e-43   Glycine max [soybeans]
ref|XP_007160405.1|  hypothetical protein PHAVU_002G319100g             153   4e-43   Phaseolus vulgaris [French bean]
ref|XP_006448200.1|  hypothetical protein CICLE_v10016918mg             153   5e-43   Citrus clementina [clementine]
gb|KDO38128.1|  hypothetical protein CISIN_1g031916mg                   152   6e-43   Citrus sinensis [apfelsine]
emb|CBI26856.3|  unnamed protein product                                152   6e-43   Vitis vinifera
gb|AFK36376.1|  unknown                                                 153   7e-43   Lotus japonicus
ref|XP_004298512.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    153   7e-43   Fragaria vesca subsp. vesca
ref|XP_009764643.1|  PREDICTED: cell number regulator 2-like            152   8e-43   Nicotiana sylvestris
ref|XP_009594388.1|  PREDICTED: cell number regulator 2-like            152   8e-43   Nicotiana tomentosiformis
ref|XP_006469221.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    152   1e-42   Citrus sinensis [apfelsine]
ref|XP_002281081.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    152   1e-42   Vitis vinifera
gb|AFK38344.1|  unknown                                                 151   2e-42   Medicago truncatula
ref|XP_010066585.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    152   2e-42   Eucalyptus grandis [rose gum]
ref|XP_010102839.1|  hypothetical protein L484_007862                   153   2e-42   
ref|XP_003630909.1|  Fruit weight 2.2-like protein                      152   2e-42   Medicago truncatula
ref|XP_006469220.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    151   2e-42   Citrus sinensis [apfelsine]
gb|KHG21402.1|  plant cadmium resistance 2 -like protein                152   3e-42   Gossypium arboreum [tree cotton]
ref|XP_010476562.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      150   4e-42   Camelina sativa [gold-of-pleasure]
emb|CBI26857.3|  unnamed protein product                                150   4e-42   Vitis vinifera
ref|XP_010271281.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    151   4e-42   Nelumbo nucifera [Indian lotus]
ref|XP_009387442.1|  PREDICTED: cell number regulator 2-like            150   5e-42   Musa acuminata subsp. malaccensis [pisang utan]
gb|KJB12053.1|  hypothetical protein B456_002G174700                    150   5e-42   Gossypium raimondii
ref|XP_010496599.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    149   5e-42   Camelina sativa [gold-of-pleasure]
ref|XP_006291991.1|  hypothetical protein CARUB_v10018179mg             149   7e-42   Capsella rubella
ref|XP_002311519.2|  hypothetical protein POPTR_0008s13210g             150   7e-42   
gb|AEA08581.1|  fw2.2                                                   150   8e-42   Arachis stenosperma
ref|XP_006304281.1|  hypothetical protein CARUB_v10010549mg             149   9e-42   Capsella rubella
ref|XP_002281061.2|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      150   9e-42   Vitis vinifera
emb|CAN82486.1|  hypothetical protein VITISV_006802                     150   9e-42   Vitis vinifera
ref|XP_007160406.1|  hypothetical protein PHAVU_002G319200g             149   1e-41   Phaseolus vulgaris [French bean]
ref|XP_004955027.1|  PREDICTED: cell number regulator 2-like            148   3e-41   Setaria italica
gb|ABK95453.1|  unknown                                                 149   3e-41   Populus trichocarpa [western balsam poplar]
ref|XP_008788458.1|  PREDICTED: cell number regulator 2-like            149   3e-41   Phoenix dactylifera
ref|XP_002868424.1|  hypothetical protein ARALYDRAFT_493614             147   4e-41   
ref|XP_011038596.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    149   4e-41   Populus euphratica
gb|KDP42302.1|  hypothetical protein JCGZ_01626                         148   5e-41   Jatropha curcas
ref|XP_010496606.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    147   5e-41   Camelina sativa [gold-of-pleasure]
ref|XP_011023881.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    148   5e-41   Populus euphratica
emb|CAN82483.1|  hypothetical protein VITISV_006799                     159   6e-41   Vitis vinifera
ref|NP_001173699.1|  Os03g0830401                                       146   7e-41   
gb|KDP38093.1|  hypothetical protein JCGZ_04736                         147   1e-40   Jatropha curcas
ref|NP_001235158.1|  uncharacterized protein LOC100527373               147   1e-40   
gb|KJB12057.1|  hypothetical protein B456_002G175100                    145   2e-40   Gossypium raimondii
ref|XP_003630911.1|  hypothetical protein MTR_8g104890                  146   2e-40   Medicago truncatula
emb|CBI26858.3|  unnamed protein product                                146   2e-40   Vitis vinifera
ref|XP_004232037.1|  PREDICTED: cell number regulator 2                 145   2e-40   
gb|AAF74287.1|AF261775_1  ORFX                                          145   2e-40   Solanum pennellii
gb|AAO12190.1|  fw2.2                                                   145   2e-40   Solanum pimpinellifolium [currant tomato]
gb|AAO12196.1|  fw2.2                                                   145   2e-40   Solanum pennellii
ref|XP_010476563.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    145   2e-40   Camelina sativa [gold-of-pleasure]
ref|XP_003631175.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    145   2e-40   Vitis vinifera
ref|XP_009757579.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    146   3e-40   Nicotiana sylvestris
ref|XP_010266903.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    146   4e-40   Nelumbo nucifera [Indian lotus]
ref|NP_680337.2|  PLAC8 family protein                                  144   6e-40   Arabidopsis thaliana [mouse-ear cress]
dbj|BAK01385.1|  predicted protein                                      145   6e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006648784.1|  PREDICTED: cell number regulator 2-like            145   7e-40   Oryza brachyantha
dbj|BAK04959.1|  predicted protein                                      147   7e-40   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010044215.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    145   9e-40   Eucalyptus grandis [rose gum]
ref|XP_006378442.1|  hypothetical protein POPTR_0010s11930g             145   1e-39   Populus trichocarpa [western balsam poplar]
ref|XP_010066591.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    145   1e-39   Eucalyptus grandis [rose gum]
ref|XP_009410079.1|  PREDICTED: cell number regulator 2-like            144   1e-39   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMT03501.1|  hypothetical protein F775_20686                         143   1e-39   
ref|XP_008236516.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    144   1e-39   Prunus mume [ume]
gb|KDP29383.1|  hypothetical protein JCGZ_18304                         144   2e-39   Jatropha curcas
ref|XP_008447011.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    143   2e-39   
gb|AAO12189.1|  fw2.2                                                   143   2e-39   Solanum cheesmaniae
ref|XP_007226769.1|  hypothetical protein PRUPE_ppa018556mg             144   2e-39   
ref|XP_008243409.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 11     144   2e-39   Prunus mume [ume]
ref|XP_004170989.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    142   3e-39   
ref|XP_007160407.1|  hypothetical protein PHAVU_002G319200g             142   3e-39   Phaseolus vulgaris [French bean]
ref|XP_010269371.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    143   4e-39   Nelumbo nucifera [Indian lotus]
ref|XP_003581316.1|  PREDICTED: cell number regulator 2-like isof...    142   4e-39   Brachypodium distachyon [annual false brome]
gb|EAY92435.1|  hypothetical protein OsI_14168                          142   5e-39   Oryza sativa Indica Group [Indian rice]
ref|NP_001047231.1|  Os02g0579800                                       142   6e-39   
ref|XP_007201687.1|  hypothetical protein PRUPE_ppa023567mg             142   8e-39   Prunus persica
ref|XP_010107951.1|  hypothetical protein L484_027541                   144   8e-39   
ref|XP_010066589.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    142   9e-39   Eucalyptus grandis [rose gum]
ref|XP_008780719.1|  PREDICTED: cell number regulator 2-like            140   1e-38   
gb|EMT00654.1|  hypothetical protein F775_27031                         140   1e-38   
emb|CAN61647.1|  hypothetical protein VITISV_009005                     148   1e-38   Vitis vinifera
ref|XP_009419125.1|  PREDICTED: cell number regulator 10-like           141   2e-38   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028478.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    141   2e-38   Eucalyptus grandis [rose gum]
ref|XP_002518775.1|  conserved hypothetical protein                     141   3e-38   Ricinus communis
ref|XP_010066569.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      140   4e-38   Eucalyptus grandis [rose gum]
gb|KCW64493.1|  hypothetical protein EUGRSUZ_G02100                     141   6e-38   Eucalyptus grandis [rose gum]
ref|XP_010068707.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    139   7e-38   
ref|XP_011010193.1|  PREDICTED: cell number regulator 1-like            139   7e-38   Populus euphratica
ref|XP_010666623.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    139   9e-38   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_004297457.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    138   9e-38   Fragaria vesca subsp. vesca
ref|XP_006378441.1|  hypothetical protein POPTR_0010s11920g             140   1e-37   
ref|XP_010666627.1|  PREDICTED: cell number regulator 1-like            138   1e-37   
ref|XP_009358701.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    139   1e-37   Pyrus x bretschneideri [bai li]
ref|XP_004294816.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    139   1e-37   Fragaria vesca subsp. vesca
ref|XP_010692733.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    138   2e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB12064.1|  hypothetical protein B456_002G175600                    138   2e-37   Gossypium raimondii
emb|CBI32422.3|  unnamed protein product                                140   2e-37   Vitis vinifera
gb|EYU40872.1|  hypothetical protein MIMGU_mgv1a023101mg                138   2e-37   Erythranthe guttata [common monkey flower]
ref|XP_010527793.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      138   2e-37   Tarenaya hassleriana [spider flower]
ref|XP_010932525.1|  PREDICTED: cell number regulator 10-like iso...    138   3e-37   Elaeis guineensis
emb|CDP00820.1|  unnamed protein product                                138   3e-37   Coffea canephora [robusta coffee]
ref|XP_002282121.1|  PREDICTED: cell number regulator 1                 138   3e-37   Vitis vinifera
ref|XP_010066590.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    137   3e-37   Eucalyptus grandis [rose gum]
ref|XP_010070341.1|  PREDICTED: cell number regulator 2-like            138   4e-37   Eucalyptus grandis [rose gum]
gb|KDP31920.1|  hypothetical protein JCGZ_12381                         137   4e-37   Jatropha curcas
gb|KCW64542.1|  hypothetical protein EUGRSUZ_G02148                     137   4e-37   Eucalyptus grandis [rose gum]
gb|AAD02554.1|  PGPS/D12                                                137   4e-37   Petunia x hybrida [garden petunia]
ref|XP_010068703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    136   5e-37   Eucalyptus grandis [rose gum]
gb|KCW64547.1|  hypothetical protein EUGRSUZ_G02154                     136   5e-37   Eucalyptus grandis [rose gum]
ref|XP_007156520.1|  hypothetical protein PHAVU_003G292900g             137   6e-37   Phaseolus vulgaris [French bean]
ref|XP_010265360.1|  PREDICTED: cell number regulator 2-like            137   6e-37   Nelumbo nucifera [Indian lotus]
ref|XP_002282134.1|  PREDICTED: cell number regulator 1 isoform X1      137   6e-37   Vitis vinifera
ref|XP_002523567.1|  conserved hypothetical protein                     136   9e-37   
emb|CBI32421.3|  unnamed protein product                                138   1e-36   Vitis vinifera
gb|AFM43804.1|  fruit weight 2.2-1 protein                              137   1e-36   Dimocarpus longan [longan]
ref|XP_002447969.1|  hypothetical protein SORBIDRAFT_06g019050          136   1e-36   Sorghum bicolor [broomcorn]
emb|CAN70200.1|  hypothetical protein VITISV_021221                     138   1e-36   Vitis vinifera
ref|NP_001238282.1|  uncharacterized protein LOC100527585               136   2e-36   Glycine max [soybeans]
ref|XP_008795343.1|  PREDICTED: cell number regulator 2-like isof...    135   2e-36   
ref|XP_004294815.1|  PREDICTED: cell number regulator 2-like            136   2e-36   Fragaria vesca subsp. vesca
ref|XP_008795345.1|  PREDICTED: cell number regulator 10-like iso...    134   3e-36   
ref|NP_172941.1|  cadmium resistance protein 1                          134   3e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010247538.1|  PREDICTED: uncharacterized protein LOC104590526    139   3e-36   
ref|XP_002463578.1|  hypothetical protein SORBIDRAFT_01g002370          134   4e-36   
ref|XP_009403093.1|  PREDICTED: cell number regulator 1-like            135   4e-36   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN31068.1|  Cell number regulator 1                                 135   4e-36   Glycine soja [wild soybean]
ref|XP_003529392.1|  PREDICTED: cell number regulator 1-like            135   4e-36   
ref|XP_007047233.1|  Plant cadmium resistance 2                         136   5e-36   
ref|XP_008795342.1|  PREDICTED: cell number regulator 10-like iso...    136   5e-36   
ref|XP_004964285.1|  PREDICTED: cell number regulator 7-like            135   5e-36   Setaria italica
ref|XP_008389981.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    134   6e-36   
ref|XP_007045339.1|  Uncharacterized protein TCM_011102                 143   6e-36   
ref|XP_007045233.1|  Plant cadmium resistance 2, putative isoform 1     135   6e-36   
ref|XP_008789254.1|  PREDICTED: cell number regulator 10-like           134   7e-36   Phoenix dactylifera
ref|XP_002310729.2|  hypothetical protein POPTR_0007s11140g             134   7e-36   
ref|XP_002282112.1|  PREDICTED: cell number regulator 1                 134   7e-36   
ref|XP_010932616.1|  PREDICTED: cell number regulator 2                 133   1e-35   
emb|CDP00593.1|  unnamed protein product                                136   1e-35   Coffea canephora [robusta coffee]
emb|CBI32423.3|  unnamed protein product                                135   1e-35   Vitis vinifera
ref|XP_006388087.1|  hypothetical protein POPTR_0347s00200g             133   1e-35   
ref|XP_002281039.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 2      133   2e-35   Vitis vinifera
ref|XP_010939439.1|  PREDICTED: cell number regulator 1-like            134   2e-35   Elaeis guineensis
emb|CAN70201.1|  hypothetical protein VITISV_021222                     138   2e-35   Vitis vinifera
ref|XP_004505208.1|  PREDICTED: cell number regulator 1-like            134   2e-35   Cicer arietinum [garbanzo]
ref|XP_010265198.1|  PREDICTED: cell number regulator 2-like            132   3e-35   Nelumbo nucifera [Indian lotus]
ref|XP_004142270.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    132   3e-35   Cucumis sativus [cucumbers]
ref|XP_006406603.1|  hypothetical protein EUTSA_v10021908mg             132   3e-35   Eutrema salsugineum [saltwater cress]
gb|KJB12052.1|  hypothetical protein B456_002G174600                    133   3e-35   Gossypium raimondii
gb|AES90190.2|  fruit weight 2.2 protein                                133   3e-35   Medicago truncatula
ref|XP_003607993.1|  Placenta-specific gene 8 protein                   133   3e-35   
ref|XP_010527540.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 11     132   3e-35   Tarenaya hassleriana [spider flower]
ref|XP_008373159.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    133   3e-35   Malus domestica [apple tree]
ref|NP_001051784.1|  Os03g0830200                                       132   4e-35   
ref|XP_006406602.1|  hypothetical protein EUTSA_v10022218mg             130   4e-35   
ref|NP_001052997.1|  Os04g0461600                                       132   4e-35   
ref|XP_003524372.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    133   5e-35   Glycine max [soybeans]
sp|D9HP26.1|CNR10_MAIZE  RecName: Full=Cell number regulator 10; ...    131   6e-35   Zea mays [maize]
ref|NP_001151128.1|  cell number regulator 10                           131   6e-35   
ref|XP_007042410.1|  Plant cadmium resistance 2, putative               132   8e-35   
gb|AES90189.2|  fruit weight 2.2 protein                                130   1e-34   Medicago truncatula
ref|NP_001051787.1|  Os03g0830500                                       130   2e-34   
ref|XP_008464696.1|  PREDICTED: cell number regulator 2-like            130   2e-34   Cucumis melo [Oriental melon]
gb|KJB77671.1|  hypothetical protein B456_012G150200                    131   2e-34   Gossypium raimondii
ref|XP_010229876.1|  PREDICTED: cell number regulator 11-like           130   2e-34   
gb|AFW67070.1|  PGPS/D12                                                132   2e-34   
gb|EAY92439.1|  hypothetical protein OsI_14172                          130   2e-34   Oryza sativa Indica Group [Indian rice]
gb|KJB77672.1|  hypothetical protein B456_012G150200                    131   3e-34   Gossypium raimondii
ref|XP_010663577.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6      134   3e-34   Vitis vinifera
gb|EEC73477.1|  hypothetical protein OsI_07803                          129   4e-34   Oryza sativa Indica Group [Indian rice]
gb|EMT19237.1|  hypothetical protein F775_11263                         132   4e-34   
ref|XP_006437706.1|  hypothetical protein CICLE_v10033938mg             130   6e-34   Citrus clementina [clementine]
ref|XP_011097029.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6      132   7e-34   Sesamum indicum [beniseed]
ref|XP_006484577.1|  PREDICTED: cell number regulator 2-like            129   7e-34   
gb|KDO70031.1|  hypothetical protein CISIN_1g042250mg                   129   7e-34   Citrus sinensis [apfelsine]
ref|NP_001047232.2|  Os02g0580000                                       128   8e-34   
gb|AFM43805.1|  fruit weight 2.2-2 protein                              129   8e-34   Dimocarpus longan [longan]
ref|XP_006651983.1|  PREDICTED: cell number regulator 10-like           128   8e-34   Oryza brachyantha
dbj|BAD29574.1|  putative ORFX                                          128   8e-34   Oryza sativa Japonica Group [Japonica rice]
gb|AFK33553.1|  unknown                                                 128   9e-34   Lotus japonicus
ref|XP_010932737.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    128   1e-33   Elaeis guineensis
ref|XP_009410078.1|  PREDICTED: cell number regulator 2-like            129   1e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011016153.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    128   2e-33   Populus euphratica
ref|XP_010692711.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    127   2e-33   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008779940.1|  PREDICTED: cell number regulator 10-like           127   2e-33   
ref|XP_003607992.1|  hypothetical protein MTR_4g086320                  131   3e-33   
ref|XP_009117862.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    127   3e-33   Brassica rapa
gb|KFK41278.1|  hypothetical protein AALP_AA2G109400                    127   3e-33   Arabis alpina [alpine rockcress]
ref|XP_010271278.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    128   4e-33   Nelumbo nucifera [Indian lotus]
emb|CDX81682.1|  BnaC08g39190D                                          126   5e-33   
ref|XP_010068760.1|  PREDICTED: cell number regulator 2                 128   5e-33   
ref|XP_008452392.1|  PREDICTED: cell number regulator 2-like            126   5e-33   Cucumis melo [Oriental melon]
ref|XP_008644181.1|  PREDICTED: cell number regulator 11 isoform X1     126   6e-33   Zea mays [maize]
ref|XP_010042703.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    126   7e-33   
ref|XP_011078432.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    126   8e-33   
ref|XP_003575228.1|  PREDICTED: cell number regulator 2-like            127   9e-33   
dbj|BAD53511.1|  putative fw2.2                                         125   1e-32   
ref|XP_006406600.1|  hypothetical protein EUTSA_v10022103mg             125   1e-32   
ref|XP_010911252.1|  PREDICTED: cell number regulator 2-like            125   1e-32   
gb|AIL52311.1|  cadmium resistance protein                              124   1e-32   
emb|CDO98447.1|  unnamed protein product                                131   1e-32   
ref|XP_002318695.2|  hypothetical protein POPTR_0012s09370g             126   1e-32   
gb|KJB79311.1|  hypothetical protein B456_013G043200                    125   1e-32   
ref|XP_009145891.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 7      124   2e-32   
gb|KJB37241.1|  hypothetical protein B456_006G195300                    127   3e-32   
ref|XP_009410080.1|  PREDICTED: cell number regulator 10-like           125   3e-32   
ref|XP_010666910.1|  PREDICTED: cell number regulator 9-like            127   4e-32   
emb|CDX92238.1|  BnaA05g21690D                                          123   5e-32   
ref|XP_006826803.1|  hypothetical protein AMTR_s00010p00033430          124   7e-32   
gb|EEC73476.1|  hypothetical protein OsI_07802                          123   8e-32   
ref|XP_004301064.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    128   9e-32   
gb|KCW83841.1|  hypothetical protein EUGRSUZ_B00709                     122   1e-31   
gb|KJB12061.1|  hypothetical protein B456_002G175400                    124   1e-31   
ref|XP_002463577.1|  hypothetical protein SORBIDRAFT_01g002360          123   1e-31   
ref|XP_010265197.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    127   1e-31   
dbj|BAE92288.1|  putative ORFX                                          124   2e-31   
ref|XP_006647956.1|  PREDICTED: cell number regulator 1-like            123   2e-31   
ref|XP_010031861.1|  PREDICTED: cell number regulator 10-like           122   2e-31   
ref|XP_009621690.1|  PREDICTED: cell number regulator 2-like            123   2e-31   
ref|XP_010066594.1|  PREDICTED: cell number regulator 2-like            122   2e-31   
ref|XP_006339946.1|  PREDICTED: cell number regulator 1-like            123   2e-31   
emb|CDM84255.1|  unnamed protein product                                121   3e-31   
ref|XP_010462710.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    122   3e-31   
emb|CDY71552.1|  BnaCnng73400D                                          123   3e-31   
ref|XP_008360030.1|  PREDICTED: cell number regulator 10-like           121   3e-31   
ref|XP_003518067.1|  PREDICTED: cell number regulator 1-like            122   3e-31   
ref|XP_004954015.1|  PREDICTED: cell number regulator 1-like isof...    122   4e-31   
emb|CDY48592.1|  BnaCnng16510D                                          122   4e-31   
ref|XP_004954014.1|  PREDICTED: cell number regulator 1-like isof...    122   5e-31   
ref|XP_002891473.1|  hypothetical protein ARALYDRAFT_337030             123   5e-31   
ref|XP_009147919.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6      123   6e-31   
ref|XP_010513665.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 11     120   7e-31   
ref|XP_010265196.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    124   8e-31   
ref|NP_001182142.1|  cell number regulator 11                           120   9e-31   
gb|EMS54885.1|  hypothetical protein TRIUR3_05363                       120   9e-31   
ref|XP_010675482.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    121   9e-31   
ref|XP_002454063.1|  hypothetical protein SORBIDRAFT_04g024020          121   9e-31   
ref|XP_007045227.1|  Plant cadmium resistance 2                         122   9e-31   
ref|XP_010470814.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    120   1e-30   
ref|XP_010269384.1|  PREDICTED: cell number regulator 1-like            120   1e-30   
ref|XP_006582840.1|  PREDICTED: uncharacterized protein LOC100306...    120   1e-30   
ref|XP_006391118.1|  hypothetical protein EUTSA_v10019246mg             120   1e-30   
ref|NP_177028.1|  cadmium resistance protein 11                         120   1e-30   
ref|XP_010511870.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    120   1e-30   
ref|XP_006341625.1|  PREDICTED: E3 ubiquitin-protein ligase Hakai...    125   1e-30   
ref|XP_008346788.1|  PREDICTED: proline-rich protein HaeIII subfa...    125   1e-30   
ref|XP_011009998.1|  PREDICTED: activating signal cointegrator 1 ...    125   1e-30   
ref|XP_007036476.1|  PLAC8 family protein                               125   2e-30   
ref|XP_007036480.1|  PLAC8 family protein                               125   2e-30   
ref|XP_002885259.1|  hypothetical protein ARALYDRAFT_479349             119   2e-30   
ref|XP_010692741.1|  PREDICTED: cell number regulator 10-like           120   2e-30   
ref|XP_011009997.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    125   2e-30   
ref|XP_010459003.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    120   2e-30   
ref|XP_004236417.1|  PREDICTED: pollen-specific leucine-rich repe...    125   2e-30   
ref|XP_009105411.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 11     120   2e-30   
ref|XP_009348105.1|  PREDICTED: proline-rich protein HaeIII subfa...    124   3e-30   
ref|NP_001048208.1|  Os02g0763000                                       120   3e-30   
ref|XP_002887193.1|  hypothetical protein ARALYDRAFT_894633             119   3e-30   
ref|XP_006393318.1|  hypothetical protein EUTSA_v10011755mg             121   3e-30   
ref|XP_007160402.1|  hypothetical protein PHAVU_002G318900g             119   3e-30   
emb|CDY62854.1|  BnaA06g03310D                                          120   3e-30   
ref|XP_003570575.1|  PREDICTED: cell number regulator 1-like            119   4e-30   
ref|XP_004965193.1|  PREDICTED: cell number regulator 11-like           118   6e-30   
ref|XP_006650838.1|  PREDICTED: cell number regulator 10-like           118   6e-30   
ref|XP_009146119.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    119   7e-30   
dbj|BAJ91768.1|  predicted protein                                      118   8e-30   
ref|XP_008797261.1|  PREDICTED: cell number regulator 1-like            119   8e-30   
ref|XP_007045225.1|  Plant cadmium resistance 2                         117   9e-30   
ref|XP_004981170.1|  PREDICTED: cell number regulator 10-like           118   1e-29   
gb|ACF85498.1|  unknown                                                 119   1e-29   
emb|CAN75309.1|  hypothetical protein VITISV_033323                     121   1e-29   
ref|XP_010045639.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    122   1e-29   
gb|KCW83842.1|  hypothetical protein EUGRSUZ_B00710                     122   1e-29   
ref|NP_001151323.1|  cell number regulator 1                            118   1e-29   
ref|XP_002452873.1|  hypothetical protein SORBIDRAFT_04g034060          118   2e-29   
ref|XP_004952894.1|  PREDICTED: cell number regulator 2-like            118   2e-29   
ref|XP_008244010.1|  PREDICTED: leucine-rich repeat extensin-like...    122   2e-29   
dbj|BAK07354.1|  predicted protein                                      118   2e-29   
ref|XP_006301542.1|  hypothetical protein CARUB_v10021976mg             117   2e-29   
ref|XP_002279956.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 4      121   2e-29   
gb|KJB12063.1|  hypothetical protein B456_002G175600                    116   2e-29   
ref|XP_009339371.1|  PREDICTED: proline-rich proteoglycan 2-like        122   3e-29   
ref|XP_006448195.1|  hypothetical protein CICLE_v10016864mg             117   3e-29   
ref|XP_007036477.1|  PLAC8 family protein                               119   3e-29   
gb|KJB39330.1|  hypothetical protein B456_007G006900                    121   3e-29   
ref|XP_007046275.1|  Plant cadmium resistance 11, putative              118   3e-29   
ref|XP_004986181.1|  PREDICTED: cell number regulator 7-like            116   3e-29   
gb|EMS50828.1|  hypothetical protein TRIUR3_04649                       117   3e-29   
emb|CDX92237.1|  BnaA05g21700D                                          117   3e-29   
ref|XP_008346854.1|  PREDICTED: uncharacterized protein LOC103409845    121   4e-29   
ref|XP_002463576.1|  hypothetical protein SORBIDRAFT_01g002350          116   4e-29   
ref|NP_001238213.1|  uncharacterized protein LOC100306397               116   4e-29   
gb|KFK36044.1|  hypothetical protein AALP_AA4G070600                    117   4e-29   
ref|XP_010551155.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 6      117   5e-29   
ref|XP_006485849.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    120   5e-29   
emb|CDY70500.1|  BnaCnng68650D                                          116   5e-29   
ref|XP_009612122.1|  PREDICTED: cell number regulator 7-like            115   6e-29   
ref|XP_009339439.1|  PREDICTED: uncharacterized protein LOC103931645    124   6e-29   
ref|XP_006304539.1|  hypothetical protein CARUB_v10011498mg             117   7e-29   
gb|AHW50665.1|  cadmium resistance protein 12                           115   7e-29   
ref|NP_175332.1|  PLAC8 family protein                                  117   8e-29   
ref|XP_009766449.1|  PREDICTED: cell number regulator 7-like            115   9e-29   
ref|XP_002463575.1|  hypothetical protein SORBIDRAFT_01g002340          116   9e-29   
gb|KDO64570.1|  hypothetical protein CISIN_1g029667mg                   116   9e-29   
ref|XP_008393299.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    120   9e-29   
dbj|BAK00078.1|  predicted protein                                      115   1e-28   
ref|NP_001150718.1|  cell number regulator 7                            116   1e-28   
ref|XP_007210160.1|  hypothetical protein PRUPE_ppa021734mg             120   1e-28   
ref|NP_001182140.1|  cell number regulator 3                            115   1e-28   
ref|XP_010265806.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    118   1e-28   
gb|EMS50827.1|  hypothetical protein TRIUR3_04648                       115   1e-28   
ref|NP_188476.1|  PLAC8 family protein                                  114   2e-28   
sp|D9HP23.1|CNR7_MAIZE  RecName: Full=Cell number regulator 7; Al...    115   2e-28   
gb|KJB34361.1|  hypothetical protein B456_006G062300                    114   2e-28   
ref|XP_008244012.1|  PREDICTED: proline-rich protein 2-like             119   2e-28   
ref|XP_007036475.1|  PLAC8 family protein                               119   2e-28   
ref|XP_003560347.1|  PREDICTED: cell number regulator 2-like            114   2e-28   
gb|ADA70360.1|  fruit weight 2.2-like protein                           115   2e-28   
dbj|BAK03231.1|  predicted protein                                      114   2e-28   
gb|EMT33463.1|  hypothetical protein F775_29891                         115   3e-28   
gb|EMT09706.1|  hypothetical protein F775_12587                         114   3e-28   
gb|AFW67071.1|  hypothetical protein ZEAMMB73_434410                    113   3e-28   
gb|EMS50826.1|  hypothetical protein TRIUR3_04647                       114   3e-28   
ref|XP_004298295.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    114   4e-28   
ref|XP_010461829.1|  PREDICTED: LOW QUALITY PROTEIN: protein PLAN...    115   6e-28   
gb|ABK26896.1|  unknown                                                 112   8e-28   
ref|XP_010487773.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 7      112   1e-27   
emb|CDP00819.1|  unnamed protein product                                112   1e-27   
ref|XP_011463689.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    113   1e-27   
sp|D9HP25.1|CNR9_MAIZE  RecName: Full=Cell number regulator 9; Al...    113   1e-27   
ref|NP_001148298.1|  PGPS/D12                                           113   1e-27   
ref|XP_007210047.1|  hypothetical protein PRUPE_ppa017696mg             113   1e-27   
emb|CDO98448.1|  unnamed protein product                                112   2e-27   
ref|XP_006661605.1|  PREDICTED: cell number regulator 10-like           113   2e-27   
ref|NP_188475.1|  PLAC8 family protein                                  112   2e-27   
gb|EAZ15101.1|  hypothetical protein OsJ_30514                          112   2e-27   
gb|EMT25656.1|  hypothetical protein F775_15812                         112   2e-27   
ref|NP_001147615.1|  PGPS/D12                                           112   2e-27   
gb|EMT33464.1|  hypothetical protein F775_29892                         112   2e-27   
ref|XP_007160404.1|  hypothetical protein PHAVU_002G3190000g            110   2e-27   
gb|AAK52582.1|AC079685_13  Unknown protein                              112   2e-27   
ref|NP_001144684.1|  cell number regulator 2                            112   3e-27   
gb|KCW83840.1|  hypothetical protein EUGRSUZ_B00708                     111   3e-27   
ref|NP_001064039.1|  Os10g0112100                                       112   4e-27   
ref|XP_006826802.1|  hypothetical protein AMTR_s00010p00032660          113   5e-27   
ref|XP_010692721.1|  PREDICTED: cell number regulator 9-like            110   5e-27   
gb|EEC66466.1|  hypothetical protein OsI_32544                          112   5e-27   
ref|XP_008244103.1|  PREDICTED: uncharacterized protein LOC103342271    115   5e-27   
ref|XP_009346942.1|  PREDICTED: cell number regulator 2-like            111   8e-27   
ref|XP_008346789.1|  PREDICTED: cell number regulator 2-like            110   9e-27   
ref|XP_008389191.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    109   1e-26   
gb|EMT06096.1|  hypothetical protein F775_17543                         109   1e-26   
ref|XP_001751495.1|  predicted protein                                  109   2e-26   
emb|CDP17837.1|  unnamed protein product                                108   2e-26   
emb|CDY62851.1|  BnaA06g03340D                                          108   3e-26   
ref|XP_001782161.1|  predicted protein                                  110   3e-26   
ref|XP_003631188.2|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    110   4e-26   
ref|XP_003560829.1|  PREDICTED: cell number regulator 11-like           109   5e-26   
gb|EMS50110.1|  hypothetical protein TRIUR3_01451                       112   5e-26   
dbj|BAK07059.1|  predicted protein                                      108   5e-26   
gb|EMT18700.1|  hypothetical protein F775_05178                         108   6e-26   
emb|CDY33730.1|  BnaA09g45360D                                          107   7e-26   
gb|EEE50469.1|  hypothetical protein OsJ_30513                          108   7e-26   
dbj|BAK04676.1|  predicted protein                                      107   8e-26   
gb|EYU33021.1|  hypothetical protein MIMGU_mgv11b015160mg               107   8e-26   
gb|EMS65792.1|  hypothetical protein TRIUR3_29610                       107   1e-25   
ref|XP_004986746.1|  PREDICTED: cell number regulator 4-like            107   2e-25   
ref|XP_010066586.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    108   2e-25   
ref|XP_008244011.1|  PREDICTED: leucine-rich repeat extensin-like...    111   2e-25   
gb|KJB50735.1|  hypothetical protein B456_008G184700                    108   2e-25   
dbj|BAJ98518.1|  predicted protein                                      105   3e-25   
ref|XP_008389222.1|  PREDICTED: cell number regulator 10-like           105   3e-25   
ref|XP_002511966.1|  structural constituent of cell wall, putative      110   3e-25   
ref|XP_010036868.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    107   4e-25   
ref|XP_004983440.1|  PREDICTED: cell number regulator 4-like isof...    104   1e-24   
ref|XP_010647752.1|  PREDICTED: cell number regulator 1 isoform X2      104   1e-24   
ref|XP_010265195.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    107   1e-24   
ref|XP_008224143.1|  PREDICTED: cell number regulator 7-like            103   2e-24   
ref|XP_002453300.1|  hypothetical protein SORBIDRAFT_04g003560          103   2e-24   
ref|XP_010506920.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   2e-24   
ref|XP_006392206.1|  hypothetical protein EUTSA_v10024015mg             103   3e-24   
ref|XP_010506925.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   4e-24   
ref|XP_007031864.1|  Plant cadmium resistance 11, putative              104   4e-24   
ref|XP_004296091.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   5e-24   
ref|XP_006301622.1|  hypothetical protein CARUB_v10022063mg             102   6e-24   
ref|XP_010465946.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   6e-24   
ref|XP_010265361.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    104   6e-24   
ref|XP_006440941.1|  hypothetical protein CICLE_v10024510mg             105   8e-24   
ref|XP_006651982.1|  PREDICTED: cell number regulator 10-like           102   9e-24   
gb|EAY92436.1|  hypothetical protein OsI_14169                          102   1e-23   
ref|XP_010036872.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   1e-23   
ref|XP_009346952.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    101   1e-23   
ref|XP_010506915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    103   1e-23   
emb|CDY29143.1|  BnaC09g15400D                                          102   1e-23   
ref|NP_001173698.1|  Os03g0830300                                       101   1e-23   
ref|XP_010489915.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    102   2e-23   
ref|NP_176128.1|  PLAC8 family protein                                  101   2e-23   
gb|AAO39859.1|  hypothetical protein                                    101   2e-23   
ref|XP_008646733.1|  PREDICTED: cell number regulator 4 isoform X1      101   2e-23   
ref|XP_010462060.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    102   2e-23   
emb|CDP00787.1|  unnamed protein product                                101   2e-23   
ref|XP_010500817.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 8      102   2e-23   
ref|XP_007035191.1|  Plant cadmium resistance 2                         100   4e-23   
ref|NP_001182141.1|  cell number regulator 4                            100   4e-23   
gb|KCW64540.1|  hypothetical protein EUGRSUZ_G02145                     100   4e-23   
gb|KDO70032.1|  hypothetical protein CISIN_1g041663mg                   100   4e-23   
ref|XP_004252239.1|  PREDICTED: cell number regulator 2-like            100   4e-23   
ref|NP_188474.1|  PLAC8 family protein                                  101   5e-23   
ref|XP_002314879.2|  hypothetical protein POPTR_0010s13790g             100   6e-23   
ref|XP_010470265.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  99.8    7e-23   
ref|XP_010915859.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...    102   8e-23   
ref|XP_010414744.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE ...  99.8    8e-23   
ref|XP_002885257.1|  hypothetical protein ARALYDRAFT_479347             100   1e-22   
emb|CDY38687.1|  BnaC01g28100D                                          100   1e-22   
gb|EPS59623.1|  hypothetical protein M569_15185                         100   1e-22   
ref|XP_009113322.1|  PREDICTED: protein PLANT CADMIUM RESISTANCE 9    99.4    1e-22   



>ref|XP_009351524.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like isoform X1 
[Pyrus x bretschneideri]
 ref|XP_009351525.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like isoform X2 
[Pyrus x bretschneideri]
 gb|AIU80196.1| fw2.2-like 2 protein [Pyrus betulifolia]
Length=208

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P   ++P+  GPWSTGL DCFSDP+NCCIT WCPCITFGQIAEIVDKGS SCG +GALYT
Sbjct  58   PPTHLRPRALGPWSTGLFDCFSDPKNCCITFWCPCITFGQIAEIVDKGSISCGASGALYT  117

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ACVT FPC YSCFYRSKMR+QY L+E+PCGDCLVHCFCE CALCQEYREL
Sbjct  118  LIACVTAFPCIYSCFYRSKMRQQYSLEESPCGDCLVHCFCEGCALCQEYREL  169



>gb|AHW50668.1| cadmium resistance protein 2 [Nicotiana tabacum]
Length=192

 Score =   194 bits (492),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 110/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  113  DYHKFTPSPYGDgvktgvpvssssttshayssegsHIAPNLQVKPKIRGPWSTGLCDCFS  292
             Y KF+ S YGD     +      ++      E     P +  K K   PWSTGLCDC S
Sbjct  10   QYQKFSSS-YGDETPPPLQTGVPVSSKGQLYVESIDPPPAMYRKKKNHVPWSTGLCDCMS  68

Query  293  DPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCYSCFYRSKMRE  472
            DP+NCCIT WCPCITFGQIAEI+DKGSNSCGV+GALY I+ CVTG PC YSCFYRSKMR+
Sbjct  69   DPKNCCITFWCPCITFGQIAEIIDKGSNSCGVSGALYAIIICVTGCPCFYSCFYRSKMRQ  128

Query  473  QYMLKETPCGDCLVHCFCESCALCQEYREL  562
            QY+LKE PCGDCLVHCFCE+CALCQEYREL
Sbjct  129  QYLLKENPCGDCLVHCFCEACALCQEYREL  158



>ref|XP_004236941.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Solanum lycopersicum]
Length=186

 Score =   193 bits (491),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 100/112 (89%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P +  K K   PWSTGLCDC SDP+NCCITLWCPCITFGQ+AEI+DKGSNSCGVNGALYT
Sbjct  41   PAMYRKKKNDVPWSTGLCDCMSDPKNCCITLWCPCITFGQVAEIIDKGSNSCGVNGALYT  100

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            I+ CVT  PC YSCFYR+KMR+QY+LK++PCGDCLVHCFCE+CALCQEYREL
Sbjct  101  IIICVTSCPCIYSCFYRNKMRQQYLLKKSPCGDCLVHCFCEACALCQEYREL  152



>ref|XP_009605116.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=192

 Score =   193 bits (490),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/150 (65%), Positives = 111/150 (74%), Gaps = 1/150 (1%)
 Frame = +2

Query  113  DYHKFTPSPYGDgvktgvpvssssttshayssegsHIAPNLQVKPKIRGPWSTGLCDCFS  292
             Y KF+ S YGD     +      ++      E     P +  K K   PWSTGLCDC S
Sbjct  10   QYQKFSSS-YGDETPPPLQTGVPVSSKGQLYVESIDPPPAMYRKKKNHVPWSTGLCDCMS  68

Query  293  DPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCYSCFYRSKMRE  472
            DP+NCCIT WCPCITFGQIAEI+DKGSNSCGV+GALY I+ CVTG PC YSCFYRSKMR+
Sbjct  69   DPKNCCITFWCPCITFGQIAEIIDKGSNSCGVSGALYAIIICVTGCPCFYSCFYRSKMRQ  128

Query  473  QYMLKETPCGDCLVHCFCESCALCQEYREL  562
            QY+LKE+PCGDCL+HCFCE+CALCQEYREL
Sbjct  129  QYLLKESPCGDCLLHCFCEACALCQEYREL  158



>ref|XP_007045235.1| Plant cadmium resistance 2, putative [Theobroma cacao]
 gb|EOY01067.1| Plant cadmium resistance 2, putative [Theobroma cacao]
Length=190

 Score =   192 bits (489),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N +++ K R PWS+GLCDCFSD +NCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALYT+
Sbjct  43   NTRIQTKTRVPWSSGLCDCFSDWKNCCITCWCPCVTFGQIAEIVDKGSSSCGVNGALYTL  102

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTG  CCYSCFYRSKMR+Q+MLK++PCGDCLVHCFCE CALCQEYREL
Sbjct  103  IACVTGCACCYSCFYRSKMRQQHMLKKSPCGDCLVHCFCECCALCQEYREL  153



>ref|XP_002311520.1| hypothetical protein POPTR_0008s13220g [Populus trichocarpa]
 gb|EEE88887.1| hypothetical protein POPTR_0008s13220g [Populus trichocarpa]
Length=192

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +++++ K +GPWSTGLCDC  D RNCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALY +
Sbjct  45   SIELRSKNKGPWSTGLCDCHDDWRNCCITFWCPCVTFGQIAEIVDKGSSSCGVNGALYAL  104

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++CVT FPCCYSCFYR+KMR+QY+L+ETPCGDCLVHCFCE C+LCQEYREL
Sbjct  105  ISCVTCFPCCYSCFYRAKMRQQYLLRETPCGDCLVHCFCECCSLCQEYREL  155



>ref|XP_011023892.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Populus euphratica]
Length=193

 Score =   192 bits (489),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/111 (77%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +++++ K +GPWSTGLCDC  D RNCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALY +
Sbjct  46   SIELRSKNKGPWSTGLCDCHDDWRNCCITFWCPCVTFGQIAEIVDKGSSSCGVNGALYAL  105

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++CVT FPCCYSCFYR+KMR+QY+L+ETPCGDCLVHCFCE C+LCQEYREL
Sbjct  106  ISCVTCFPCCYSCFYRAKMRQQYLLRETPCGDCLVHCFCECCSLCQEYREL  156



>ref|XP_009762819.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nicotiana 
sylvestris]
Length=192

 Score =   192 bits (487),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 98/150 (65%), Positives = 109/150 (73%), Gaps = 1/150 (1%)
 Frame = +2

Query  113  DYHKFTPSPYGDgvktgvpvssssttshayssegsHIAPNLQVKPKIRGPWSTGLCDCFS  292
             YHKF+ S YGD            ++      E       +  K K   PWSTGLCDC S
Sbjct  10   QYHKFSSS-YGDETPPPPQTGVPVSSKGQLYVESVDPPLAMYRKKKNLVPWSTGLCDCMS  68

Query  293  DPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCYSCFYRSKMRE  472
            DP+NCCIT WCPCITFGQIAEI+DKGSNSCGV+GALY I+ CVTG PC YSCFYRSKMR+
Sbjct  69   DPKNCCITFWCPCITFGQIAEIIDKGSNSCGVSGALYAIIICVTGCPCFYSCFYRSKMRQ  128

Query  473  QYMLKETPCGDCLVHCFCESCALCQEYREL  562
            QY+LKE PCGDCLVHCFCE+CALCQEYREL
Sbjct  129  QYLLKENPCGDCLVHCFCEACALCQEYREL  158



>ref|XP_006355072.1| PREDICTED: cell number regulator 2-like [Solanum tuberosum]
Length=190

 Score =   191 bits (486),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P +  K K   PWSTGLCDC SDP+NCCITLWCPCITFGQ+AEI+DKGSNSCGVNGALY 
Sbjct  45   PAMYRKKKNDVPWSTGLCDCMSDPKNCCITLWCPCITFGQVAEIIDKGSNSCGVNGALYA  104

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            I+ CVT  PCCYSCFYR+KMR+QY+LK+ PCGDCLVHCFCE+CALCQEYREL
Sbjct  105  IIICVTCCPCCYSCFYRNKMRQQYLLKKNPCGDCLVHCFCEACALCQEYREL  156



>gb|KJB30778.1| hypothetical protein B456_005G159200 [Gossypium raimondii]
Length=171

 Score =   190 bits (482),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N + + K R PWS+GLC CFSD RNCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALYT+
Sbjct  48   NTRPQTKTRVPWSSGLCGCFSDWRNCCITCWCPCVTFGQIAEIVDKGSSSCGVNGALYTL  107

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTG  CCYSCFYR+KMR+QYMLK+ PCGDCLVHCFCE CALCQEYREL
Sbjct  108  IACVTGCACCYSCFYRAKMRQQYMLKKHPCGDCLVHCFCEYCALCQEYREL  158



>gb|KJB30777.1| hypothetical protein B456_005G159200 [Gossypium raimondii]
Length=195

 Score =   190 bits (483),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N + + K R PWS+GLC CFSD RNCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALYT+
Sbjct  48   NTRPQTKTRVPWSSGLCGCFSDWRNCCITCWCPCVTFGQIAEIVDKGSSSCGVNGALYTL  107

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTG  CCYSCFYR+KMR+QYMLK+ PCGDCLVHCFCE CALCQEYREL
Sbjct  108  IACVTGCACCYSCFYRAKMRQQYMLKKHPCGDCLVHCFCEYCALCQEYREL  158



>gb|AIU80195.1| fw2.2-like 1 protein [Pyrus betulifolia]
Length=214

 Score =   189 bits (481),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 88/112 (79%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  +++P+   PWSTGLCDCFSD +NCCITLWCPCITFGQIAEIVDKGS SCG +GALYT
Sbjct  63   PPSRLRPRALIPWSTGLCDCFSDFKNCCITLWCPCITFGQIAEIVDKGSTSCGASGALYT  122

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ CVT  PCCYSCFYRSKMR+QY L+E+PCGDCLVHCFCE CALCQEYREL
Sbjct  123  LITCVTACPCCYSCFYRSKMRQQYSLEESPCGDCLVHCFCEHCALCQEYREL  174



>emb|CDP00825.1| unnamed protein product [Coffea canephora]
Length=191

 Score =   188 bits (477),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/108 (83%), Positives = 96/108 (89%), Gaps = 0/108 (0%)
 Frame = +2

Query  239  VKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILAC  418
            VKPK + PWSTGLCDC SD RNCCIT WCPCITFGQ+AEIVDKGS+SCG NGALYT++AC
Sbjct  46   VKPKPQVPWSTGLCDCTSDARNCCITCWCPCITFGQVAEIVDKGSSSCGSNGALYTLIAC  105

Query  419  VTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            VTG  C YSCFYRSKMR+QY L ETPCGDCLVHCFCE CALCQEYREL
Sbjct  106  VTGCACFYSCFYRSKMRQQYSLHETPCGDCLVHCFCEPCALCQEYREL  153



>gb|KDP38095.1| hypothetical protein JCGZ_04738 [Jatropha curcas]
Length=188

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 100/111 (90%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            ++ ++ K + PWS+GLCDCFSD RNCCIT WCPC+TFGQIAEIVDKGS++CGVNGALYT+
Sbjct  41   DISLESKNKEPWSSGLCDCFSDWRNCCITFWCPCVTFGQIAEIVDKGSSACGVNGALYTL  100

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTGF CCYSCFYR K+R+Q+ LKE+PCGDCLVHC CE CALCQEYREL
Sbjct  101  IACVTGFACCYSCFYRGKLRQQHALKESPCGDCLVHCCCEYCALCQEYREL  151



>ref|XP_002315866.1| hypothetical protein POPTR_0010s11910g [Populus trichocarpa]
 gb|EEF02037.1| hypothetical protein POPTR_0010s11910g [Populus trichocarpa]
Length=193

 Score =   187 bits (476),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/111 (76%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +++++ K +GPWSTGLCDCF D RNCC+T WCPCITFGQIAEIVDKG++SCGVNGALY +
Sbjct  46   SIELRSKSKGPWSTGLCDCFDDWRNCCVTFWCPCITFGQIAEIVDKGASSCGVNGALYAL  105

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++CVT  PCCYSCFYR+KMR+QY+L+ETPCGDCLVHC CE C+LCQEYREL
Sbjct  106  ISCVTCCPCCYSCFYRAKMRQQYLLRETPCGDCLVHCCCEYCSLCQEYREL  156



>ref|XP_011021803.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Populus euphratica]
Length=193

 Score =   187 bits (475),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/111 (77%), Positives = 101/111 (91%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +++++ K +GPWSTGLC+CF D RNCCIT WCPCITFGQIAEIVDKGS+SCGVNGALY +
Sbjct  46   SIELRSKSKGPWSTGLCECFDDWRNCCITFWCPCITFGQIAEIVDKGSSSCGVNGALYAL  105

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++CVT  PCCYSCFYR+KMR+QY+L+ETPCGDCLVHC CE C+LCQEYREL
Sbjct  106  ISCVTCCPCCYSCFYRAKMRQQYLLRETPCGDCLVHCCCEYCSLCQEYREL  156



>gb|KJB12051.1| hypothetical protein B456_002G174500 [Gossypium raimondii]
Length=182

 Score =   187 bits (474),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/111 (80%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N +++ K R PWS+GLCDCFSD RNCCIT WCPC+TFGQIAEIVDKGS+SCGVNGALYT+
Sbjct  35   NTRLQTKTRVPWSSGLCDCFSDWRNCCITCWCPCVTFGQIAEIVDKGSSSCGVNGALYTL  94

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTG  CCYSCFYRSKM +QYMLK+ PCGDCLVHC CE CALCQEYREL
Sbjct  95   IACVTGCACCYSCFYRSKMGQQYMLKKHPCGDCLVHCCCEYCALCQEYREL  145



>ref|XP_011070591.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Sesamum indicum]
Length=189

 Score =   186 bits (473),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 89/110 (81%), Positives = 100/110 (91%), Gaps = 2/110 (2%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
            + +KP++  PWSTGLCDCFSD RNCCIT WCPCITFGQI+EIVDKGS+SC  NGALYT++
Sbjct  48   IPLKPQV--PWSTGLCDCFSDVRNCCITCWCPCITFGQISEIVDKGSSSCVQNGALYTVV  105

Query  413  ACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ACVTG PC YSCFYRSKMR+QY+L E+PCGDCLVHCFCESCALCQEYREL
Sbjct  106  ACVTGCPCFYSCFYRSKMRQQYLLHESPCGDCLVHCFCESCALCQEYREL  155



>ref|XP_002284819.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Vitis vinifera]
 emb|CBI26853.3| unnamed protein product [Vitis vinifera]
Length=201

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 88/111 (79%), Positives = 101/111 (91%), Gaps = 3/111 (3%)
 Frame = +2

Query  239  VKPKI---RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            ++PK+   R PWS+GLCDCFSDPRNCCIT WCPCITFGQIAEIVDKGS++CGVNGALYT+
Sbjct  50   LQPKVKAPRVPWSSGLCDCFSDPRNCCITCWCPCITFGQIAEIVDKGSSACGVNGALYTL  109

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +ACVTG  CCYSCFYR+KMR+QY+LK +PCGDCLVHC CE C+LCQEYREL
Sbjct  110  IACVTGCACCYSCFYRAKMRQQYLLKPSPCGDCLVHCCCEYCSLCQEYREL  160



>ref|XP_008360029.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Malus domestica]
Length=214

 Score =   186 bits (473),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 87/112 (78%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  + +P+   PWSTGLCDCFSD +NCCITLWCPCITFG+IAEIVDKGS SCG +GALYT
Sbjct  63   PPSRPRPRALIPWSTGLCDCFSDFKNCCITLWCPCITFGRIAEIVDKGSTSCGASGALYT  122

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ CVT  PCCYSCFYRSKMR+QY L+E+PCGDCLVHCFCE CALCQEYREL
Sbjct  123  LITCVTACPCCYSCFYRSKMRQQYSLEESPCGDCLVHCFCEHCALCQEYREL  174



>ref|XP_010095722.1| hypothetical protein L484_002694 [Morus notabilis]
 gb|EXB62022.1| hypothetical protein L484_002694 [Morus notabilis]
Length=205

 Score =   186 bits (472),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/105 (80%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +2

Query  248  KIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTG  427
            ++  PWSTGL DCFSD +NCC+T WCPC+TFGQIAEIVDKGS SCG +GALYT++ACVTG
Sbjct  67   RVPVPWSTGLFDCFSDVKNCCVTFWCPCVTFGQIAEIVDKGSTSCGASGALYTLIACVTG  126

Query  428  FPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            F CCYSCFYRSKMR+Q+ L+E+PCGDCLVHCFCESCALCQEYREL
Sbjct  127  FACCYSCFYRSKMRQQHALQESPCGDCLVHCFCESCALCQEYREL  171



>gb|EYU30102.1| hypothetical protein MIMGU_mgv1a024272mg, partial [Erythranthe 
guttata]
Length=148

 Score =   183 bits (464),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  ++ PK R PWSTGLC CFSD RNCCIT WCPCITFGQIAEIVDKGS+SCG NGALYT
Sbjct  3    PQPRIPPKSRVPWSTGLCGCFSDCRNCCITCWCPCITFGQIAEIVDKGSSSCGQNGALYT  62

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ACVTG PC YSCFYRSK+R+QY+L E+ CGDC VHCFCESCALCQEYREL
Sbjct  63   LIACVTGCPCFYSCFYRSKLRQQYLLHESACGDCCVHCFCESCALCQEYREL  114



>ref|XP_010271282.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=197

 Score =   183 bits (464),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 86/101 (85%), Positives = 94/101 (93%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC SD RNCCIT WCPCITFGQIAEIVDKGS++CG NGALYT++ACVTG P  
Sbjct  63   PWSTGLCDCGSDVRNCCITCWCPCITFGQIAEIVDKGSSACGSNGALYTLIACVTGCPFF  122

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R+QY+LKE+PCGDCLVHCFCESCALCQEYREL
Sbjct  123  YSCFYRSKLRQQYLLKESPCGDCLVHCFCESCALCQEYREL  163



>ref|XP_008221439.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Prunus mume]
 ref|XP_008221440.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Prunus mume]
 ref|XP_008221442.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Prunus mume]
Length=208

 Score =   182 bits (462),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 96/109 (88%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
             ++P+   PWS+GLCDCFSDP+NCCIT WCPCITFGQIAEIVDKGS SCG +GALYT+++
Sbjct  61   HLRPRAPVPWSSGLCDCFSDPKNCCITCWCPCITFGQIAEIVDKGSTSCGASGALYTLIS  120

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            CVTG PC YSCFYRSKMR+QY L+E+PC DCL+HCFCE CALCQEYR L
Sbjct  121  CVTGCPCFYSCFYRSKMRQQYALEESPCNDCLLHCFCEFCALCQEYRHL  169



>ref|XP_004297454.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   182 bits (461),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 94/113 (83%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            AP   ++P+   PW TGL DCF+DP+NCC T WCPCITFGQIAEIVDKGS SCG +GALY
Sbjct  53   APPYHLRPRAPEPWKTGLFDCFNDPKNCCTTFWCPCITFGQIAEIVDKGSTSCGASGALY  112

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T++ CVTG PC YSCFYRSKMR+QY L  +PCGDCLVHCFCE CALCQEYREL
Sbjct  113  TLIFCVTGCPCFYSCFYRSKMRQQYTLDASPCGDCLVHCFCEYCALCQEYREL  165



>ref|XP_007223430.1| hypothetical protein PRUPE_ppa011430mg [Prunus persica]
 gb|EMJ24629.1| hypothetical protein PRUPE_ppa011430mg [Prunus persica]
Length=211

 Score =   180 bits (457),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 94/109 (86%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
             ++P+   PWS+GLCDCFSDP+NCCIT WCPCITFGQIAEIVDKGS SCG +GALYT++ 
Sbjct  64   HLRPRAPVPWSSGLCDCFSDPKNCCITCWCPCITFGQIAEIVDKGSTSCGASGALYTLIT  123

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            CVTG PC YSCFYRSKMR+QY L E+PC DCL+HCFCE CALCQEYR L
Sbjct  124  CVTGCPCFYSCFYRSKMRQQYALVESPCNDCLLHCFCECCALCQEYRHL  172



>ref|XP_009351523.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Pyrus x bretschneideri]
Length=151

 Score =   174 bits (440),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGL DCFSDP+NCC+TLWCPCITFGQIAE VDKGS  C  +GALY ++ACVT FPC 
Sbjct  15   PWSTGLFDCFSDPKNCCVTLWCPCITFGQIAETVDKGSIPCCASGALYILIACVTAFPCI  74

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSKMR+QY L+ +PCGDCLVHCFCE CALCQEYREL
Sbjct  75   YSCFYRSKMRQQYTLEGSPCGDCLVHCFCEGCALCQEYREL  115



>ref|XP_004297458.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=196

 Score =   175 bits (443),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PW +GL DCFSDP++CC+T WCPC+TFGQIAEIVDKGS SCG +GALY ++A VTG  C 
Sbjct  57   PWKSGLLDCFSDPKSCCLTFWCPCVTFGQIAEIVDKGSTSCGASGALYALIAFVTGCSCI  116

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSKMR+QY L+E+PCGDCLVHCFCE+CALCQEYREL
Sbjct  117  YSCFYRSKMRQQYSLEESPCGDCLVHCFCEACALCQEYREL  157



>ref|XP_004297478.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=209

 Score =   174 bits (441),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 78/101 (77%), Positives = 90/101 (89%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PW +GL DCFSDP++ C+T WCPC+TFGQIAEIVDKGS SCGV+GALY ++A VTG  C 
Sbjct  57   PWKSGLLDCFSDPKSYCLTFWCPCVTFGQIAEIVDKGSTSCGVSGALYALIAFVTGCSCI  116

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSKMR+QY L+E+PCGDCLVHCFCE+CALCQEYREL
Sbjct  117  YSCFYRSKMRQQYSLEESPCGDCLVHCFCEACALCQEYREL  157



>ref|XP_004297456.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=204

 Score =   172 bits (437),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/101 (80%), Positives = 88/101 (87%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PW +GLCDCFSDP+NCCIT  CPCITFGQIAEIVDKGS SCG +GALYT++ACVT  PC 
Sbjct  65   PWKSGLCDCFSDPKNCCITFCCPCITFGQIAEIVDKGSTSCGASGALYTLIACVTTCPCI  124

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSKMR QY L+ +PCGDCLVH FCE CALCQEYREL
Sbjct  125  YSCFYRSKMRRQYSLESSPCGDCLVHFFCEQCALCQEYREL  165



>ref|XP_002527778.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34588.1| conserved hypothetical protein [Ricinus communis]
Length=147

 Score =   167 bits (422),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 80/111 (72%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +L    K + PWSTGLCDCFSD R CCIT WCPCITFGQIAEIV+KG+ SC   GA+Y I
Sbjct  3    SLPNNSKAQVPWSTGLCDCFSDRRTCCITFWCPCITFGQIAEIVEKGTTSCATTGAIYAI  62

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LAC TG  C YSC YRSK+R QYML E+PC DCLVHC CE+CALCQEYREL
Sbjct  63   LACFTGCGCIYSCMYRSKLRHQYMLPESPCNDCLVHCCCEACALCQEYREL  113



>ref|XP_011070721.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Sesamum indicum]
Length=187

 Score =   167 bits (423),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +2

Query  251  IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGF  430
            + GPWSTGLCDCFSD  NCCIT WCPCITFGQ+AEIVDKGS SCG +GALY ++A ++G 
Sbjct  50   VPGPWSTGLCDCFSDVPNCCITYWCPCITFGQVAEIVDKGSTSCGTSGALYALVAFISGC  109

Query  431  PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            PC YSCFYRSKMR+QYML E+PC DCLVH  CE CALCQEYREL
Sbjct  110  PCIYSCFYRSKMRKQYMLTESPCIDCLVHLCCECCALCQEYREL  153



>ref|XP_011078094.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Sesamum indicum]
Length=185

 Score =   165 bits (418),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/115 (71%), Positives = 91/115 (79%), Gaps = 1/115 (1%)
 Frame = +2

Query  221  IAPNLQVKPKI-RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            I P  QV+  +  GPWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVD+GS SCG +GA
Sbjct  37   IQPGPQVQSSVPAGPWSTGLCDCFSDVSNCCITCWCPCITFGQIAEIVDRGSTSCGASGA  96

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LY ++A +TG  C YSCFYRS+MR  YML E PC DCLVH  CE+CALCQEYREL
Sbjct  97   LYALIAYITGCACIYSCFYRSRMRRLYMLPEDPCPDCLVHFCCEACALCQEYREL  151



>gb|KDO37146.1| hypothetical protein CISIN_1g031629mg [Citrus sinensis]
Length=156

 Score =   164 bits (414),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 82/113 (73%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  227  PNLQVKPK-IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            PN +  PK   GPWS+GLCDCFSD   CC+T WCP ITFG+IAEIVD+GS+SCGVN ALY
Sbjct  7    PNQEFDPKATEGPWSSGLCDCFSDCSTCCLTYWCPWITFGRIAEIVDQGSSSCGVNCALY  66

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ILA +TG  C  SC YRSKMR QYMLK++PCGDCLVH FCE CALCQEYREL
Sbjct  67   FILAWLTGCSCLLSCGYRSKMRHQYMLKDSPCGDCLVHVFCELCALCQEYREL  119



>gb|EYU17884.1| hypothetical protein MIMGU_mgv1a023749mg [Erythranthe guttata]
Length=193

 Score =   165 bits (417),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/114 (70%), Positives = 90/114 (79%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            + P++QV   + GPWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVD+GS SCG +GAL
Sbjct  46   MHPSMQVHGNLPGPWSTGLCDCFSDVSNCCITCWCPCITFGQIAEIVDRGSTSCGASGAL  105

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y +++  TG  C YSC YRSKMR QYML E PC D L+H  CESCALCQEYREL
Sbjct  106  YALISYFTGCACIYSCTYRSKMRSQYMLAEDPCPDFLLHLCCESCALCQEYREL  159



>gb|KDP38094.1| hypothetical protein JCGZ_04737 [Jatropha curcas]
Length=171

 Score =   164 bits (414),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 79/112 (71%), Positives = 89/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  Q    + G WS+GLC C SD +NCCIT WCPCITFGQIAEIVDKG+ SC  +GALY 
Sbjct  26   PLHQHHHALEGGWSSGLCGCCSDVKNCCITFWCPCITFGQIAEIVDKGATSCATSGALYG  85

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +LAC TG  C YSCFYRSK+R+QYML+E PC DCLVHC CE+CALCQEYREL
Sbjct  86   LLACFTGCACIYSCFYRSKLRKQYMLQERPCNDCLVHCCCETCALCQEYREL  137



>ref|XP_006469218.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Citrus sinensis]
Length=156

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 81/113 (72%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  227  PNLQVKPK-IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            PN +  PK   GPWS+GLCDCFSD   CC+T WCP ITFG+IAEIVD+GS+SCGVN ALY
Sbjct  7    PNQEFDPKATEGPWSSGLCDCFSDCSTCCLTYWCPWITFGRIAEIVDQGSSSCGVNCALY  66

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             I+A +TG  C  SC YRSKMR QYMLK++PCGDCLVH FCE CALCQEYREL
Sbjct  67   FIIAWLTGCSCLLSCGYRSKMRHQYMLKDSPCGDCLVHVFCELCALCQEYREL  119



>ref|XP_010266998.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=161

 Score =   163 bits (412),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 93/112 (83%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P + V+ +    WSTGLCDC  D +NCC+T WCPCITFGQI+EI+DKG++SCG NGALYT
Sbjct  16   PAVPVQVQAPVDWSTGLCDCSDDVQNCCVTCWCPCITFGQISEIIDKGTSSCGTNGALYT  75

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +++ V G P  YSCFYRSK+R+QY+LKE+PC DCLVHC CESCALCQEYREL
Sbjct  76   LISFVIGCPFLYSCFYRSKLRQQYLLKESPCVDCLVHCCCESCALCQEYREL  127



>gb|KFK30972.1| hypothetical protein AALP_AA6G051700 [Arabis alpina]
Length=151

 Score =   162 bits (409),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 77/107 (72%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP+  G WST  CDCFSD  NCCIT WCPCITFGQIAEIVD+GS+SCG  GALY ++ACV
Sbjct  10   KPQADGEWSTDFCDCFSDCSNCCITFWCPCITFGQIAEIVDRGSSSCGTTGALYMLIACV  69

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG  C YSCFYR+KMR+QY LK + CGDCL H FCE CAL Q YREL
Sbjct  70   TGCACFYSCFYRTKMRKQYNLKGSECGDCLKHSFCEVCALTQAYREL  116



>ref|XP_006448204.1| hypothetical protein CICLE_v10017041mg [Citrus clementina]
 gb|ESR61444.1| hypothetical protein CICLE_v10017041mg [Citrus clementina]
Length=156

 Score =   162 bits (409),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 80/113 (71%), Positives = 91/113 (81%), Gaps = 1/113 (1%)
 Frame = +2

Query  227  PNLQVKPKI-RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            PN +  PK   GPWS+GLCDCFSD   CC+T WCP ITFG+IAEIVD+GS+SCGVN ALY
Sbjct  7    PNQEFDPKAAEGPWSSGLCDCFSDCSTCCLTYWCPWITFGRIAEIVDQGSSSCGVNCALY  66

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             I+A +TG  C  SC YRS+MR QYMLK++PCGDCLVH FCE CALCQEYREL
Sbjct  67   FIIAWLTGCSCLLSCGYRSRMRHQYMLKDSPCGDCLVHVFCELCALCQEYREL  119



>emb|CDP00822.1| unnamed protein product [Coffea canephora]
Length=160

 Score =   162 bits (409),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 79/102 (77%), Positives = 86/102 (84%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G W+TGLC CFSD  NCCIT WCPCITFGQIAEIVDKG+ SCG +GALY +LA +TG  C
Sbjct  25   GSWATGLCGCFSDVSNCCITCWCPCITFGQIAEIVDKGTTSCGTSGALYGLLAYLTGCAC  84

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSCFYRSKMR QYML E+PCGDCLVH  CE+CALCQEYREL
Sbjct  85   IYSCFYRSKMRRQYMLPESPCGDCLVHFCCETCALCQEYREL  126



>emb|CDP00823.1| unnamed protein product [Coffea canephora]
Length=195

 Score =   162 bits (411),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 87/105 (83%), Gaps = 0/105 (0%)
 Frame = +2

Query  248  KIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTG  427
               G WSTGLCDCFSD  NCC+T WCPCITFG+IAEIVD+GS SCG +GALY +LA  TG
Sbjct  57   NTTGSWSTGLCDCFSDVPNCCMTCWCPCITFGEIAEIVDEGSTSCGASGALYGLLAYFTG  116

Query  428  FPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              C YSCFYR+KMR+QYML E+PCGDCLVH  C+SCALCQEYREL
Sbjct  117  CACIYSCFYRTKMRQQYMLPESPCGDCLVHFCCDSCALCQEYREL  161



>ref|XP_009117865.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Brassica rapa]
Length=151

 Score =   161 bits (407),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLHAKPRAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T+++C TG  C YSCFYR KMR QY +    CGDCL H FCE CAL Q+YREL
Sbjct  63   TLISCFTGCGCIYSCFYRGKMRAQYNIGGNDCGDCLKHFFCELCALTQQYREL  115



>emb|CDY33732.1| BnaA09g45380D [Brassica napus]
Length=151

 Score =   160 bits (406),  Expect = 3e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLHAKPQAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T+++C TG  C YSCFYR KMR QY +    CGDCL H FCE CAL Q+YREL
Sbjct  63   TLISCFTGCGCIYSCFYRGKMRAQYNIGGNDCGDCLKHFFCELCALTQQYREL  115



>emb|CDX81680.1| BnaC08g39210D [Brassica napus]
Length=151

 Score =   160 bits (405),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 87/113 (77%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +LQ KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLQGKPQAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VTG  C YSCFYR KMR QY ++ + CGDCL H FCE CAL Q+YREL
Sbjct  63   ALINAVTGCACIYSCFYRGKMRAQYNIEGSDCGDCLKHFFCELCALTQQYREL  115



>ref|XP_007045231.1| Plant cadmium resistance 2 [Theobroma cacao]
 gb|EOY01063.1| Plant cadmium resistance 2 [Theobroma cacao]
Length=158

 Score =   159 bits (403),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            +P    PWS G CDC SD + CCI  WCPCITFGQIAEIVDKGS SCG +GALYT++  +
Sbjct  19   QPHDEVPWSVGFCDCLSDMKTCCIAYWCPCITFGQIAEIVDKGSTSCGASGALYTLILLI  78

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             G PC YSCFYR+KMR+QYMLK   CGDC++H FCE+CAL QEYREL
Sbjct  79   IGCPCFYSCFYRTKMRKQYMLKGGGCGDCMLHFFCETCALTQEYREL  125



>emb|CDY33731.1| BnaA09g45370D [Brassica napus]
Length=151

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AEHLHGKPQAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VTG  C YSCFYR KMR QY ++ + CGDCL H FCE CAL Q+YREL
Sbjct  63   ALINAVTGCACIYSCFYRGKMRAQYNIEGSDCGDCLKHFFCELCALTQQYREL  115



>ref|XP_009117864.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Brassica 
rapa]
Length=151

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 86/113 (76%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLHGKPQAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VTG  C YSCFYR KMR QY ++ + CGDCL H FCE CAL Q+YREL
Sbjct  63   ALINAVTGCACIYSCFYRGKMRAQYNIEGSDCGDCLKHFFCELCALTQQYREL  115



>ref|XP_003631187.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Vitis vinifera]
 emb|CBI27046.3| unnamed protein product [Vitis vinifera]
Length=209

 Score =   160 bits (404),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 89/101 (88%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC CF+D ++CC+T WCPC+TFG+IAEIVD+GS SCGV+GALYT++ C+TG  C 
Sbjct  73   PWSTGLCHCFNDCKSCCLTFWCPCVTFGRIAEIVDRGSTSCGVSGALYTLILCLTGCSCL  132

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY+L+E+PC DC VHC+CE CALCQEYREL
Sbjct  133  YSCFYRSKLRGQYLLEESPCVDCCVHCWCEGCALCQEYREL  173



>ref|XP_010909567.1| PREDICTED: cell number regulator 2-like [Elaeis guineensis]
Length=180

 Score =   159 bits (401),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 78/110 (71%), Positives = 88/110 (80%), Gaps = 0/110 (0%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
             QV  +  GPWSTGLC+CF D  NC IT +CPCITFGQIAEIVDKGS SCG +GALY ++
Sbjct  35   FQVYSQAPGPWSTGLCECFDDCSNCLITCFCPCITFGQIAEIVDKGSTSCGASGALYALI  94

Query  413  ACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              VTG  C YSCFYRSK+R QY L+E+PC DCLVHC CE+CALCQEYREL
Sbjct  95   MWVTGCGCLYSCFYRSKLRAQYSLQESPCNDCLVHCCCETCALCQEYREL  144



>emb|CDY71864.1| BnaAnng39070D [Brassica napus]
Length=151

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 85/113 (75%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP+  G WSTG CDCFSD +NCCIT WCP ITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLHAKPQAEGEWSTGFCDCFSDCKNCCITCWCPGITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T+++C TG  C YSCFYR KMR QY +    CGDCL H FCE CAL Q+YREL
Sbjct  63   TLISCFTGCGCIYSCFYRGKMRAQYNIGGNDCGDCLKHFFCELCALTQQYREL  115



>gb|KJB12060.1| hypothetical protein B456_002G175300 [Gossypium raimondii]
Length=145

 Score =   157 bits (398),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 84/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            +P    PWS G CDCFSD + CCI  WCPCITFGQIAEIVDKGS SCG +GALYT++  +
Sbjct  6    QPHDEAPWSVGFCDCFSDMKTCCIACWCPCITFGQIAEIVDKGSTSCGASGALYTLIMFI  65

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG PC YSCFYRSK+R+QY LK   CGDC++H  CE+CAL QEYREL
Sbjct  66   TGLPCFYSCFYRSKLRKQYKLKGGGCGDCMLHFCCETCALTQEYREL  112



>ref|XP_009615155.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nicotiana 
tomentosiformis]
Length=179

 Score =   158 bits (400),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 79/113 (70%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            AP  Q      G WSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SCG +GALY
Sbjct  34   APQFQANHN-PGTWSTGLCDCFSDVSNCCITCWCPCITFGQIAEIVDKGTTSCGASGALY  92

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L  +TG  C YSCFYR+KMR+QYML E+ CGDC++H  CE CALCQEYREL
Sbjct  93   FLLEVLTGCGCIYSCFYRTKMRKQYMLPESTCGDCMLHFCCECCALCQEYREL  145



>ref|XP_006416962.1| hypothetical protein EUTSA_v10009008mg [Eutrema salsugineum]
 gb|ESQ35315.1| hypothetical protein EUTSA_v10009008mg [Eutrema salsugineum]
Length=151

 Score =   157 bits (397),  Expect = 5e-45, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A     KP+  G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+G+ +CG  GA+Y
Sbjct  3    AQRFHDKPQAEGEWSTGFCDCFSDCKNCCITCWCPCITFGQVAEIVDQGATTCGTGGAIY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L+ VTG  C YSCFYR KMR QY +  + CGDCL H FCE CAL QEYREL
Sbjct  63   ALLSAVTGCACIYSCFYRGKMRAQYNIGGSHCGDCLQHFFCELCALTQEYREL  115



>ref|XP_010535733.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Tarenaya 
hassleriana]
Length=150

 Score =   157 bits (397),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 73/107 (68%), Positives = 85/107 (79%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP+    WSTG CDCFSD  NCCIT WCPCITFG++AEIVD+GS SCG +GALY ++AC+
Sbjct  9    KPQAEAEWSTGFCDCFSDCSNCCITCWCPCITFGEVAEIVDRGSTSCGASGALYALVACI  68

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG  C YSCFYR+KMR+QY +  + CGDCL H FCE CAL QEYREL
Sbjct  69   TGCGCIYSCFYRTKMRKQYNISGSQCGDCLSHFFCELCALTQEYREL  115



>ref|XP_008780573.1| PREDICTED: cell number regulator 2-like, partial [Phoenix dactylifera]
Length=158

 Score =   157 bits (396),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 77/100 (77%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  D  NCCIT +CPCITFGQIAEIVDKGS+SCG +GALYT++ CVTG  C Y
Sbjct  50   WSTGLCHCLDDCSNCCITCFCPCITFGQIAEIVDKGSSSCGASGALYTLILCVTGCSCFY  109

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSK+R QY LKE+PC DCLVHC CE CALCQEYREL
Sbjct  110  SCFYRSKLRAQYSLKESPCNDCLVHCCCELCALCQEYREL  149



>ref|XP_004503375.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Cicer arietinum]
Length=216

 Score =   159 bits (401),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 76/106 (72%), Positives = 85/106 (80%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            PK+   WSTGLCDC S+P  CCIT WCPCITFGQ+AEIVDKGS SCG +GALYT++ CV 
Sbjct  74   PKLLVEWSTGLCDCCSNPGKCCITFWCPCITFGQVAEIVDKGSTSCGASGALYTLICCVI  133

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G    YSCFYRSKMR+QY LK   C DCL+H FCE+CALCQEYREL
Sbjct  134  GCASLYSCFYRSKMRQQYGLKGNDCTDCLIHFFCETCALCQEYREL  179



>ref|XP_009793964.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nicotiana 
sylvestris]
Length=180

 Score =   157 bits (397),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/113 (68%), Positives = 88/113 (78%), Gaps = 1/113 (1%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            AP  Q      G WSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SCG +GA+Y
Sbjct  35   APQFQANHN-PGTWSTGLCDCFSDVSNCCITCWCPCITFGQIAEIVDKGTTSCGASGAIY  93

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  +TG  C YSCFYR+KMR+QYML E+ CGDC++H  CE CALCQEYREL
Sbjct  94   FLIEALTGCGCIYSCFYRTKMRKQYMLPESSCGDCMLHFCCECCALCQEYREL  146



>ref|NP_172940.1| cadmium resistance protein 2 [Arabidopsis thaliana]
 sp|Q9LQU4.1|PCR2_ARATH RecName: Full=Protein PLANT CADMIUM RESISTANCE 2; Short=AtPCR2 
[Arabidopsis thaliana]
 gb|AAF79235.1|AC006917_20 F10B6.27 [Arabidopsis thaliana]
 gb|AAL62389.1| unknown protein [Arabidopsis thaliana]
 gb|AAM48020.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29237.1| cadmium resistance protein 2 [Arabidopsis thaliana]
Length=152

 Score =   156 bits (394),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/113 (65%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCFSD +NCCIT WCPCITFGQ+AEIVD+GS SCG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQVAEIVDRGSTSCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++A VTG  C YSCFYR KMR QY +K   C DCL H  CE C+L Q+YREL
Sbjct  63   ALIAVVTGCACIYSCFYRGKMRAQYNIKGDDCTDCLKHFCCELCSLTQQYREL  115



>ref|XP_009117863.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Brassica 
rapa]
Length=147

 Score =   155 bits (393),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 85/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
             ++ KP+  G WSTG CDCF D  NCC+T WCPC+TFGQIAEIVD+GS+SCG  GALY +
Sbjct  2    EVEGKPQADGEWSTGFCDCFLDCSNCCMTFWCPCVTFGQIAEIVDQGSSSCGTTGALYML  61

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LA  TG  C YSCFYR+KMR+QY LK + CGDCL H FCE CAL Q YREL
Sbjct  62   LAWFTGCGCIYSCFYRTKMRKQYNLKGSECGDCLKHFFCELCALTQAYREL  112



>ref|XP_006354110.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Solanum tuberosum]
Length=164

 Score =   156 bits (394),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            Q +    G WSTGLCDCFSD  NCC+T WCPCITFGQIAEIVDKG+ SCG +GALY ++ 
Sbjct  22   QFQANHPGTWSTGLCDCFSDVPNCCLTCWCPCITFGQIAEIVDKGTVSCGASGALYFLIE  81

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +TG  C YSCFYR+KMR+QYML E+PCGDCL+H  CE CALCQE+REL
Sbjct  82   ALTGCGCIYSCFYRTKMRKQYMLPESPCGDCLLHFCCECCALCQEHREL  130



>ref|XP_006826804.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
 gb|ERM94041.1| hypothetical protein AMTR_s00010p00034340 [Amborella trichopoda]
Length=191

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC  DP NCCIT WCPCITFGQIAEI D+G  SCGV+G+LY ++  + G  CC
Sbjct  56   PWSTGLCDCCEDPANCCITCWCPCITFGQIAEIADRGITSCGVSGSLYGLMLLIVGCACC  115

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY L ++PC DCLVH FCE CALCQEYREL
Sbjct  116  YSCFYRSKLRSQYNLSKSPCADCLVHFFCEGCALCQEYREL  156



>ref|XP_003611770.1| hypothetical protein MTR_5g017650 [Medicago truncatula]
 gb|AES94728.1| plant cadmium resistance protein [Medicago truncatula]
Length=193

 Score =   157 bits (396),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = +2

Query  263  WSTGLCDC---FSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFP  433
            WSTGLCDC    SDPR  CIT WCPCITFGQ+AEI+DKGS SCG +GALYT++ CV G P
Sbjct  52   WSTGLCDCCSASSDPRKSCITFWCPCITFGQVAEIIDKGSTSCGASGALYTLICCVIGCP  111

Query  434  CCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C YSCFYRSKMR+QY LK   C DCL+HC CE+CALCQEYREL
Sbjct  112  CLYSCFYRSKMRQQYGLKGNDCTDCLIHCCCEACALCQEYREL  154



>ref|XP_002284811.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Vitis vinifera]
Length=165

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            QV+P  + PWSTGLCDCFSD  NCC+T WCPC+TFG+IAEIVD GS+SC +NG LYT++A
Sbjct  21   QVQPGAKVPWSTGLCDCFSDVPNCCMTFWCPCVTFGRIAEIVDSGSSSCALNGLLYTLVA  80

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              TG  C  SCF RSKMR+QY L+   C DCL H FCE+CALCQEYREL
Sbjct  81   FTTGCACLCSCFNRSKMRKQYKLEGNDCKDCLAHYFCEACALCQEYREL  129



>gb|AFK33509.1| unknown [Medicago truncatula]
Length=193

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 76/103 (74%), Positives = 84/103 (82%), Gaps = 3/103 (3%)
 Frame = +2

Query  263  WSTGLCDC---FSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFP  433
            WSTGLCDC    SDPR  CIT WCPCITFGQ+AEI+DKGS SCG +GALYT++ CV G P
Sbjct  52   WSTGLCDCCSASSDPRKSCITFWCPCITFGQVAEIIDKGSTSCGASGALYTLICCVIGCP  111

Query  434  CCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C YSCFYRSKMR+QY LK   C DCL+HC CE+CALCQEYREL
Sbjct  112  CLYSCFYRSKMRQQYGLKGNDCTDCLIHCCCEACALCQEYREL  154



>ref|XP_002529141.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF33254.1| conserved hypothetical protein [Ricinus communis]
Length=199

 Score =   156 bits (394),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 85/100 (85%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF D R+CC+T WCPCITFG+IAE+ D+GS +CGV+GALYT++ C+TG  C Y
Sbjct  66   WSTGLCGCFEDVRSCCLTCWCPCITFGRIAEMADRGSTACGVSGALYTLILCLTGCSCLY  125

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSK+R Q+ L+E+PC DC VHCFCE CALCQEYREL
Sbjct  126  SCFYRSKLRGQFFLEESPCTDCCVHCFCEECALCQEYREL  165



>ref|XP_002892834.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH69093.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=152

 Score =   154 bits (390),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 83/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCFSD +NCCIT WCPCITFGQIA+IVD+G+ +CG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCFSDCKNCCITFWCPCITFGQIADIVDRGATTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VTG  C YSCFYR KMR QY ++   CGDCL H  CE CAL Q+YREL
Sbjct  63   ALITAVTGCGCIYSCFYRQKMRAQYNIRGDDCGDCLKHFCCELCALTQQYREL  115



>ref|XP_011015518.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 11-like [Populus 
euphratica]
Length=200

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            GPWST LC CFSD  +CC+T WCPC+ FG+IAEIVD+GS SCG++G LYT++ C+TG  C
Sbjct  65   GPWSTSLCGCFSDLNSCCLTCWCPCVAFGRIAEIVDRGSTSCGMSGTLYTLILCLTGCSC  124

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSCFYRSK+R Q+ L+E+PC DC VHCFCE CALCQEYREL
Sbjct  125  LYSCFYRSKLRGQFFLEESPCTDCCVHCFCEECALCQEYREL  166



>ref|XP_002315950.2| hypothetical protein POPTR_0010s13780g [Populus trichocarpa]
 gb|EEF02121.2| hypothetical protein POPTR_0010s13780g [Populus trichocarpa]
Length=200

 Score =   156 bits (394),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 85/102 (83%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            GPWST LC CFSD  +CC+T WCPC+ FG+IAEIVD+GS SCG++G LYT++ C+TG  C
Sbjct  65   GPWSTSLCGCFSDLNSCCLTCWCPCVAFGRIAEIVDRGSTSCGMSGTLYTLILCLTGCSC  124

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSCFYRSK+R Q+ L+E+PC DC VHCFCE CALCQEYREL
Sbjct  125  LYSCFYRSKLRGQFFLEESPCTDCCVHCFCEECALCQEYREL  166



>ref|XP_004503374.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 11-like [Cicer arietinum]
Length=178

 Score =   155 bits (392),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  248  KIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTG  427
            K    WSTGL DCFSD ++CCIT WCPCITFG+IAEIVDKG+ SCGV+G LYT++ C TG
Sbjct  38   KAHQDWSTGLFDCFSDIQSCCITCWCPCITFGRIAEIVDKGTTSCGVSGGLYTLICCFTG  97

Query  428  FPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              C YSC YRSKMR +YMLK+TPC DCLVH  CESCALCQEYREL
Sbjct  98   CGCLYSCIYRSKMRHEYMLKDTPCCDCLVHYCCESCALCQEYREL  142



>ref|XP_010916802.1| PREDICTED: cell number regulator 2-like [Elaeis guineensis]
Length=187

 Score =   155 bits (393),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
             LQV+ K+  PWSTGL DC  D  NCC+T +CPC+TFGQ+AEIVD+GS SC  +GALY +
Sbjct  45   TLQVQSKLPTPWSTGLFDCCDDVGNCCVTCFCPCVTFGQVAEIVDQGSISCAASGALYAL  104

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + CVTG  C YSCFYRSKMR Q+ L+E+PC DCLVHC CE CALCQEYREL
Sbjct  105  IFCVTGCNCLYSCFYRSKMRGQFFLEESPCADCLVHCCCEMCALCQEYREL  155



>ref|XP_010090019.1| hypothetical protein L484_027249 [Morus notabilis]
 gb|EXB38816.1| hypothetical protein L484_027249 [Morus notabilis]
Length=145

 Score =   154 bits (389),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 86/102 (84%), Gaps = 1/102 (1%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            GPWSTGLCDCFSD ++CC+T WCPC+TFG+IAEIVD+G+ SC  +GALY +L  V G  C
Sbjct  8    GPWSTGLCDCFSDCKSCCLTYWCPCVTFGRIAEIVDEGATSCVASGALYLLLVWV-GVVC  66

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            CYSC YRSK+R +Y L+E+PCGDCLVHCFC  CALCQEYREL
Sbjct  67   CYSCTYRSKIRRRYALEESPCGDCLVHCFCGLCALCQEYREL  108



>ref|XP_009148875.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Brassica 
rapa]
 emb|CDY45296.1| BnaA06g09660D [Brassica napus]
Length=151

 Score =   154 bits (389),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  +P+  G WSTG CDCFSD  NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AKHLHGQPQAEGEWSTGFCDCFSDCGNCCITCWCPCITFGQVAEIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T+++  TG  C YSCFYR KMR QY +    CGDCL H FCE CAL Q+YREL
Sbjct  63   TLISFFTGCGCLYSCFYRGKMRAQYNIGGNDCGDCLKHFFCELCALTQQYREL  115



>ref|XP_004228721.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Solanum lycopersicum]
Length=164

 Score =   154 bits (390),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 75/109 (69%), Positives = 88/109 (81%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            Q +    G WSTGLCDCFSD  +CC+T WCPCITFGQIAEIVDKG+ SCG +GALY ++ 
Sbjct  22   QFQANHPGNWSTGLCDCFSDISSCCLTCWCPCITFGQIAEIVDKGTVSCGASGALYFLIE  81

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +TG  C YSCFYR+KMR+QYML E+PCGDCL+H  CE CALCQE+REL
Sbjct  82   ALTGCGCIYSCFYRTKMRKQYMLPESPCGDCLLHFCCECCALCQEHREL  130



>emb|CBI26855.3| unnamed protein product [Vitis vinifera]
Length=223

 Score =   156 bits (395),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            QV+P  + PWSTGLCDCFSD  NCC+T WCPC+TFG+IAEIVD GS+SC +NG LYT++A
Sbjct  79   QVQPGAKVPWSTGLCDCFSDVPNCCMTFWCPCVTFGRIAEIVDSGSSSCALNGLLYTLVA  138

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              TG  C  SCF RSKMR+QY L+   C DCL H FCE+CALCQEYREL
Sbjct  139  FTTGCACLCSCFNRSKMRKQYKLEGNDCKDCLAHYFCEACALCQEYREL  187



>gb|KFK40702.1| hypothetical protein AALP_AA2G030200 [Arabis alpina]
Length=151

 Score =   154 bits (388),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  K      WSTG CDCFSD +NCCIT WCPCITFGQ+A+IVD+G+ SCG  GALY
Sbjct  3    AQHLHAKHGTEEEWSTGFCDCFSDCKNCCITCWCPCITFGQVADIVDQGTTSCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L+ +TG  C YSCFYR KMR QY L+ + CGDCL H FCE CAL Q+YREL
Sbjct  63   ALLSALTGCGCIYSCFYRQKMRAQYNLRGSDCGDCLKHFFCEVCALTQQYREL  115



>ref|XP_010266790.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=192

 Score =   155 bits (392),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 88/112 (79%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P    + + + PWSTGLCDC  D   CCIT WCPCITF QI+EI+DKG++SCG+NGA+YT
Sbjct  47   PAFPTQTQRQVPWSTGLCDCCDDVPLCCITCWCPCITFAQISEIIDKGTSSCGMNGAIYT  106

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            I+A  TG  C YSCFYR+K+R QY L+E+PCGDC VH  CESCALCQEYREL
Sbjct  107  IIAYFTGCACLYSCFYRTKLRHQYSLQESPCGDCFVHFCCESCALCQEYREL  158



>ref|NP_001236652.1| uncharacterized protein LOC100306298 [Glycine max]
 gb|ACU14415.1| unknown [Glycine max]
Length=186

 Score =   155 bits (391),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDCFS+  NCC+T WCPC+TFG++AEIVDKGS SCG +GALYT++ CV G  C Y
Sbjct  49   WSTGLCDCFSECGNCCMTCWCPCVTFGRVAEIVDKGSTSCGASGALYTLICCVIGCGCLY  108

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR KMR QY LK   C DCL+HCFCE CALCQEYREL
Sbjct  109  SCFYRPKMRRQYGLKGNGCSDCLIHCFCEPCALCQEYREL  148



>ref|XP_006448197.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61437.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=150

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 87/109 (80%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
             V   + GPWS+GLCDCFSD   CC+T WCPCITFG+IA+IVDKGS+SC V+GAL+ +++
Sbjct  31   NVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLVIS  90

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             VTG  C YS  YRSKMR+QYMLK  PCGDCLVH  CE+CAL QEYREL
Sbjct  91   LVTGCGCLYSACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEYREL  139



>ref|XP_010090017.1| hypothetical protein L484_027247 [Morus notabilis]
 gb|EXB38814.1| hypothetical protein L484_027247 [Morus notabilis]
Length=145

 Score =   153 bits (387),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 73/102 (72%), Positives = 85/102 (83%), Gaps = 1/102 (1%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            GPWSTGLCDCFSD  +CC+T WCPC+TFGQIAEIVD+G+ SC  +GALY +L    G  C
Sbjct  8    GPWSTGLCDCFSDWESCCLTYWCPCVTFGQIAEIVDEGATSCVASGALYLLLL-WAGVVC  66

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            CYSC YRSK+R++Y L+E+PCGDCLVHCFC  CALCQEYREL
Sbjct  67   CYSCTYRSKIRKKYGLEESPCGDCLVHCFCGLCALCQEYREL  108



>gb|AEZ52398.1| hypothetical protein, partial [Wolffia australiana]
Length=165

 Score =   154 bits (388),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  Q +   RG W+TGLCDC  D  NCCIT WCPCITFGQIAEIVD+GS SCG +GA+Y 
Sbjct  20   PLAQTQAVPRGKWTTGLCDCGDDVGNCCITCWCPCITFGQIAEIVDRGSTSCGASGAIYA  79

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++A VTG  C YSCFYR ++R QY L E PC DC VHCFCE C+LCQ YREL
Sbjct  80   LVAVVTGCACIYSCFYRKRLRLQYDLPEKPCADCCVHCFCELCSLCQAYREL  131



>ref|XP_010932615.1| PREDICTED: cell number regulator 2-like [Elaeis guineensis]
Length=182

 Score =   154 bits (390),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 86/111 (77%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
               V  +   PWSTGLC CF D  NCCI+ +CPCITFG+IAEIVDKGS+SCG +GALY +
Sbjct  38   TFHVHSQAPVPWSTGLCHCFDDCSNCCISCFCPCITFGRIAEIVDKGSSSCGASGALYAL  97

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + CVT   C YSCFYR+K+R QY L+ +PC DCLVHCFCE CALCQEYREL
Sbjct  98   IFCVTACSCLYSCFYRTKLRAQYSLRGSPCTDCLVHCFCEPCALCQEYREL  148



>emb|CAN63010.1| hypothetical protein VITISV_005303 [Vitis vinifera]
Length=239

 Score =   156 bits (394),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            QV+P  + PWSTGLCDCFSD  NCC+T WCPC+TFG+IAEIVD GS+SC +NG LYT++A
Sbjct  21   QVQPGAKVPWSTGLCDCFSDVPNCCMTFWCPCVTFGRIAEIVDSGSSSCALNGLLYTLVA  80

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              TG  C  SCF RSKMR+QY L+   C DCL H FCE+CALCQEYREL
Sbjct  81   FTTGCACLCSCFNRSKMRKQYKLEGNDCKDCLAHYFCEACALCQEYREL  129



>emb|CDX81681.1| BnaC08g39200D [Brassica napus]
Length=162

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 84/111 (76%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
             ++ KP+  G WSTG CDC SD  NCC+T WCPC+ FGQIAEIVD+GS+SCG  GALY +
Sbjct  2    EVEGKPQADGEWSTGFCDCLSDCSNCCMTFWCPCVIFGQIAEIVDQGSSSCGTTGALYML  61

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LA  TG  C YSCFYR+KMR+QY LK + CGDCL H FCE CAL Q YREL
Sbjct  62   LAWFTGCGCIYSCFYRTKMRKQYNLKGSECGDCLKHFFCELCALTQAYREL  112



>ref|XP_002527777.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF34587.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score =   154 bits (389),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/102 (73%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G WS+GLC C SD +NCCIT WCPCITFGQIAEI DKG+ SC  +GA+Y ILA  TG  C
Sbjct  52   GAWSSGLCGCCSDVKNCCITCWCPCITFGQIAEIADKGTTSCATSGAIYGILAWFTGCGC  111

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSC YRSK+R+QYML E+PC DCLVHC CE+CALCQEYREL
Sbjct  112  IYSCLYRSKLRQQYMLPESPCNDCLVHCCCEACALCQEYREL  153



>ref|XP_006448196.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
 gb|ESR61436.1| hypothetical protein CICLE_v10016920mg [Citrus clementina]
Length=176

 Score =   153 bits (387),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 74/111 (67%), Positives = 88/111 (79%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +  V   + GPWS+GLCDCFSD   CC+T WCPCITFG+IA+IVDKGS+SC V+GAL+ +
Sbjct  29   HANVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLV  88

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ VTG  C YS  YRSKMR+QYMLK  PCGDCLVH  CE+CAL QEYREL
Sbjct  89   ISLVTGCGCLYSACYRSKMRQQYMLKGGPCGDCLVHFCCETCALSQEYREL  139



>ref|XP_003524373.1| PREDICTED: cell number regulator 2-like [Glycine max]
 gb|KHN21586.1| Protein PLANT CADMIUM RESISTANCE 2 [Glycine soja]
Length=175

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 73/100 (73%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGL DCFS+ +NCCIT WCPCITFG++AEIVD+GS SCG +GALYT++ C+ G    Y
Sbjct  39   WSTGLFDCFSNFKNCCITCWCPCITFGRVAEIVDQGSTSCGASGALYTMICCLIGCGWIY  98

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+KMR QYMLKE+PC DCL HC CE CALCQEYREL
Sbjct  99   SCFYRTKMRRQYMLKESPCWDCLTHCCCEPCALCQEYREL  138



>ref|XP_007160405.1| hypothetical protein PHAVU_002G319100g [Phaseolus vulgaris]
 gb|ESW32399.1| hypothetical protein PHAVU_002G319100g [Phaseolus vulgaris]
Length=189

 Score =   153 bits (387),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 75/100 (75%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDCFSD  NCCITLWCPCITFG++AEIVD+GS+SCG +GALYT++ CVT   C Y
Sbjct  52   WSTGLCDCFSDCGNCCITLWCPCITFGRLAEIVDRGSSSCGASGALYTLVCCVTCCACLY  111

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR Q+ LK   C DCL+HC CE CALCQEYREL
Sbjct  112  SCFYRSKMRRQHGLKGNGCTDCLIHCCCEPCALCQEYREL  151



>ref|XP_006448200.1| hypothetical protein CICLE_v10016918mg [Citrus clementina]
 gb|ESR61440.1| hypothetical protein CICLE_v10016918mg [Citrus clementina]
Length=176

 Score =   153 bits (386),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 90/109 (83%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
             V     GPWS+GLCDC SD   CC+T WCPCITFG+IAEIVDKGS+SCGVNGALY I+A
Sbjct  31   HVHQPTVGPWSSGLCDCCSDCSTCCLTYWCPCITFGRIAEIVDKGSSSCGVNGALYFIIA  90

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +TG  C YSC YRSKMR QYMLK++PCGDCLVH FCESCALCQEYREL
Sbjct  91   WLTGCACLYSCGYRSKMRHQYMLKDSPCGDCLVHFFCESCALCQEYREL  139



>gb|KDO38128.1| hypothetical protein CISIN_1g031916mg [Citrus sinensis]
Length=150

 Score =   152 bits (383),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +  V   + GPWS+GLCDCFSD   CC+T WCPCITFG+IA+IVDKGS+SC V+GALY +
Sbjct  29   HANVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALYLV  88

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ VTG  C YS  YRSKMR+QYMLK  PCGDCL H  C++CAL QEYREL
Sbjct  89   ISLVTGCGCLYSSCYRSKMRQQYMLKGGPCGDCLAHFCCDTCALSQEYREL  139



>emb|CBI26856.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   152 bits (384),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I+    ++P    PWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SC  +GA+
Sbjct  7    ISSTGGLQPGTEVPWSTGLCDCFSDVTNCCITCWCPCITFGQIAEIVDKGTVSCFASGAI  66

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  L   T   C +SC YR+K+R+Q MLKE+PCGDCLVH  CE+C+LCQEYREL
Sbjct  67   YAALTYFTTCACLFSCSYRTKLRKQLMLKESPCGDCLVHFCCETCSLCQEYREL  120



>gb|AFK36376.1| unknown [Lotus japonicus]
Length=187

 Score =   153 bits (386),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDCFS+  NCC+T WCPC+TFG++AEIVDKGS SCG +GALYT++ C+ G  C Y
Sbjct  51   WSTGLCDCFSNCGNCCMTCWCPCVTFGRVAEIVDKGSTSCGASGALYTLITCLIGCGCLY  110

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR KMR Q+ LK   C DCL HCFCESC+LCQEYREL
Sbjct  111  SCFYRGKMRSQHHLKGNDCLDCLTHCFCESCSLCQEYREL  150



>ref|XP_004298512.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=196

 Score =   153 bits (387),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 73/112 (65%), Positives = 84/112 (75%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P     P I  PW +G+C CFSD  +CC+T +CPCITFGQIAEIVDKGS SC V+G +YT
Sbjct  47   PYHHFPPPIPEPWKSGICGCFSDMNSCCLTFFCPCITFGQIAEIVDKGSISCAVSGVIYT  106

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             + C+TG  C YSC YRSK+R QY L+E PC DC VH FCESCALCQEYREL
Sbjct  107  AIYCLTGCACIYSCLYRSKLRHQYYLEEKPCYDCFVHFFCESCALCQEYREL  158



>ref|XP_009764643.1| PREDICTED: cell number regulator 2-like [Nicotiana sylvestris]
Length=180

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +2

Query  224  APNLQVKPKIRG--PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            A  + V P      PWSTGLC CF DP NC +T  CPCITFGQI+EIV+KG+ SC  +GA
Sbjct  33   AAGMPVHPSATATAPWSTGLCHCFDDPANCLVTCVCPCITFGQISEIVNKGTTSCAASGA  92

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LY +L  +TG P  YSCFYRS+MR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  93   LYGVLLGLTGLPSLYSCFYRSRMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  147



>ref|XP_009594388.1| PREDICTED: cell number regulator 2-like [Nicotiana tomentosiformis]
Length=180

 Score =   152 bits (385),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 84/115 (73%), Gaps = 2/115 (2%)
 Frame = +2

Query  224  APNLQVKPKIRG--PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            A  + V P      PWSTGLC CF DP NC +T  CPCITFGQI+EIV+KG+ SC  +GA
Sbjct  33   AAGMPVHPSATATAPWSTGLCHCFDDPANCLVTCVCPCITFGQISEIVNKGTTSCAASGA  92

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LY +L  +TG P  YSCFYRS+MR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  93   LYGVLLGLTGLPSLYSCFYRSRMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  147



>ref|XP_006469221.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Citrus sinensis]
Length=176

 Score =   152 bits (384),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 87/111 (78%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            +  V   + GPWS+GLCDCFSD   CC+T WCPCITFG+IA+IVDKGS+SC V+GAL+ +
Sbjct  29   HANVHQLVEGPWSSGLCDCFSDCSTCCLTCWCPCITFGRIADIVDKGSSSCSVSGALFLV  88

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ VTG  C YS  YRSKMR+QYMLK  PCGDCL H  CE+CAL QEYREL
Sbjct  89   ISLVTGCGCLYSACYRSKMRQQYMLKGGPCGDCLAHFCCETCALSQEYREL  139



>ref|XP_002281081.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Vitis vinifera]
Length=180

 Score =   152 bits (383),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I+    ++P    PWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SC  +GA+
Sbjct  33   ISSTGGLQPGTEVPWSTGLCDCFSDVTNCCITCWCPCITFGQIAEIVDKGTVSCFASGAI  92

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  L   T   C +SC YR+K+R+Q MLKE+PCGDCLVH  CE+C+LCQEYREL
Sbjct  93   YAALTYFTTCACLFSCSYRTKLRKQLMLKESPCGDCLVHFCCETCSLCQEYREL  146



>gb|AFK38344.1| unknown [Medicago truncatula]
Length=172

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDC SDP   CITL CPCITFGQ+AEI+DKGS SCG +GALYT++ CV G  C Y
Sbjct  52   WSTGLCDCCSDPGKSCITLCCPCITFGQVAEIIDKGSTSCGASGALYTLICCVIGCGCLY  111

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR+QY LK   C DCL+HC CE+CALCQEYREL
Sbjct  112  SCFYRSKMRQQYGLKGNDCTDCLIHCCCEACALCQEYREL  151



>ref|XP_010066585.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW64518.1| hypothetical protein EUGRSUZ_G02119 [Eucalyptus grandis]
Length=195

 Score =   152 bits (384),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/110 (65%), Positives = 85/110 (77%), Gaps = 0/110 (0%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
            LQ +P    PWS+GL  CF D   CC++ WCPCITFG+IAEI D GS SC V+GA+YT++
Sbjct  52   LQARPINNMPWSSGLFSCFDDVPTCCLSFWCPCITFGRIAEIADHGSVSCPVHGAVYTVI  111

Query  413  ACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            A +TG  CCYSCFYR+KMR+QY L+E PC DCLVH  CESCAL QEYREL
Sbjct  112  ALLTGCACCYSCFYRTKMRQQYQLQEDPCADCLVHFCCESCALTQEYREL  161



>ref|XP_010102839.1| hypothetical protein L484_007862 [Morus notabilis]
 gb|EXB94199.1| hypothetical protein L484_007862 [Morus notabilis]
Length=233

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/101 (71%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGL DC  D   CC+T WCPC+TFG+IAEIVD+GS  CGV GALYT++ CVTG  C 
Sbjct  56   PWSTGLSDCCDDVGTCCLTCWCPCVTFGRIAEIVDQGSTPCGVGGALYTLIMCVTGCSCM  115

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY L+E PC DC +HCFCE CALCQEYREL
Sbjct  116  YSCFYRSKLRGQYFLEERPCTDCCIHCFCEGCALCQEYREL  156



>ref|XP_003630909.1| Fruit weight 2.2-like protein [Medicago truncatula]
 gb|AET05385.1| plant cadmium resistance protein [Medicago truncatula]
 gb|AFK44973.1| unknown [Medicago truncatula]
Length=191

 Score =   152 bits (383),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 74/100 (74%), Positives = 82/100 (82%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDC SDP   CITL CPCITFGQ+AEI+DKGS SCG +GALYT++ CV G  C Y
Sbjct  52   WSTGLCDCCSDPGKSCITLCCPCITFGQVAEIIDKGSTSCGASGALYTLICCVIGCGCLY  111

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR+QY LK   C DCL+HC CE+CALCQEYREL
Sbjct  112  SCFYRSKMRQQYGLKGNDCTDCLIHCCCEACALCQEYREL  151



>ref|XP_006469220.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Citrus sinensis]
Length=176

 Score =   151 bits (382),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 81/109 (74%), Positives = 89/109 (82%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
             V     GPWS+GLCDC SD   CC+T WCPCITFG+IAE VDKGS+SCGVNGALY I+A
Sbjct  31   HVHQPTVGPWSSGLCDCCSDCSTCCLTYWCPCITFGRIAETVDKGSSSCGVNGALYFIIA  90

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +TG  C YSC YRSKMR QYMLK++PCGDCLVH FCESCALCQEYREL
Sbjct  91   WLTGCACLYSCGYRSKMRHQYMLKDSPCGDCLVHFFCESCALCQEYREL  139



>gb|KHG21402.1| plant cadmium resistance 2 -like protein [Gossypium arboreum]
Length=220

 Score =   152 bits (384),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 85/108 (79%), Gaps = 0/108 (0%)
 Frame = +2

Query  239  VKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILAC  418
             +P    PWSTGLCDC SD  +CC+T WCPCITFGQIAEIVD GS  CGV+GALY ++  
Sbjct  76   TQPPRNVPWSTGLCDCCSDLPSCCLTCWCPCITFGQIAEIVDHGSTPCGVSGALYALIGI  135

Query  419  VTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +TG PC YSCFYRS+MR +YML++ PC DC +H  CE+CALCQEYREL
Sbjct  136  LTGCPCIYSCFYRSRMRSEYMLEDRPCNDCCLHFCCEACALCQEYREL  183



>ref|XP_010476562.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Camelina sativa]
Length=151

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 72/113 (64%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCF+D  NCCIT WCPCITFGQ+AEIVD+GS SCG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCFTDCPNCCITFWCPCITFGQVAEIVDQGSTSCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  V G  C YSCFYR KMR QY +    CGDCL H  CE CAL Q+YREL
Sbjct  63   ALITAVIGCGCMYSCFYRKKMRAQYNIGGDDCGDCLKHFCCELCALTQQYREL  115



>emb|CBI26857.3| unnamed protein product [Vitis vinifera]
Length=154

 Score =   150 bits (378),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I+    ++P    PWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SC  +GA+
Sbjct  7    ISSTGSLQPGTEVPWSTGLCDCFSDVTNCCITCWCPCITFGQIAEIVDKGTVSCFASGAI  66

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  LA  T   C +SC YR+K+R+Q MLKE+PC DCLVH  CE C+LCQEYREL
Sbjct  67   YAALAYFTTCACLFSCSYRTKLRKQLMLKESPCEDCLVHFCCEPCSLCQEYREL  120



>ref|XP_010271281.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=196

 Score =   151 bits (382),  Expect = 4e-42, Method: Compositional matrix adjust.
 Identities = 74/112 (66%), Positives = 87/112 (78%), Gaps = 0/112 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  Q +P+ + PWSTGLCDC +D  NCCIT WCPCITFGQIAEIVDKGS  CG++GA+Y 
Sbjct  52   PVYQTQPQAQTPWSTGLCDCCADVPNCCITCWCPCITFGQIAEIVDKGSLPCGMSGAIYA  111

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             L   T   C YSC YR+K+R+QY L+ +PCGDCLVH  CE+CALCQEYREL
Sbjct  112  FLNWFTCCACMYSCIYRAKLRQQYSLQSSPCGDCLVHFCCETCALCQEYREL  163



>ref|XP_009387442.1| PREDICTED: cell number regulator 2-like [Musa acuminata subsp. 
malaccensis]
Length=184

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 84/109 (77%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            + +P +  PWSTGL DC  D  NCC+T +CPCITFGQIAEIVD GS  CG +GALY ++ 
Sbjct  43   RAQPPLPAPWSTGLFDCCDDVGNCCVTCFCPCITFGQIAEIVDGGSVPCGASGALYALMF  102

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            CVTG  C YSCFYRSKMR Q  L+E+PC DC VHC CESCALCQEYREL
Sbjct  103  CVTGCACLYSCFYRSKMRGQLFLEESPCADCAVHCCCESCALCQEYREL  151



>gb|KJB12053.1| hypothetical protein B456_002G174700 [Gossypium raimondii]
Length=182

 Score =   150 bits (380),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/108 (67%), Positives = 84/108 (78%), Gaps = 0/108 (0%)
 Frame = +2

Query  239  VKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILAC  418
             +P    PWSTGLCDC SD  NCC+T WCPCITFG+IAEIVD GS SCGV GALY ++  
Sbjct  38   TQPPRNVPWSTGLCDCCSDLPNCCLTCWCPCITFGRIAEIVDHGSTSCGVGGALYALIGI  97

Query  419  VTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +TG PC YSC YRS+MR +YML++ PC DC +H  CE+CALCQEYREL
Sbjct  98   LTGCPCIYSCVYRSRMRSEYMLEDRPCNDCCLHFCCEACALCQEYREL  145



>ref|XP_010496599.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Camelina 
sativa]
Length=151

 Score =   149 bits (377),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCFSD  NCCIT WCPCITFGQ+AEIVD+GS +CG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCFSDCSNCCITCWCPCITFGQVAEIVDRGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  + G  C YSCFYR KMR QY +    CGDCL H  CE CAL Q+YREL
Sbjct  63   ALITAIIGCGCIYSCFYRKKMRAQYNIGGDDCGDCLKHFCCELCALTQQYREL  115



>ref|XP_006291991.1| hypothetical protein CARUB_v10018179mg [Capsella rubella]
 gb|EOA24889.1| hypothetical protein CARUB_v10018179mg [Capsella rubella]
Length=152

 Score =   149 bits (376),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 70/113 (62%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG  DCFSD  NCCIT WCPCITFGQ+AEIVD+G+ +CG  GALY
Sbjct  3    AQHLHGKPHAEGEWSTGFFDCFSDCSNCCITFWCPCITFGQVAEIVDQGATTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VTG  C YSCFYR K+R QY +    CGDCL H  CE CAL Q+YREL
Sbjct  63   ALITAVTGGGCIYSCFYRKKIRAQYNISGNACGDCLKHFCCELCALTQQYREL  115



>ref|XP_002311519.2| hypothetical protein POPTR_0008s13210g [Populus trichocarpa]
 gb|EEE88886.2| hypothetical protein POPTR_0008s13210g [Populus trichocarpa]
Length=180

 Score =   150 bits (379),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/102 (70%), Positives = 83/102 (81%), Gaps = 0/102 (0%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G WS+GLCDCFSD  NCCIT WCPCITFG+IAEIVDKG+ SC V+GA+Y +L   TG PC
Sbjct  54   GRWSSGLCDCFSDIPNCCITCWCPCITFGRIAEIVDKGTTSCAVSGAIYGVLLWFTGCPC  113

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSC YR+KMR+Q M ++ PC DCLVH  C++CALCQEYREL
Sbjct  114  IYSCLYRNKMRKQLMFEDRPCNDCLVHFCCDACALCQEYREL  155



>gb|AEA08581.1| fw2.2 [Arachis stenosperma]
Length=184

 Score =   150 bits (379),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WST LCDCFSD  NCCIT WCPC+TFG++AEIVD+GS SCG +GALY ++ C+ G  C Y
Sbjct  47   WSTSLCDCFSDCGNCCITYWCPCVTFGRVAEIVDRGSTSCGASGALYALVCCLIGCGCLY  106

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR Q  LK + CGDC++HC CE CALCQEYREL
Sbjct  107  SCFYRSKMRRQLNLKGSDCGDCMIHCCCEPCALCQEYREL  146



>ref|XP_006304281.1| hypothetical protein CARUB_v10010549mg [Capsella rubella]
 gb|EOA37179.1| hypothetical protein CARUB_v10010549mg [Capsella rubella]
Length=152

 Score =   149 bits (376),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCFSD  NCCIT WCPCITFGQ+AEIVD+G+ +CG  GALY
Sbjct  3    AQHLHGKPHAEGEWSTGFCDCFSDFPNCCITFWCPCITFGQVAEIVDQGATTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  VT   C YSCFYR KMR QY +    CGDCL H  CE CAL Q+YREL
Sbjct  63   ALIMAVTSCACMYSCFYRKKMRAQYNIGGDDCGDCLKHFCCELCALTQQYREL  115



>ref|XP_002281061.2| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Vitis vinifera]
Length=180

 Score =   150 bits (378),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 86/114 (75%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I+    ++P    PWSTGLCDCFSD  NCCIT WCPCITFGQIAEIVDKG+ SC  +GA+
Sbjct  33   ISSTGSLQPGTEVPWSTGLCDCFSDVTNCCITCWCPCITFGQIAEIVDKGTVSCFASGAI  92

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  LA  T   C +SC YR+K+R+Q MLKE+PC DCLVH  CE C+LCQEYREL
Sbjct  93   YAALAYFTTCACLFSCSYRTKLRKQLMLKESPCEDCLVHFCCEPCSLCQEYREL  146



>emb|CAN82486.1| hypothetical protein VITISV_006802 [Vitis vinifera]
Length=180

 Score =   150 bits (378),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/85 (82%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +2

Query  308  CITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCYSCFYRSKMREQYMLK  487
            CIT WCPCITFGQIAEIVDKGS++CGVNGALYT++ACVTG  CCYSCFYR+KMR+QY+LK
Sbjct  55   CITCWCPCITFGQIAEIVDKGSSACGVNGALYTLIACVTGCACCYSCFYRAKMRQQYLLK  114

Query  488  ETPCGDCLVHCFCESCALCQEYREL  562
             +PCGDCLVHC CE C+LCQEYREL
Sbjct  115  PSPCGDCLVHCCCEYCSLCQEYREL  139



>ref|XP_007160406.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
 gb|ESW32400.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
Length=171

 Score =   149 bits (377),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 85/109 (78%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
              KP     WSTGLCDCFS+ +NCCIT WCPCITFGQIAE+VDKG+ SCG +GALY+++ 
Sbjct  27   NTKPLPETEWSTGLCDCFSNFKNCCITCWCPCITFGQIAEVVDKGATSCGASGALYSLIY  86

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C+ G  C YSC YR+KMR+QY LK TP  D L HC CE+CALCQE+REL
Sbjct  87   CLLGCGCIYSCVYRTKMRQQYKLKGTPFLDFLTHCCCETCALCQEHREL  135



>ref|XP_004955027.1| PREDICTED: cell number regulator 2-like [Setaria italica]
Length=171

 Score =   148 bits (374),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 73/101 (72%), Positives = 81/101 (80%), Gaps = 1/101 (1%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGL DCF DP NCC+TL  PCITFGQ+AEIVD+GS SCG + ALYT+L   TGF C 
Sbjct  36   PWSTGLFDCFDDPGNCCVTLLFPCITFGQVAEIVDRGSTSCGASAALYTLLT-WTGFHCI  94

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY L+E+PC DC VH  CE CALCQEYREL
Sbjct  95   YSCFYRSKLRAQYGLEESPCADCCVHYCCELCALCQEYREL  135



>gb|ABK95453.1| unknown [Populus trichocarpa]
Length=191

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 87/115 (76%), Gaps = 1/115 (1%)
 Frame = +2

Query  218  HIAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            H  P    +P+  G WS+GLCDCFSD  NCCIT WCPCITFG+IAEIVDKG+  C V+GA
Sbjct  41   HSHPIQHQQPQ-PGRWSSGLCDCFSDIPNCCITCWCPCITFGRIAEIVDKGTTPCAVSGA  99

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             Y +L   TG PC YSC YR+KMR+Q ML++ PC DCLVH  C++CALCQEYREL
Sbjct  100  TYGVLLWFTGCPCIYSCIYRTKMRKQLMLEDRPCNDCLVHFCCDACALCQEYREL  154



>ref|XP_008788458.1| PREDICTED: cell number regulator 2-like [Phoenix dactylifera]
Length=186

 Score =   149 bits (375),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 81/110 (74%), Positives = 89/110 (81%), Gaps = 0/110 (0%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
             QV  +   PWSTGLCDCF D  NCC+T  CPCITFGQIAEI DKGS SCGV+GALY ++
Sbjct  39   FQVHSQEPVPWSTGLCDCFDDCGNCCLTCCCPCITFGQIAEIADKGSTSCGVSGALYALV  98

Query  413  ACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              VTG PC YSCFYRSK+R QY L+E+PC DCLVHCFCESCALCQEYREL
Sbjct  99   MWVTGCPCLYSCFYRSKLRAQYSLQESPCNDCLVHCFCESCALCQEYREL  148



>ref|XP_002868424.1| hypothetical protein ARALYDRAFT_493614 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44683.1| hypothetical protein ARALYDRAFT_493614 [Arabidopsis lyrata subsp. 
lyrata]
Length=154

 Score =   147 bits (372),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 82/113 (73%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDCFSD +NCCIT  CPCITFGQ+A+IVD+G+ SCG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCFSDCKNCCITCLCPCITFGQVADIVDRGTTSCGAAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            T++A +TG    YSCFYR KMR QY ++   C DCL H  CE CAL QEYREL
Sbjct  63   TLIAVITGCGSIYSCFYRGKMRAQYNIRGDGCTDCLKHFCCELCALTQEYREL  115



>ref|XP_011038596.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 3-like [Populus euphratica]
Length=193

 Score =   149 bits (375),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 81/100 (81%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLCDC SD   CC+T WCPCITFG+IAEI DKG+  C V+GA+Y +L C TG  C Y
Sbjct  59   WSSGLCDCCSDVPGCCLTCWCPCITFGRIAEITDKGTTPCAVSGAIYGLLWCFTGCSCLY  118

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRSK+R QYML+E+PC DCLVHC CESCALCQEYREL
Sbjct  119  SCLYRSKLRTQYMLEESPCNDCLVHCCCESCALCQEYREL  158



>gb|KDP42302.1| hypothetical protein JCGZ_01626 [Jatropha curcas]
Length=184

 Score =   148 bits (373),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/107 (67%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            +P   G WSTGLC C  DP NC IT +CPCITFGQIAEI+++GS SC   GA+Y +L   
Sbjct  42   RPGAPGKWSTGLCHCCDDPANCMITCFCPCITFGQIAEILNEGSTSCASRGAVYGLLLAF  101

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TGF C YSCFYRSK+R QY L+E PC DCLVHC CE+CALCQEYREL
Sbjct  102  TGFACLYSCFYRSKLRGQYDLEEAPCVDCLVHCCCETCALCQEYREL  148



>ref|XP_010496606.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Camelina 
sativa]
Length=151

 Score =   147 bits (370),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WS+G CDC SD  N C+  WCPCITFGQ+A+IVD+GS SCG  GALY
Sbjct  3    AQHLHAKPHAEGEWSSGFCDCSSDCPNFCMAFWCPCITFGQVADIVDQGSTSCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  +TG  C YSCFYR KMR QY ++   CGDCL H FCE CAL Q+YREL
Sbjct  63   ALITAITGCGCIYSCFYRKKMRAQYNIRGDDCGDCLKHFFCEPCALTQQYREL  115



>ref|XP_011023881.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Populus euphratica]
Length=191

 Score =   148 bits (374),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 72/109 (66%), Positives = 86/109 (79%), Gaps = 2/109 (2%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            Q +P  R  WS+GLCDCFSD  NCCIT WCPCITFG++AEIVDKG+  C V+GA+Y +L 
Sbjct  48   QQQPPSR--WSSGLCDCFSDIPNCCITCWCPCITFGRVAEIVDKGTTPCAVSGAIYGVLL  105

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              TG PC YSC YR+KMR+Q ML++ PC DCLVH  C++CALCQEYREL
Sbjct  106  WFTGCPCIYSCIYRTKMRKQLMLEDRPCNDCLVHFCCDACALCQEYREL  154



>emb|CAN82483.1| hypothetical protein VITISV_006799 [Vitis vinifera]
Length=1180

 Score =   159 bits (401),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/109 (68%), Positives = 86/109 (79%), Gaps = 0/109 (0%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            QV+P  + PWSTGLCDCFSD  NCC+T WCPC+TFG+IAEIVD GS+SC +NG LYT++A
Sbjct  21   QVQPGAKVPWSTGLCDCFSDVPNCCMTFWCPCVTFGRIAEIVDSGSSSCALNGLLYTLVA  80

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              TG  C  SCF RSKMR+QY L+   C DCL H FCE+CALCQEYREL
Sbjct  81   FTTGCACLCSCFNRSKMRKQYKLEGNDCKDCLAHYFCEACALCQEYREL  129



>ref|NP_001173699.1| Os03g0830401 [Oryza sativa Japonica Group]
 gb|AAO39872.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP46224.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99697.1| PGPS/D12, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAH92427.1| Os03g0830401 [Oryza sativa Japonica Group]
Length=148

 Score =   146 bits (369),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 71/106 (67%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P     WS+GL DCF D   CC+T WCPCITFG++AEIVD+GS SCG +GALY +LA VT
Sbjct  13   PVGSAAWSSGLFDCFDDCGLCCMTCWCPCITFGRVAEIVDRGSTSCGASGALYALLAMVT  72

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G  C YSC YR KMR QY L +  CGDC VHC+CESCALCQEYREL
Sbjct  73   GCQCIYSCTYRGKMRAQYGLADAACGDCCVHCWCESCALCQEYREL  118



>gb|KDP38093.1| hypothetical protein JCGZ_04736 [Jatropha curcas]
Length=178

 Score =   147 bits (371),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 71/112 (63%), Positives = 85/112 (76%), Gaps = 2/112 (2%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  Q      GPWS+GL DC SD +NCCIT WCPCITFGQIAEIVDKG+  C  +GA+Y 
Sbjct  31   PLHQSHQGREGPWSSGLFDCRSDVKNCCITCWCPCITFGQIAEIVDKGTIGCKTSGAIYC  90

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +++C+ G    +SC YR+K+R Q+ML+E PC DCLVH FCESCALCQEYREL
Sbjct  91   VVSCLIG--SVHSCIYRTKLRHQFMLEEKPCNDCLVHYFCESCALCQEYREL  140



>ref|NP_001235158.1| uncharacterized protein LOC100527373 [Glycine max]
 gb|ACU16462.1| unknown [Glycine max]
Length=175

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 76/109 (70%), Positives = 86/109 (79%), Gaps = 6/109 (6%)
 Frame = +2

Query  236  QVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILA  415
            Q KP +   WSTGLCDCFSD  NCCIT WCPC+TFG++AEIVD+GS SCG +GALYT++ 
Sbjct  35   QSKPTVD--WSTGLCDCFSDCGNCCITWWCPCVTFGRVAEIVDRGSTSCGASGALYTLVC  92

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C  G+P  YSC YRSKMR QY LK   C DCL+HC CESCALCQEYREL
Sbjct  93   C--GWP--YSCIYRSKMRRQYGLKGNCCTDCLLHCCCESCALCQEYREL  137



>gb|KJB12057.1| hypothetical protein B456_002G175100 [Gossypium raimondii]
Length=131

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP    PWS G CDCFSD + CC+   CPCI FG+I+EI+DKGS SCG +GA Y ++ C+
Sbjct  6    KPHDEAPWSVGFCDCFSDMKTCCMACLCPCIAFGRISEILDKGSTSCGASGARYILIMCI  65

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TGFP  YSCFYRSK+R+QY LK   CGDC+ H +CE CAL QEYREL
Sbjct  66   TGFPGLYSCFYRSKLRKQYRLKGGCCGDCMRHLYCEICALTQEYREL  112



>ref|XP_003630911.1| hypothetical protein MTR_8g104890 [Medicago truncatula]
 gb|AET05387.1| plant cadmium resistance protein [Medicago truncatula]
Length=169

 Score =   146 bits (368),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 81/111 (73%), Positives = 91/111 (82%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N+  +P     WSTGL DCFSD + CCIT WCPCITFG+IAEIVDKGS SC V+GALYT+
Sbjct  23   NVGHQPNANQEWSTGLFDCFSDCKTCCITYWCPCITFGRIAEIVDKGSTSCAVSGALYTL  82

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + CVTG  C YSC YR+KMR+QYMLK+TPC DCLVHC CESCALCQEYREL
Sbjct  83   ICCVTGCGCLYSCIYRNKMRQQYMLKDTPCCDCLVHCCCESCALCQEYREL  133



>emb|CBI26858.3| unnamed protein product [Vitis vinifera]
Length=183

 Score =   146 bits (369),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP   GPW+TGLCDC SD + CC+T+WCPC+TFGQIAEIVD+G+ SC V   LY I+  +
Sbjct  39   KPGNPGPWNTGLCDCCSDVKTCCLTMWCPCVTFGQIAEIVDRGNTSCFVAATLYAIVG-L  97

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + +  C SCFYR+KMR+Q+ML+++PC DCLVH FCE CALCQE+REL
Sbjct  98   SKWGFCLSCFYRTKMRKQFMLEKSPCDDCLVHWFCEPCALCQEHREL  144



>ref|XP_004232037.1| PREDICTED: cell number regulator 2 [Solanum lycopersicum]
 gb|AAF74286.1|AF261774_1 ORFX [Solanum lycopersicum]
 gb|AAO12185.1| fw2.2 [Solanum lycopersicum]
 gb|AAO12186.1| fw2.2 [Solanum lycopersicum]
 gb|AAO12187.1| fw2.2 [Solanum lycopersicum]
 gb|AAO12188.1| fw2.2 [Solanum lycopersicum]
Length=163

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF DP NC +T  CPCITFGQI+EI++KG+ SCG  GALY +L  +TG P  Y
Sbjct  32   WSTGLCHCFDDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGALYCLLG-LTGLPSLY  90

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  91   SCFYRSKMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  130



>gb|AAF74287.1|AF261775_1 ORFX [Solanum pennellii]
Length=163

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF DP NC +T  CPCITFGQI+EI++KG+ SCG  GALY +L  +TG P  Y
Sbjct  32   WSTGLCHCFDDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGALYCLLG-LTGLPSLY  90

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  91   SCFYRSKMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  130



>gb|AAO12190.1| fw2.2 [Solanum pimpinellifolium]
 gb|AAO12191.1| fw2.2 [Solanum pimpinellifolium]
 gb|AAO12192.1| fw2.2 [Solanum pimpinellifolium]
 gb|AAO12193.1| fw2.2 [Solanum neorickii]
 gb|AAO12194.1| fw2.2 [Solanum peruvianum]
 gb|AAO12195.1| fw2.2 [Solanum habrochaites]
Length=163

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF DP NC +T  CPCITFGQI+EI++KG+ SCG  GALY +L  +TG P  Y
Sbjct  32   WSTGLCHCFDDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGALYCLLG-LTGLPSLY  90

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  91   SCFYRSKMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  130



>gb|AAO12196.1| fw2.2 [Solanum pennellii]
Length=163

 Score =   145 bits (367),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 71/100 (71%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF DP NC +T  CPCITFGQI+EI++KG+ SCG  GALY +L  +TG P  Y
Sbjct  32   WSTGLCHCFDDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGALYCLLG-LTGLPSLY  90

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRSKMR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  91   SCFYRSKMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  130



>ref|XP_010476563.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Camelina 
sativa]
Length=151

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 67/113 (59%), Positives = 80/113 (71%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A +L  KP   G WSTG CDC S+  N C+  WCPCITFGQ+A+IVD+GS +CG  GALY
Sbjct  3    AQHLHAKPHAEGEWSTGFCDCSSNCPNFCMAFWCPCITFGQVADIVDQGSTTCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  +TG  C YSCFYR KMR QY ++   CGDCL H FCE CAL Q+YREL
Sbjct  63   ALITAITGCGCIYSCFYRKKMRAQYNIRGDDCGDCLKHFFCEPCALTQQYREL  115



>ref|XP_003631175.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Vitis vinifera]
Length=149

 Score =   145 bits (366),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 86/107 (80%), Gaps = 1/107 (1%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP   GPW+TGLCDC SD + CC+T+WCPC+TFGQIAEIVD+G+ SC V   LY I+  +
Sbjct  11   KPGNPGPWNTGLCDCCSDVKTCCLTMWCPCVTFGQIAEIVDRGNTSCFVAATLYAIVG-L  69

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + +  C SCFYR+KMR+Q+ML+++PC DCLVH FCE CALCQE+REL
Sbjct  70   SKWGFCLSCFYRTKMRKQFMLEKSPCDDCLVHWFCEPCALCQEHREL  116



>ref|XP_009757579.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nicotiana 
sylvestris]
Length=177

 Score =   146 bits (368),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 85/111 (77%), Gaps = 2/111 (2%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            NL+ +P +  PWSTGL DC  D  +CC+T WCPCITFG++AEIVD+GS S GV+GALY +
Sbjct  35   NLEFRPLV--PWSTGLFDCCQDVHSCCLTCWCPCITFGRVAEIVDRGSTSSGVSGALYLL  92

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            L CVTG  C YSCFYRSK+R QY L E PC D   HC CE+CALCQEYREL
Sbjct  93   LLCVTGCSCLYSCFYRSKLRGQYFLDEIPCTDFCSHCCCETCALCQEYREL  143



>ref|XP_010266903.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=193

 Score =   146 bits (368),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/101 (68%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC +D  NCCIT W PCITFGQ+AEI+DKGS SCG +  +Y ++A  TG  C 
Sbjct  59   PWSTGLCDCCADVANCCITCWFPCITFGQMAEIIDKGSVSCGTSALIYQVMALTTGCACM  118

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYR K+R+QY+L+E+PC DCLVH  CE CALCQEYREL
Sbjct  119  YSCFYRRKLRQQYLLQESPCDDCLVHFCCEPCALCQEYREL  159



>ref|NP_680337.2| PLAC8 family protein [Arabidopsis thaliana]
 sp|P0CW97.1|PCR3_ARATH RecName: Full=Protein PLANT CADMIUM RESISTANCE 3; Short=AtPCR3 
[Arabidopsis thaliana]
 gb|AED93976.1| PLAC8 family protein [Arabidopsis thaliana]
Length=152

 Score =   144 bits (364),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            + +LQ  P   G WSTG CDCFSD +NCCIT  CPCITFGQ+A+IVD+G+ SCG  GALY
Sbjct  3    SQHLQANPHAEGEWSTGFCDCFSDCQNCCITWLCPCITFGQVADIVDRGNTSCGTAGALY  62

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +LA +TG  C YSC YR K+R QY ++   C DCL H  CE CAL QEYREL
Sbjct  63   VLLAAITGCGCLYSCIYRGKIRAQYNIRGDGCTDCLKHFCCELCALTQEYREL  115



>dbj|BAK01385.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=187

 Score =   145 bits (366),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDCF D  NCC+T  CPC+TFGQIAEI+D+GS SCG +GALY ++ C+TG  C Y
Sbjct  53   WSTGLCDCFDDCSNCCVTCLCPCVTFGQIAEIIDRGSTSCGASGALYALIMCLTGCQCVY  112

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+KMR  Y L+E+PC DC +H  CE CALCQEYREL
Sbjct  113  SCFYRAKMRAHYGLQESPCADCCIHWCCEPCALCQEYREL  152



>ref|XP_006648784.1| PREDICTED: cell number regulator 2-like [Oryza brachyantha]
Length=175

 Score =   145 bits (365),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGL DCF D  NCC+T WCPCITFGQ+AEIVD+GS SCG +GALY ++  +TG  C Y
Sbjct  41   WSTGLFDCFDDCHNCCVTWWCPCITFGQVAEIVDRGSTSCGTSGALYALVMLLTGCHCVY  100

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+KMR QY L+E PC DC VH  CE CALCQ YREL
Sbjct  101  SCFYRAKMRAQYGLQERPCADCCVHYCCEPCALCQAYREL  140



>dbj|BAK04959.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=246

 Score =   147 bits (370),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDCF D  NCC+T  CPC+TFGQIAEI+D+GS SCG +GALY ++ C+TG  C Y
Sbjct  112  WSTGLCDCFDDCSNCCVTCLCPCVTFGQIAEIIDRGSTSCGASGALYALIMCLTGCQCVY  171

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+KMR  Y L+E+PC DC +H  CE CALCQEYREL
Sbjct  172  SCFYRAKMRAHYGLQESPCADCCIHWCCEPCALCQEYREL  211



>ref|XP_010044215.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW86261.1| hypothetical protein EUGRSUZ_B02945 [Eucalyptus grandis]
Length=185

 Score =   145 bits (365),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWST LCDCFSD   CCI+ WCPC+TFGQI+EIVD+G++SCG+NGA+Y ++A +TG  CC
Sbjct  45   PWSTDLCDCFSDLERCCISFWCPCVTFGQISEIVDRGASSCGLNGAIYFLIAWLTGCACC  104

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YS FYR KMR+QY +      D L+HC CESCAL QEYREL
Sbjct  105  YSFFYRLKMRKQYRIDGNAAEDFLLHCLCESCALTQEYREL  145



>ref|XP_006378442.1| hypothetical protein POPTR_0010s11930g [Populus trichocarpa]
 gb|ERP56239.1| hypothetical protein POPTR_0010s11930g [Populus trichocarpa]
Length=193

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 80/100 (80%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLCDC SD   CC+T WCPCITFG+IAEI DKG+  C V+GA+Y +L   TG  C Y
Sbjct  59   WSSGLCDCCSDVPGCCLTCWCPCITFGRIAEITDKGTTPCVVSGAIYGLLMWFTGCSCLY  118

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRSK+R QYML+E+PC DCLVHC CESCALCQEYREL
Sbjct  119  SCLYRSKLRTQYMLEESPCNDCLVHCCCESCALCQEYREL  158



>ref|XP_010066591.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW64541.1| hypothetical protein EUGRSUZ_G02147 [Eucalyptus grandis]
Length=202

 Score =   145 bits (365),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  + + +++  WS+GLCDC SD RNCCIT  CPC+TFGQIAEIVDKGS+SCGVNGALYT
Sbjct  52   PTYEERDQVQ--WSSGLCDCLSDRRNCCITCCCPCVTFGQIAEIVDKGSSSCGVNGALYT  109

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ C  G  CCYSCFYR+KMR+QY LK++PC DC VH +CE CALCQEYREL
Sbjct  110  LIFCTVGCSCCYSCFYRAKMRQQYALKKSPCTDCCVHFWCECCALCQEYREL  161



>ref|XP_009410079.1| PREDICTED: cell number regulator 2-like [Musa acuminata subsp. 
malaccensis]
Length=182

 Score =   144 bits (363),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 83/111 (75%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
              Q++    G WSTGLC+C  D  NCCIT +CPCITFGQIAEIVDKG+ SCG +GALY +
Sbjct  39   TFQIQTPAGGAWSTGLCECCDDGSNCCITCFCPCITFGQIAEIVDKGATSCGTSGALYAL  98

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +  VT   C YSCFYRSK+R Q  L+E PC DCLVHC CE+C+LCQ YREL
Sbjct  99   IMYVTCCQCLYSCFYRSKLRAQLGLREEPCADCLVHCCCETCSLCQMYREL  149



>gb|EMT03501.1| hypothetical protein F775_20686 [Aegilops tauschii]
Length=140

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
             WS+GLC CF D   CC+T +CPC+ FG+IAEIVD G+ SC  +G +Y  LA VTG  C 
Sbjct  8    SWSSGLCGCFDDVGGCCLTFFCPCVVFGRIAEIVDMGATSCCASGTVYAALASVTGMGCL  67

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YRS++REQY LKETPCGDC VH FCE+CALCQEYREL
Sbjct  68   YSCGYRSRLREQYRLKETPCGDCCVHWFCEACALCQEYREL  108



>ref|XP_008236516.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Prunus mume]
Length=191

 Score =   144 bits (364),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 71/111 (64%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N Q    +RG WSTGLC CF DP NC IT +CPCITFGQIAEIV +GS SC   G  Y I
Sbjct  47   NTQPSGHVRGSWSTGLCHCFDDPANCMITAFCPCITFGQIAEIVSQGSTSCASQGVCYGI  106

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            L   T   C YSCFYRS++R QY L+E PC DCLVH  C +CALCQEYREL
Sbjct  107  LLATTANACLYSCFYRSRLRGQYDLEEAPCVDCLVHFCCATCALCQEYREL  157



>gb|KDP29383.1| hypothetical protein JCGZ_18304 [Jatropha curcas]
Length=197

 Score =   144 bits (364),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 71/113 (63%), Positives = 86/113 (76%), Gaps = 3/113 (3%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
             PN+   P+    WSTGL DCF+D  +CC+T WCPCITFG+IAEIVD+GS SCGV+GA+Y
Sbjct  54   TPNV---PRTPVAWSTGLWDCFNDINSCCLTWWCPCITFGRIAEIVDRGSTSCGVSGAMY  110

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  +TG  C YSCFYR+K+R QY L+E PC DC VH  CE CALCQEYREL
Sbjct  111  ILIMWLTGCSCIYSCFYRAKLRGQYFLEEKPCPDCCVHYCCEGCALCQEYREL  163



>ref|XP_008447011.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Cucumis melo]
Length=160

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP     WSTGLC C +D   CC+T WCPCITFG+IAE+VD+GS SCGV+GA+Y  + CV
Sbjct  16   KPHSTIGWSTGLCHCCNDISICCLTCWCPCITFGRIAEMVDRGSTSCGVSGAIYLAILCV  75

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG  C YSCFYR++MR Q++LKE P  DC  HC CE CALCQEYREL
Sbjct  76   TGCSCLYSCFYRTRMRGQFLLKERPLSDCCTHCLCEQCALCQEYREL  122



>gb|AAO12189.1| fw2.2 [Solanum cheesmaniae]
Length=163

 Score =   143 bits (361),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC CF DP NC +T  CPCITFGQI+EI++KG+ SCG  GALY +L  +TG P  Y
Sbjct  32   WSTGLCHCFDDPANCLVTSVCPCITFGQISEILNKGTTSCGSRGALYCLLG-LTGLPSLY  90

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR KMR QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  91   SCFYRFKMRGQYDLEEAPCVDCLVHVFCEPCALCQEYREL  130



>ref|XP_007226769.1| hypothetical protein PRUPE_ppa018556mg [Prunus persica]
 gb|EMJ27968.1| hypothetical protein PRUPE_ppa018556mg [Prunus persica]
Length=185

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC+C  D  +CC+T WCPC+TFG+IAEIVD+GS SCGV+G +Y+++ C+ G  C 
Sbjct  44   PWSTGLCNCCEDVSSCCLTCWCPCVTFGRIAEIVDRGSTSCGVSGTIYSLMLCLVGCSCL  103

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY+L+E PC DC VH  CE CALCQEYR+L
Sbjct  104  YSCFYRSKLRGQYLLEERPCTDCCVHFCCEECALCQEYRQL  144



>ref|XP_008243409.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 11 [Prunus mume]
Length=184

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC+C  D  +CC+T WCPC+TFG++AEIVD+GS SCGV+G +Y+++ C+ G  C 
Sbjct  43   PWSTGLCNCCEDVSSCCLTCWCPCVTFGRVAEIVDRGSTSCGVSGTIYSLMLCLVGCSCL  102

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY+L+E PC DC VH  CE CALCQEYR+L
Sbjct  103  YSCFYRSKLRGQYLLEERPCTDCCVHFCCEECALCQEYRQL  143



>ref|XP_004170989.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Cucumis sativus]
Length=159

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP     WSTGLC C +D   CC+T WCPCITFG+IAE+VD+GS SCG++GA+Y  + CV
Sbjct  15   KPHSTVGWSTGLCHCCNDISICCLTCWCPCITFGRIAEMVDRGSTSCGISGAIYLAILCV  74

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG  C YSCFYR++MR Q++L+E P  DC  HC CE CALCQEYREL
Sbjct  75   TGCSCLYSCFYRTRMRGQFLLEERPLSDCCTHCLCEQCALCQEYREL  121



>ref|XP_007160407.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
 gb|ESW32401.1| hypothetical protein PHAVU_002G319200g [Phaseolus vulgaris]
Length=164

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 71/115 (62%), Positives = 83/115 (72%), Gaps = 0/115 (0%)
 Frame = +2

Query  218  HIAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            H  P     P     WSTGL DCFSD +NC IT  CPCITFGQIAE+VDKG+ SCG +GA
Sbjct  14   HNHPAAAASPMPETEWSTGLFDCFSDLKNCFITCLCPCITFGQIAEVVDKGATSCGASGA  73

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LY+++ C+ G  C YSC YR+KMR+QY LK TP  D L HC CE+CALCQE+REL
Sbjct  74   LYSLIYCLLGCGCIYSCVYRTKMRQQYKLKGTPFLDFLTHCCCETCALCQEHREL  128



>ref|XP_010269371.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Nelumbo nucifera]
Length=187

 Score =   143 bits (361),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 75/116 (65%), Positives = 85/116 (73%), Gaps = 2/116 (2%)
 Frame = +2

Query  218  HIAPNLQVK-PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNG  394
            +IA N   K P +  PWSTGLC C  DP NC IT +CPCITFGQIAEIV++G  SC   G
Sbjct  39   YIARNTPFKAPAVGMPWSTGLCHCCDDPANCVITCFCPCITFGQIAEIVNRGQTSCASRG  98

Query  395  ALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            A+Y +L   TGF C YSCFYRSK+R QY L+E PC DCLVH  CE+CALCQEYREL
Sbjct  99   AIYGLLG-FTGFACFYSCFYRSKLRGQYDLEEAPCVDCLVHFCCETCALCQEYREL  153



>ref|XP_003581316.1| PREDICTED: cell number regulator 2-like isoform X2 [Brachypodium 
distachyon]
Length=153

 Score =   142 bits (358),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            W++GLC CF D   CC+TL CPC+TFG+IAEI+D+G++SC  NG LY +LA  TG  C Y
Sbjct  19   WASGLCGCFHDVSGCCLTLCCPCVTFGRIAEILDQGNSSCCANGLLYMLLASTTGLGCLY  78

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRSK+R QY LKE PCGDC VH FCE+CALCQEYREL
Sbjct  79   SCTYRSKLRGQYGLKEKPCGDCCVHMFCEACALCQEYREL  118



>gb|EAY92435.1| hypothetical protein OsI_14168 [Oryza sativa Indica Group]
Length=153

 Score =   142 bits (357),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 69/106 (65%), Positives = 77/106 (73%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P    PWS+GL DCF D   CC+T WCPCITFG++AEIVD GS SCG +GALY  LA VT
Sbjct  15   PVGSAPWSSGLFDCFDDYGLCCMTWWCPCITFGRLAEIVDMGSTSCGHSGALYVFLAVVT  74

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            GF   Y+C YR KMR QY L   PCGDC +HC+CE CAL QEYREL
Sbjct  75   GFQWIYTCTYRGKMRAQYGLSGEPCGDCCIHCWCEPCALIQEYREL  120



>ref|NP_001047231.1| Os02g0579800 [Oryza sativa Japonica Group]
 dbj|BAD29572.1| putative ORFX [Oryza sativa Japonica Group]
 dbj|BAF09145.1| Os02g0579800 [Oryza sativa Japonica Group]
 gb|EAZ23564.1| hypothetical protein OsJ_07264 [Oryza sativa Japonica Group]
Length=162

 Score =   142 bits (358),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGL +CF D  NCC+T  CPCITFGQIAEI+D+GS+SCG +GALY ++  +TG  C Y
Sbjct  27   WSTGLFNCFDDCGNCCVTCLCPCITFGQIAEIIDRGSSSCGTSGALYALVMLLTGCNCVY  86

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+KMR QY L+E PC DC VH FCE CAL QEYREL
Sbjct  87   SCFYRAKMRSQYGLQEKPCADCPVHFFCEPCALSQEYREL  126



>ref|XP_007201687.1| hypothetical protein PRUPE_ppa023567mg [Prunus persica]
 gb|EMJ02886.1| hypothetical protein PRUPE_ppa023567mg [Prunus persica]
Length=191

 Score =   142 bits (359),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 78/111 (70%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N Q    +RG WSTGLC CF DP NC IT +CPCITFGQIAEIV +G+ SC   G  Y +
Sbjct  47   NTQPSGHVRGNWSTGLCHCFDDPANCMITAFCPCITFGQIAEIVSQGATSCASQGVCYGV  106

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            L   T   C YSCFYRS++R QY L+E PC DCLVH  C +CALCQEYREL
Sbjct  107  LLATTANACLYSCFYRSRLRGQYDLEEAPCVDCLVHFCCATCALCQEYREL  157



>ref|XP_010107951.1| hypothetical protein L484_027541 [Morus notabilis]
 gb|EXC17351.1| hypothetical protein L484_027541 [Morus notabilis]
Length=233

 Score =   144 bits (362),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 75/113 (66%), Positives = 83/113 (73%), Gaps = 1/113 (1%)
 Frame = +2

Query  227  PNLQV-KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            P LQV      G WSTGLC C  DP NC +T +CPCITFGQIAEIVDKGS+SCG  GA Y
Sbjct  87   PRLQVPAAAAAGRWSTGLCHCCDDPANCMVTCFCPCITFGQIAEIVDKGSSSCGSRGATY  146

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L   TG  C YSC YRSK+R QY L+E+PC DCLVH  CE+CALCQEYREL
Sbjct  147  GLLLGCTGLACLYSCSYRSKLRGQYDLEESPCVDCLVHFCCETCALCQEYREL  199



>ref|XP_010066589.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW64538.1| hypothetical protein EUGRSUZ_G02142 [Eucalyptus grandis]
Length=202

 Score =   142 bits (359),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 77/112 (69%), Positives = 92/112 (82%), Gaps = 2/112 (2%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  + + +++  WS+GLCDC SD RNCCIT  CPC+TFGQIAEIVDKGS+SCGVNGALYT
Sbjct  52   PTYEERDQVQ--WSSGLCDCLSDRRNCCITCCCPCVTFGQIAEIVDKGSSSCGVNGALYT  109

Query  407  ILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            ++ C  G  CCYSCFYR+KMR+QY LK++PC DC VH +CE CALCQEYREL
Sbjct  110  LIFCTVGCCCCYSCFYRAKMRQQYALKKSPCTDCCVHFWCECCALCQEYREL  161



>ref|XP_008780719.1| PREDICTED: cell number regulator 2-like, partial [Phoenix dactylifera]
Length=126

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLCDC  D  NCC+T +CPC+TFG+IAEIVD+GS SCG  G LYT++  V G P  Y
Sbjct  9    WSTGLCDCCEDAGNCCLTCFCPCVTFGRIAEIVDRGSTSCGTAGLLYTLMMFVVGPPWIY  68

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+K+R QY L + PC DCLVHCFC   ALCQEYREL
Sbjct  69   SCFYRTKLRRQYSLPKEPCNDCLVHCFCHHLALCQEYREL  108



>gb|EMT00654.1| hypothetical protein F775_27031 [Aegilops tauschii]
Length=145

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/110 (62%), Positives = 80/110 (73%), Gaps = 0/110 (0%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
            +Q        WSTGLCDCF D  NCCIT  CPCITFGQ+AEI+D+ S SCG +GALY ++
Sbjct  1    MQAGQAPLAAWSTGLCDCFDDCGNCCITCLCPCITFGQVAEIIDRWSTSCGASGALYALI  60

Query  413  ACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              +TG  C YSCFYR+KMR  Y L+E+PC DC +H  CE CALCQEYREL
Sbjct  61   MLLTGCQCVYSCFYRAKMRAHYGLQESPCADCCIHWCCEPCALCQEYREL  110



>emb|CAN61647.1| hypothetical protein VITISV_009005 [Vitis vinifera]
Length=452

 Score =   148 bits (373),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            KP   GPW+TGLCDC SD + CC+T+WCPC+TFGQIAEIVD+G+ SC V   LY I+  +
Sbjct  314  KPGNPGPWNTGLCDCCSDVKTCCLTMWCPCVTFGQIAEIVDRGNTSCXVAATLYAIVG-L  372

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + +  C SCFYR+KMR+Q+ML++ PC DCLVH FCE CALCQE+REL
Sbjct  373  SKWGFCLSCFYRTKMRKQFMLEKXPCDDCLVHWFCEPCALCQEHREL  419



>ref|XP_009419125.1| PREDICTED: cell number regulator 10-like [Musa acuminata subsp. 
malaccensis]
Length=175

 Score =   141 bits (355),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 85/114 (75%), Gaps = 2/114 (2%)
 Frame = +2

Query  227  PNLQVKPKIRG--PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            P+    P  +G  PWSTGLCDC  D  NCC+T +CPC+TFG+IAEIVD+GS SCG +GAL
Sbjct  28   PHPVTAPPYQGLQPWSTGLCDCTDDCGNCCMTCFCPCVTFGRIAEIVDQGSASCGTSGAL  87

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y +L  +T F   YSC YRSKMR QY L E+PC DCLVHC CE CALCQEYREL
Sbjct  88   YCLLEYLTCFHWVYSCCYRSKMRAQYSLPESPCADCLVHCCCEPCALCQEYREL  141



>ref|XP_010028478.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW55222.1| hypothetical protein EUGRSUZ_I01157 [Eucalyptus grandis]
Length=187

 Score =   141 bits (356),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 69/102 (68%), Positives = 79/102 (77%), Gaps = 1/102 (1%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G WST LC C  DP NC IT +CPCITFGQI+EIVD+GS +C   G +Y +LA +TGF C
Sbjct  53   GKWSTNLCHCCDDPANCIITCFCPCITFGQISEIVDRGSTNCAAKGTVYGLLA-MTGFAC  111

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSCFYRS++R QY L E PC DCLVH FCE+CALCQEYREL
Sbjct  112  LYSCFYRSRLRGQYDLAEDPCVDCLVHFFCEACALCQEYREL  153



>ref|XP_002518775.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF43700.1| conserved hypothetical protein [Ricinus communis]
Length=191

 Score =   141 bits (355),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 70/106 (66%), Positives = 80/106 (75%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P   G WSTGLC C  DP NC IT +CPCITFGQIAEIV+KGS SC  +GA+Y +L   +
Sbjct  52   PGPTGKWSTGLCHCCDDPANCVITCFCPCITFGQIAEIVNKGSTSCAGSGAVYGLLLAFS  111

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            GF C YSCFYRS +R Q+ L+E PC DCLVH  CE+CALCQEYREL
Sbjct  112  GFACLYSCFYRSLLRGQFDLEEAPCVDCLVHFCCETCALCQEYREL  157



>ref|XP_010066569.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Eucalyptus grandis]
Length=187

 Score =   140 bits (354),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
                +P    PWS+GL  CF D   CC++ WCPCITFG+IAEI D GS SC V+GA+YT 
Sbjct  43   GFHAQPVDNVPWSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTA  102

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +A +TG  CC+SC YR+KMR+QY LKE PC DCLVH  CE+CAL QEYREL
Sbjct  103  IALLTGCACCFSCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEYREL  153



>gb|KCW64493.1| hypothetical protein EUGRSUZ_G02100 [Eucalyptus grandis]
Length=237

 Score =   141 bits (356),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 68/111 (61%), Positives = 81/111 (73%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
                +P    PWS+GL  CF D   CC++ WCPCITFG+IAEI D GS SC V+GA+YT 
Sbjct  93   GFHAQPVDNVPWSSGLFSCFGDIPICCLSFWCPCITFGRIAEITDHGSVSCPVHGAIYTA  152

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +A +TG  CC+SC YR+KMR+QY LKE PC DCLVH  CE+CAL QEYREL
Sbjct  153  IALLTGCACCFSCCYRTKMRQQYQLKEDPCADCLVHFCCETCALTQEYREL  203



>ref|XP_010068707.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
Length=146

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC  D ++CCIT WCPCITFGQI+EI+DKG+ SC +N A+YT++  +T   C 
Sbjct  13   PWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGATSCVMNCAIYTLIYLLTSCACL  72

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR+K+R ++ LKE PC DCLVHC C  CALCQEYREL
Sbjct  73   YSCCYRTKLRREFGLKEDPCNDCLVHCCCMYCALCQEYREL  113



>ref|XP_011010193.1| PREDICTED: cell number regulator 1-like [Populus euphratica]
Length=175

 Score =   139 bits (351),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC +T  CPC+TFGQIAE+V+KGS SC  +GA+Y +L   TG  C Y
Sbjct  41   WSTGLCHCCDDPANCLVTCTCPCVTFGQIAEVVNKGSISCAASGAVYGLLLGFTGLSCLY  100

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRS++R QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  101  SCFYRSRLRGQYDLEEAPCVDCLVHFFCEPCALCQEYREL  140



>ref|XP_010666623.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Beta vulgaris 
subsp. vulgaris]
Length=171

 Score =   139 bits (350),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 84/113 (74%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            AP+        G +STGLCDCFSD   CC+T WCPCITFG+IAEIVD+GS+SCGV+GALY
Sbjct  25   APHNNQSNASVGSFSTGLCDCFSDASLCCMTCWCPCITFGRIAEIVDRGSSSCGVSGALY  84

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++  +TG  C YSC YRSKM+ Q+ + E  C DC +H +CE CALCQEYREL
Sbjct  85   ALIFGLTGCQCVYSCAYRSKMKAQFNMPENNCEDCCIHFWCEFCALCQEYREL  137



>ref|XP_004297457.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 3-like [Fragaria 
vesca subsp. vesca]
Length=138

 Score =   138 bits (347),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 80/101 (79%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PW++GL DCFSDP++CC+T  CPC+TFG+I EI DKGS SC + GA Y ++A + G PC 
Sbjct  4    PWNSGLLDCFSDPKSCCLTYLCPCVTFGRIVEIADKGSTSCCLGGAAYVLVALMFGCPCL  63

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             S  YRS++R+QY L+   CGDCLVHCFCE+CALCQEYREL
Sbjct  64   LSFRYRSRLRQQYSLEGNSCGDCLVHCFCETCALCQEYREL  104



>ref|XP_006378441.1| hypothetical protein POPTR_0010s11920g, partial [Populus trichocarpa]
 gb|ERP56238.1| hypothetical protein POPTR_0010s11920g, partial [Populus trichocarpa]
Length=196

 Score =   140 bits (352),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 68/100 (68%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLCDC SD  +CC+T WCPCITFG+IAEI DKG+  C V+GA+Y +L C T   C Y
Sbjct  62   WSSGLCDCCSDVPSCCLTYWCPCITFGRIAEITDKGTTPCAVSGAIYGLLLCFTCCSCLY  121

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRSK+R QYML+E+ C D LVHC CESCALCQEYREL
Sbjct  122  SCLYRSKLRTQYMLEESRCNDFLVHCCCESCALCQEYREL  161



>ref|XP_010666627.1| PREDICTED: cell number regulator 1-like [Beta vulgaris subsp. 
vulgaris]
Length=157

 Score =   138 bits (348),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC C  DP NC +T +CPCITFGQIAE+V++G+  C VNG +Y +L   TG PC 
Sbjct  24   PWSTGLCHCCDDPANCLVTAFCPCITFGQIAELVNQGNPGCAVNGTIYGLLMGFTGLPCL  83

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYR ++R QY L+E P  DCLVH  CE CALCQEYREL
Sbjct  84   YSCFYRPRLRGQYGLEEGPSADCLVHFCCEPCALCQEYREL  124



>ref|XP_009358701.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 11-like [Pyrus x 
bretschneideri]
Length=178

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 79/100 (79%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC+C  D  +CC+T WCPC+TFG+IAEIVD+GS  CGV+G LY+++ C+ G  C Y
Sbjct  40   WSTGLCNCCGDVSSCCLTCWCPCVTFGRIAEIVDRGSTPCGVSGTLYSLMVCLMGCSCLY  99

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+K+R QY L+E PC DC VH  CE+CALCQEYR L
Sbjct  100  SCFYRTKLRGQYFLEEKPCTDCCVHFCCEACALCQEYRHL  139



>ref|XP_004294816.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Fragaria 
vesca subsp. vesca]
Length=188

 Score =   139 bits (350),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 67/115 (58%), Positives = 82/115 (71%), Gaps = 0/115 (0%)
 Frame = +2

Query  218  HIAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            ++   ++    + G WSTGLC C  DP NC IT +CPCITFGQIAEIV++GS+SC   G 
Sbjct  41   YVVNTVRSTRHVGGEWSTGLCHCCDDPANCLITFFCPCITFGQIAEIVEQGSSSCAQQGT  100

Query  398  LYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             Y IL   TG  C YSCF+RS++R QY L+E+PC DCLVH  C +CALCQEYREL
Sbjct  101  CYGILLATTGLACLYSCFFRSRLRGQYDLEESPCVDCLVHFCCATCALCQEYREL  155



>ref|XP_010692733.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Beta vulgaris 
subsp. vulgaris]
Length=165

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 82/107 (77%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            +  + G +STGLCDCFSD   CC+T WCPCITFG+IAEIVDKGS+SCG +GA+Y+++   
Sbjct  25   QSAVVGEFSTGLCDCFSDVSLCCLTCWCPCITFGRIAEIVDKGSSSCGTSGAIYSLIMAF  84

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG    YSC YRSKM+ QY + E  CGDC  H +CE+C+LCQEYREL
Sbjct  85   TGCQWIYSCTYRSKMKAQYGMPENSCGDCCTHFWCEACSLCQEYREL  131



>gb|KJB12064.1| hypothetical protein B456_002G175600, partial [Gossypium raimondii]
Length=162

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/107 (64%), Positives = 80/107 (75%), Gaps = 0/107 (0%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV  421
            +P+   PWS G CDC SD + CCI+ WCPCITFGQIAEIVDKGS SCG +GALY ++  +
Sbjct  33   QPQNELPWSAGFCDCCSDLKTCCISYWCPCITFGQIAEIVDKGSTSCGASGALYILIMFI  92

Query  422  TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            TG  C YSC YRSK+R+QY LK   CGDC+ H  CE CAL QEYRE+
Sbjct  93   TGCGCLYSCCYRSKLRKQYNLKGGDCGDCMRHFCCEPCALTQEYREV  139



>emb|CBI32422.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   140 bits (352),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  D  NC IT  CPCITFGQIAEIV KGS++C V+GALY +L C+TG  C Y
Sbjct  85   WSTGLCHCCDDAANCLITCCCPCITFGQIAEIVSKGSSNCAVSGALYALL-CLTGLACLY  143

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS+MR QY L++ PC DCLVH FCE C+LCQEYREL
Sbjct  144  SCAYRSRMRAQYDLEDAPCVDCLVHVFCEGCSLCQEYREL  183



>gb|EYU40872.1| hypothetical protein MIMGU_mgv1a023101mg [Erythranthe guttata]
Length=173

 Score =   138 bits (348),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 85/117 (73%), Gaps = 4/117 (3%)
 Frame = +2

Query  224  APNLQVKPKI----RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVN  391
            APNL  +P++       WSTGLCDC  +   CC+T WCPCI FG+IAEIVD+GS SCGV+
Sbjct  23   APNLGGRPRLSPHDHAQWSTGLCDCCDNLSICCLTCWCPCIAFGRIAEIVDRGSTSCGVS  82

Query  392  GALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            GALY+++ C+ G+   YSC YRSKMR QY L+E P  DC VH  CE+CALCQEYR L
Sbjct  83   GALYSMITCMGGWCWVYSCMYRSKMRGQYFLEEKPGTDCCVHFCCETCALCQEYRHL  139



>ref|XP_010527793.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Tarenaya hassleriana]
Length=164

 Score =   138 bits (347),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 68/113 (60%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A     K +    WSTG CDCFSD  NCCIT WCPCITFGQ+AEI+D+GS SCG +GALY
Sbjct  17   AQGTHGKFQAEVEWSTGFCDCFSDCSNCCITCWCPCITFGQVAEILDRGSTSCGTSGALY  76

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             ++   TG  C YSC YR+KMR QY +K   CGDC  H  CE CAL Q YREL
Sbjct  77   ALIEVFTGCGCLYSCVYRTKMRRQYNIKGDDCGDCFKHFCCELCALTQLYREL  129



>ref|XP_010932525.1| PREDICTED: cell number regulator 10-like isoform X1 [Elaeis guineensis]
Length=176

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/113 (65%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            APN     +   PWSTGLCDC  D  NCC+T +CPCITFG+IAEIVD+G+ SCG +GALY
Sbjct  32   APNTLAVTQEPQPWSTGLCDCTDDCGNCCMTCFCPCITFGRIAEIVDQGATSCGTSGALY  91

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L   T     YSC YRSKMR Q  L E PC DCLVHC CESCALCQEYREL
Sbjct  92   ALLEYFTCCHWIYSCCYRSKMRAQLHLAERPCNDCLVHCCCESCALCQEYREL  144



>emb|CDP00820.1| unnamed protein product [Coffea canephora]
Length=168

 Score =   138 bits (347),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 79/105 (75%), Gaps = 1/105 (1%)
 Frame = +2

Query  248  KIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTG  427
             I G WSTGL DCFSD  NCC+TLWCPC+T G+IAEIVDKGS S    GALY +L  + G
Sbjct  31   NIPGTWSTGLYDCFSDVPNCCLTLWCPCVTLGRIAEIVDKGSTSREACGALYAVLN-ILG  89

Query  428  FPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              C +S  YRS++R+QY L  TPCGDCLVH FCE CALCQE+REL
Sbjct  90   CACLHSRLYRSRLRKQYNLPATPCGDCLVHFFCEPCALCQEHREL  134



>ref|XP_002282121.1| PREDICTED: cell number regulator 1 [Vitis vinifera]
Length=186

 Score =   138 bits (348),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  D  NC IT  CPCITFGQIAEIV KGS++C V+GALY +L C+TG  C Y
Sbjct  54   WSTGLCHCCDDAANCLITCCCPCITFGQIAEIVSKGSSNCAVSGALYALL-CLTGLACLY  112

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS+MR QY L++ PC DCLVH FCE C+LCQEYREL
Sbjct  113  SCAYRSRMRAQYDLEDAPCVDCLVHVFCEGCSLCQEYREL  152



>ref|XP_010066590.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
 gb|KCW64539.1| hypothetical protein EUGRSUZ_G02143 [Eucalyptus grandis]
Length=146

 Score =   137 bits (344),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC CF D ++CCIT WCPCITFGQI+EI+DKG  +C +N A+YT++  +T   C 
Sbjct  13   PWSTGLCGCFDDIKSCCITYWCPCITFGQISEILDKGETTCVMNCAIYTLICWLTSCACL  72

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR+K+R ++ LKE PC DCLVHC C  CALCQEYREL
Sbjct  73   YSCCYRTKLRREFGLKEDPCNDCLVHCCCMYCALCQEYREL  113



>ref|XP_010070341.1| PREDICTED: cell number regulator 2-like [Eucalyptus grandis]
 ref|XP_010026422.1| PREDICTED: cell number regulator 2-like [Eucalyptus grandis]
 gb|KCW59028.1| hypothetical protein EUGRSUZ_H01656 [Eucalyptus grandis]
 gb|KCW59325.1| hypothetical protein EUGRSUZ_H02012 [Eucalyptus grandis]
Length=174

 Score =   138 bits (347),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC IT +CPC+TFGQIAEIV +GS SC  +G  Y +LA +TG PC Y
Sbjct  42   WSTGLCHCCDDPANCLITAFCPCVTFGQIAEIVSRGSVSCAASGFAYAVLA-LTGLPCLY  100

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRS+MR QY+L+E P  DCLVH  CE C+LCQEYREL
Sbjct  101  SCFYRSRMRGQYVLEEAPVADCLVHFCCEPCSLCQEYREL  140



>gb|KDP31920.1| hypothetical protein JCGZ_12381 [Jatropha curcas]
Length=154

 Score =   137 bits (345),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC ++  CPC+TFGQIAEIV+KGS  C  +GA+Y IL   TG  C Y
Sbjct  21   WSTGLCHCCDDPANCLVSCLCPCVTFGQIAEIVNKGSIPCAASGAVYGILLGFTGLACLY  80

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCF+RS++R QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  81   SCFFRSRLRGQYDLEEAPCVDCLVHFFCEPCALCQEYREL  120



>gb|KCW64542.1| hypothetical protein EUGRSUZ_G02148, partial [Eucalyptus grandis]
Length=149

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 65/101 (64%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC  D ++CCIT WCPCITFGQI+EI+DKG  SC +N A+Y ++  +T   C 
Sbjct  16   PWSTGLCDCCGDIKSCCITFWCPCITFGQISEILDKGETSCVMNCAIYKLIYLLTSCACL  75

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR+K+R ++ LKE PC DCLVHC C  CALCQEYREL
Sbjct  76   YSCCYRTKLRREFGLKEDPCNDCLVHCCCMHCALCQEYREL  116



>gb|AAD02554.1| PGPS/D12 [Petunia x hybrida]
Length=145

 Score =   137 bits (344),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 68/112 (61%), Positives = 84/112 (75%), Gaps = 4/112 (4%)
 Frame = +2

Query  233  LQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTIL  412
            +  +P++  PWS+G+CDCF D + CC+T WCPCITFG+IAE+ D+GS SC V+G +Y ++
Sbjct  1    MSDRPQV--PWSSGICDCFQDVKGCCLTCWCPCITFGRIAEVADQGSTSCVVSGTVYLLV  58

Query  413  ACVT-GFPCC-YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              VT GF CC YSCFYRSK+R QY L E PC D   HC CE CALCQEYREL
Sbjct  59   YLVTSGFGCCWYSCFYRSKLRNQYYLDEKPCSDLCTHCCCEYCALCQEYREL  110



>ref|XP_010068703.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Eucalyptus 
grandis]
Length=146

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 77/101 (76%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC  D ++CCIT WCPCITFGQI EI+DKG  SC +N A+YT++  +T   C 
Sbjct  13   PWSTGLCDCCGDIKSCCITFWCPCITFGQILEILDKGETSCVMNCAIYTLIYLLTSCACL  72

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR+K+R  + LKE PC DCLVHC C  CALCQEYREL
Sbjct  73   YSCCYRTKLRRDFGLKEDPCNDCLVHCCCMYCALCQEYREL  113



>gb|KCW64547.1| hypothetical protein EUGRSUZ_G02154 [Eucalyptus grandis]
Length=146

 Score =   136 bits (343),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 78/101 (77%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC CF D ++CCIT WCPCITFGQ +EI+DKG  +C +N A+YT++  +T   C 
Sbjct  13   PWSTGLCGCFDDIKSCCITFWCPCITFGQTSEILDKGQTTCVMNCAIYTLIYLLTSCACL  72

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR+K+R ++ LKE PC DCLVHC C  CALCQEYREL
Sbjct  73   YSCCYRTKLRREFGLKEDPCNDCLVHCCCMYCALCQEYREL  113



>ref|XP_007156520.1| hypothetical protein PHAVU_003G292900g [Phaseolus vulgaris]
 gb|ESW28514.1| hypothetical protein PHAVU_003G292900g [Phaseolus vulgaris]
Length=190

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/111 (60%), Positives = 78/111 (70%), Gaps = 6/111 (5%)
 Frame = +2

Query  248  KIRGP------WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
             +RGP      WSTGLC C  DP NC +T +CPC+TFG IAEI+DKG  +C  NG +Y  
Sbjct  47   SVRGPMIRTQRWSTGLCRCLDDPGNCLVTCFCPCVTFGLIAEIIDKGEQTCTCNGTIYGT  106

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            L  ++G  C YSC+YRSKMR QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  107  LLALSGLACLYSCYYRSKMRAQYDLPEAPCMDCLVHFCCEACALCQEYREL  157



>ref|XP_010265360.1| PREDICTED: cell number regulator 2-like [Nelumbo nucifera]
Length=165

 Score =   137 bits (344),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/111 (66%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
             L ++P+   PWSTGLCDC  D  +CC+T WCPC+TFG+IAEIVD+GS SCGV+GALYT+
Sbjct  21   TLHIQPQTPAPWSTGLCDCCDDFSSCCLTCWCPCVTFGRIAEIVDRGSTSCGVSGALYTL  80

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            + C+TG  C YSCFYRSK+R Q+ L+E+PC DC VHC C  CALCQEYREL
Sbjct  81   ILCMTGCSCLYSCFYRSKLRGQFFLEESPCTDCCVHCCCGECALCQEYREL  131



>ref|XP_002282134.1| PREDICTED: cell number regulator 1 isoform X1 [Vitis vinifera]
Length=183

 Score =   137 bits (346),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLC C  DP N  IT  CPCITFGQIAEIV KGS++C V+G +YT+L C  G PC Y
Sbjct  51   WSSGLCHCCDDPANFLITCVCPCITFGQIAEIVSKGSSNCAVSGTIYTVL-CFIGLPCLY  109

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R QY L+E+PC DCLVH FCE+C+LCQEYREL
Sbjct  110  SCVYRSRLRAQYDLEESPCVDCLVHFFCEACSLCQEYREL  149



>ref|XP_002523567.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF38762.1| conserved hypothetical protein [Ricinus communis]
Length=149

 Score =   136 bits (342),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 76/100 (76%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC +T  CPCITFGQIAEIV+KGS +C  +GA+Y +L   TG PC Y
Sbjct  38   WSTGLCHCCDDPANCFVTCMCPCITFGQIAEIVNKGSITCAASGAVYALLG-FTGLPCLY  96

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR ++R QY L+E PC DCLVH  C+ CALCQEYREL
Sbjct  97   SCFYRPRLRGQYDLEEAPCADCLVHFLCQPCALCQEYREL  136



>emb|CBI32421.3| unnamed protein product [Vitis vinifera]
Length=216

 Score =   138 bits (347),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLC C  DP N  IT  CPCITFGQIAEIV KGS++C V+G +YT+L C  G PC Y
Sbjct  84   WSSGLCHCCDDPANFLITCVCPCITFGQIAEIVSKGSSNCAVSGTIYTVL-CFIGLPCLY  142

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R QY L+E+PC DCLVH FCE+C+LCQEYREL
Sbjct  143  SCVYRSRLRAQYDLEESPCVDCLVHFFCEACSLCQEYREL  182



>gb|AFM43804.1| fruit weight 2.2-1 protein [Dimocarpus longan]
Length=184

 Score =   137 bits (344),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 70/102 (69%), Positives = 78/102 (76%), Gaps = 1/102 (1%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G WSTG C C  DP NC IT +CPCITFGQIAEIVD+GS SC  NG +Y +LA +TGF C
Sbjct  49   GQWSTGFCHCCDDPANCFITCFCPCITFGQIAEIVDRGSTSCAANGTIYGLLA-MTGFAC  107

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             YSC YRSK+R QY L+E+PC DCL H  CE CALCQEYREL
Sbjct  108  LYSCCYRSKLRGQYDLEESPCVDCLAHFCCEPCALCQEYREL  149



>ref|XP_002447969.1| hypothetical protein SORBIDRAFT_06g019050 [Sorghum bicolor]
 gb|EES12297.1| hypothetical protein SORBIDRAFT_06g019050 [Sorghum bicolor]
Length=154

 Score =   136 bits (342),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 69/116 (59%), Positives = 83/116 (72%), Gaps = 1/116 (1%)
 Frame = +2

Query  218  HIAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGA  397
            + A  +Q      G WS+GLCDCF D   CC+T +CPC+TFG+IA IVD+G +SC V+G+
Sbjct  4    NAAFGVQGNAAAAGAWSSGLCDCFDDVGGCCLTFFCPCVTFGRIAHIVDQGGSSCCVSGS  63

Query  398  LYTILACVTGF-PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            LY +LA VTG   C YSC YRSK+R QY L E PC DC VH  CE+CALCQEYREL
Sbjct  64   LYMLLASVTGLGACLYSCIYRSKLRSQYGLTEKPCADCCVHLCCEACALCQEYREL  119



>emb|CAN70200.1| hypothetical protein VITISV_021221 [Vitis vinifera]
Length=234

 Score =   138 bits (348),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 79/100 (79%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLC C  DP N  IT  CPCITFGQIAEIV KGS++C V+G +YT+L C  G PC Y
Sbjct  51   WSSGLCHCCDDPANFLITCVCPCITFGQIAEIVSKGSSNCAVSGTIYTVL-CFIGLPCLY  109

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R QY L+E+PC DCLVH FCE+C+LCQEYREL
Sbjct  110  SCVYRSRLRAQYDLEESPCVDCLVHFFCEACSLCQEYREL  149



>ref|NP_001238282.1| uncharacterized protein LOC100527585 [Glycine max]
 gb|ACU16696.1| unknown [Glycine max]
 gb|KHN37502.1| Cell number regulator 1 [Glycine soja]
Length=193

 Score =   136 bits (343),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/118 (57%), Positives = 80/118 (68%), Gaps = 6/118 (5%)
 Frame = +2

Query  227  PNLQVKPKIRGP------WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGV  388
            P +     +RGP      WST LC C  DP NC +T +CPC+TFG IAEIVDKG+ +C  
Sbjct  42   PYISTSVSVRGPVIRTNRWSTNLCHCTEDPGNCLVTCFCPCVTFGLIAEIVDKGNTTCTY  101

Query  389  NGALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             GA+Y  L  ++G  C YSC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  102  AGAIYGTLLALSGLSCLYSCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEYREL  159



>ref|XP_008795343.1| PREDICTED: cell number regulator 2-like isoform X2 [Phoenix dactylifera]
Length=163

 Score =   135 bits (340),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 84/116 (72%), Gaps = 10/116 (9%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A  +Q  P +   WSTGLCDC +D  +CC+T +CPCITFGQIAEIVD+G+ SCG +GAL+
Sbjct  21   AFQMQQGPHL---WSTGLCDCTTDCWSCCMTCFCPCITFGQIAEIVDQGATSCGSSGALF  77

Query  404  TILACVTGFPCC---YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              L    G  CC   YSCFYRSKMR Q+ L E PC DCLVHC CE CALCQEYREL
Sbjct  78   VFL----GIICCHWIYSCFYRSKMRTQFRLAERPCCDCLVHCLCERCALCQEYREL  129



>ref|XP_004294815.1| PREDICTED: cell number regulator 2-like [Fragaria vesca subsp. 
vesca]
Length=188

 Score =   136 bits (342),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 76/105 (72%), Gaps = 0/105 (0%)
 Frame = +2

Query  248  KIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTG  427
             + G WSTGLC C  DP NC IT +CPCITFGQIAEIVD+GS+SC   G  Y IL   T 
Sbjct  51   HVGGEWSTGLCHCCDDPPNCMITCFCPCITFGQIAEIVDQGSSSCAQQGTCYGILLATTV  110

Query  428  FPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              C YSCFYRSK+R QY L+E+PC DCLVH  C  CALCQEYREL
Sbjct  111  LACLYSCFYRSKLRGQYDLEESPCVDCLVHFCCPGCALCQEYREL  155



>ref|XP_008795345.1| PREDICTED: cell number regulator 10-like isoform X3 [Phoenix 
dactylifera]
Length=144

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 84/116 (72%), Gaps = 10/116 (9%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A  +Q  P +   WSTGLCDC +D  +CC+T +CPCITFGQIAEIVD+G+ SCG +GAL+
Sbjct  21   AFQMQQGPHL---WSTGLCDCTTDCWSCCMTCFCPCITFGQIAEIVDQGATSCGSSGALF  77

Query  404  TILACVTGFPCC---YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              L    G  CC   YSCFYRSKMR Q+ L E PC DCLVHC CE CALCQEYREL
Sbjct  78   VFL----GIICCHWIYSCFYRSKMRTQFRLAERPCCDCLVHCLCERCALCQEYREL  129



>ref|NP_172941.1| cadmium resistance protein 1 [Arabidopsis thaliana]
 sp|Q9LQU2.1|PCR1_ARATH RecName: Full=Protein PLANT CADMIUM RESISTANCE 1; Short=AtPCR1 
[Arabidopsis thaliana]
 gb|AAF79233.1|AC006917_18 F10B6.29 [Arabidopsis thaliana]
 dbj|BAC43448.1| unknown protein [Arabidopsis thaliana]
 gb|AAO64083.1| unknown protein [Arabidopsis thaliana]
 gb|AEE29238.1| cadmium resistance protein 1 [Arabidopsis thaliana]
Length=151

 Score =   134 bits (338),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 77/114 (68%), Gaps = 0/114 (0%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            +   L  KP  +G WSTG CDCFSD RNCCITL CPCITFGQ+AEIVD+GS SC   GAL
Sbjct  1    MEAQLHAKPHAQGEWSTGFCDCFSDCRNCCITLCCPCITFGQVAEIVDRGSKSCCAAGAL  60

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y ++  +T     Y+CFY  KMR QY +K   C DCL H  C  CAL Q+YREL
Sbjct  61   YMLIDLITSCGRMYACFYSGKMRAQYNIKGDGCTDCLKHFCCNLCALTQQYREL  114



>ref|XP_010247538.1| PREDICTED: uncharacterized protein LOC104590526 [Nelumbo nucifera]
Length=324

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 73/145 (50%), Positives = 89/145 (61%), Gaps = 33/145 (23%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRN---------------------------------C  307
            P + V+ +    WSTGLCDCF D +                                   
Sbjct  166  PAIXVQVQAPVDWSTGLCDCFGDVQQYKNYGLSSSDLLLLSKLVQFNSSQPDVSPPFLTG  225

Query  308  CITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCYSCFYRSKMREQYMLK  487
            C+T WCPCITFGQI+EI+DKG++SC  NGALYT+++ V G P   SCFYRSK+R+QY+LK
Sbjct  226  CVTCWCPCITFGQISEIIDKGTSSCVTNGALYTLISFVIGCPISDSCFYRSKLRQQYLLK  285

Query  488  ETPCGDCLVHCFCESCALCQEYREL  562
            E+PC D LVHC CESCALCQEYREL
Sbjct  286  ESPCVDYLVHCCCESCALCQEYREL  310



>ref|XP_002463578.1| hypothetical protein SORBIDRAFT_01g002370 [Sorghum bicolor]
 gb|EER90576.1| hypothetical protein SORBIDRAFT_01g002370 [Sorghum bicolor]
Length=148

 Score =   134 bits (337),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/110 (59%), Positives = 79/110 (72%), Gaps = 2/110 (2%)
 Frame = +2

Query  239  VKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILAC  418
            V   +R  WS+GL DC  D   CC+T WCPCITFG+IAE+VD+G+ SCG +GALY ++AC
Sbjct  11   VAGALRQQWSSGLFDCLDDCHICCLTYWCPCITFGRIAEMVDRGATSCGTSGALYAVIAC  70

Query  419  VTGFPC--CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +T   C   YSC YR+ MR Q+ L E PC DCLVH  CE CALCQ+YREL
Sbjct  71   LTASQCTWVYSCTYRAMMRAQFGLPEAPCADCLVHLCCEPCALCQQYREL  120



>ref|XP_009403093.1| PREDICTED: cell number regulator 1-like [Musa acuminata subsp. 
malaccensis]
Length=182

 Score =   135 bits (340),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 78/101 (77%), Gaps = 1/101 (1%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC C  DP NC +T  CPCITFGQIA+IVD+G+ SC  +G +Y +L C+TG  C 
Sbjct  45   PWSTGLCHCMDDPGNCLVTCLCPCITFGQIADIVDEGTCSCVASGTVYGLL-CLTGMACL  103

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRS+MR Q+ L+E P  DCL+HC CE CALCQEYREL
Sbjct  104  YSCFYRSRMRGQHDLEEGPVPDCLIHCCCEPCALCQEYREL  144



>gb|KHN31068.1| Cell number regulator 1 [Glycine soja]
Length=193

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  227  PNLQVKPKIRGP------WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGV  388
            P +     +RGP      WSTGLC C  DP NC +T +CPC+TFG IAEIVDKG+ +C  
Sbjct  42   PYINNSVSVRGPVIRTQRWSTGLCRCTDDPGNCLVTCFCPCVTFGLIAEIVDKGNTTCTC  101

Query  389  NGALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             GA+Y  L  ++G  C YSC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  102  AGAIYGTLLALSGLACLYSCYYRSKLRVQYDLPEAPCMDCLVHFCCETCALCQEYREL  159



>ref|XP_003529392.1| PREDICTED: cell number regulator 1-like [Glycine max]
Length=193

 Score =   135 bits (341),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/118 (58%), Positives = 81/118 (69%), Gaps = 6/118 (5%)
 Frame = +2

Query  227  PNLQVKPKIRGP------WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGV  388
            P +     +RGP      WSTGLC C  DP NC +T +CPC+TFG IAEIVDKG+ +C  
Sbjct  42   PYISNSVSVRGPVIRTQRWSTGLCRCTDDPGNCLVTCFCPCVTFGLIAEIVDKGNTTCTC  101

Query  389  NGALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             GA+Y  L  ++G  C YSC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  102  AGAIYGTLLALSGLACLYSCYYRSKLRVQYDLPEAPCMDCLVHFCCETCALCQEYREL  159



>ref|XP_007047233.1| Plant cadmium resistance 2 [Theobroma cacao]
 gb|EOX91390.1| Plant cadmium resistance 2 [Theobroma cacao]
Length=214

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC IT  CPC+TFGQIAEIV+KGS SC  +GA+Y +LA + G  C Y
Sbjct  72   WSTGLCHCCDDPANCLITCLCPCVTFGQIAEIVNKGSISCAASGAVYGLLA-LAGLSCLY  130

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R QY L+E PC DCLVH  CE+C+LCQEYREL
Sbjct  131  SCVYRSRLRGQYDLEEAPCADCLVHFCCETCSLCQEYREL  170



>ref|XP_008795342.1| PREDICTED: cell number regulator 10-like isoform X1 [Phoenix 
dactylifera]
Length=212

 Score =   136 bits (342),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 73/116 (63%), Positives = 84/116 (72%), Gaps = 10/116 (9%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            A  +Q  P +   WSTGLCDC +D  +CC+T +CPCITFGQIAEIVD+G+ SCG +GAL+
Sbjct  21   AFQMQQGPHL---WSTGLCDCTTDCWSCCMTCFCPCITFGQIAEIVDQGATSCGSSGALF  77

Query  404  TILACVTGFPCC---YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              L    G  CC   YSCFYRSKMR Q+ L E PC DCLVHC CE CALCQEYREL
Sbjct  78   VFL----GIICCHWIYSCFYRSKMRTQFRLAERPCCDCLVHCLCERCALCQEYREL  129



>ref|XP_004964285.1| PREDICTED: cell number regulator 7-like [Setaria italica]
Length=173

 Score =   135 bits (339),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/105 (66%), Positives = 82/105 (78%), Gaps = 5/105 (5%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV---TGFP  433
            WS+GL DCF D   CC+T WCPCITFG++AEIVD+G+ SCG++GA+YT+LA V   TGF 
Sbjct  34   WSSGLFDCFDDCGLCCLTCWCPCITFGRVAEIVDRGATSCGMSGAMYTLLALVAYLTGFR  93

Query  434  C--CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C   YSC YRSKMR Q+ L ETPC DC VH FCE CALCQ+Y+EL
Sbjct  94   CQWIYSCTYRSKMRAQFGLPETPCCDCCVHFFCERCALCQQYKEL  138



>ref|XP_008389981.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Malus domestica]
Length=146

 Score =   134 bits (336),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 62/83 (75%), Positives = 70/83 (84%), Gaps = 0/83 (0%)
 Frame = +2

Query  227  PNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYT  406
            P  + +P+   PWSTGLCDCFSD +NCCITLWCPCITFG IAEIVDKGS SCG +GALYT
Sbjct  63   PPSRPRPRALIPWSTGLCDCFSDFKNCCITLWCPCITFGXIAEIVDKGSTSCGASGALYT  122

Query  407  ILACVTGFPCCYSCFYRSKMREQ  475
            ++ CVT  PCCYSCFYRSKMR+Q
Sbjct  123  LITCVTACPCCYSCFYRSKMRQQ  145



>ref|XP_007045339.1| Uncharacterized protein TCM_011102 [Theobroma cacao]
 gb|EOY01171.1| Uncharacterized protein TCM_011102 [Theobroma cacao]
Length=800

 Score =   143 bits (361),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 81/101 (80%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC SD  NCCIT WCP ITFGQ+AEIVD+GS+SCG +GALY +L    G  C 
Sbjct  665  PWSTGLCDCCSDVPNCCITCWCPYITFGQVAEIVDQGSSSCGASGALYGLLCSFMGCVCV  724

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YS FYR++MR QY+L+++PCGD  +H  CE+CALCQEYREL
Sbjct  725  YSSFYRTRMRSQYLLEDSPCGDYCIHFCCETCALCQEYREL  765



>ref|XP_007045233.1| Plant cadmium resistance 2, putative isoform 1 [Theobroma cacao]
 gb|EOY01065.1| Plant cadmium resistance 2, putative isoform 1 [Theobroma cacao]
Length=191

 Score =   135 bits (340),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 69/109 (63%), Positives = 80/109 (73%), Gaps = 3/109 (3%)
 Frame = +2

Query  242  KPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNG--ALYTILA  415
            +P  +  WSTGLCDC SD  NCCIT WCPCITFGQ+AEIVD+GS +C +    +   I  
Sbjct  48   QPAGKVSWSTGLCDCGSDVPNCCITCWCPCITFGQVAEIVDEGS-TCNLRNKWSPLRITL  106

Query  416  CVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             V G    YSCFYRS+MR QYML+E+PCGDC  H FCE+CALCQEYREL
Sbjct  107  LVHGVSLQYSCFYRSRMRSQYMLEESPCGDCCTHFFCETCALCQEYREL  155



>ref|XP_008789254.1| PREDICTED: cell number regulator 10-like [Phoenix dactylifera]
Length=180

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/113 (61%), Positives = 81/113 (72%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            APN     +   PWSTGLCDC  +  NCC+T +CPC+TFG+IAEIVD+G+ SCG +GALY
Sbjct  34   APNAFAVTQGPQPWSTGLCDCTDNCGNCCMTCFCPCVTFGRIAEIVDQGATSCGTSGALY  93

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             +L   T     YSC YRSKMR +  L E PC DCLVHC CE+CALCQEYREL
Sbjct  94   ALLEYFTCCHWIYSCIYRSKMRTELNLAERPCNDCLVHCCCEACALCQEYREL  146



>ref|XP_002310729.2| hypothetical protein POPTR_0007s11140g [Populus trichocarpa]
 gb|EEE91179.2| hypothetical protein POPTR_0007s11140g [Populus trichocarpa]
Length=157

 Score =   134 bits (336),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC +T  CPC+TF QIAE+V+KGS S   +GA+Y +L   TG  C Y
Sbjct  23   WSTGLCHCCDDPANCLVTCMCPCVTFEQIAEVVNKGSISYAASGAVYGLLLGFTGLSCLY  82

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYRS++R QY L+E PC DCLVH FCE CALCQEYREL
Sbjct  83   SCFYRSRLRGQYDLEEAPCVDCLVHFFCEPCALCQEYREL  122



>ref|XP_002282112.1| PREDICTED: cell number regulator 1 [Vitis vinifera]
Length=181

 Score =   134 bits (338),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC IT  CPCITFGQIAEIV KGS++C V+G LY +L C TG  C Y
Sbjct  49   WSTGLCHCTDDPANCLITCCCPCITFGQIAEIVSKGSSNCAVSGTLYALL-CFTGLSCLY  107

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R +Y L+E+PC DCLVH  CE C+LCQEYREL
Sbjct  108  SCAYRSRLRAEYDLEESPCADCLVHFCCEGCSLCQEYREL  147



>ref|XP_010932616.1| PREDICTED: cell number regulator 2 [Elaeis guineensis]
Length=142

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/101 (63%), Positives = 76/101 (75%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLCDC  D  +CC+T +CPC+ FG+IAEIVDKGS SC   G LY +L  V G    
Sbjct  8    PWSTGLCDCCEDVGSCCLTCFCPCVAFGRIAEIVDKGSTSCPTGGMLYFLLMLVVGHGWI  67

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYR+K+R++Y L++ PC DCLVHC CE  ALCQEYREL
Sbjct  68   YSCFYRTKLRQEYSLQKKPCNDCLVHCCCEGLALCQEYREL  108



>emb|CDP00593.1| unnamed protein product [Coffea canephora]
Length=252

 Score =   136 bits (342),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 70/101 (69%), Positives = 82/101 (81%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWSTGLC C+SDP  CC+T WCPCITFG+IA+I+D+GS SCGV+G LY ++  +TG PC 
Sbjct  118  PWSTGLCHCWSDPNTCCLTCWCPCITFGRIADILDRGSTSCGVSGGLYMLILFMTGCPCL  177

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            YSCFYRSK+R QY L+E PC DC VHC  E CALCQEYREL
Sbjct  178  YSCFYRSKLRGQYFLEEKPCCDCCVHCCYEPCALCQEYREL  218



>emb|CBI32423.3| unnamed protein product [Vitis vinifera]
Length=217

 Score =   135 bits (339),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC IT  CPCITFGQIAEIV KGS++C V+G LY +L C TG  C Y
Sbjct  85   WSTGLCHCTDDPANCLITCCCPCITFGQIAEIVSKGSSNCAVSGTLYALL-CFTGLSCLY  143

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R +Y L+E+PC DCLVH  CE C+LCQEYREL
Sbjct  144  SCAYRSRLRAEYDLEESPCADCLVHFCCEGCSLCQEYREL  183



>ref|XP_006388087.1| hypothetical protein POPTR_0347s00200g [Populus trichocarpa]
 gb|ERP47001.1| hypothetical protein POPTR_0347s00200g [Populus trichocarpa]
Length=172

 Score =   133 bits (335),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 65/100 (65%), Positives = 76/100 (76%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLCDC SD   CC+T WCPCITFG+IAEI D+G+  C V+GA+Y +L   T   C Y
Sbjct  38   WSSGLCDCCSDVPGCCLTYWCPCITFGRIAEITDRGTTPCAVSGAIYGLLLYFTYCSCLY  97

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRSK+R QYML+E+ C D LVHC CE CALCQEYREL
Sbjct  98   SCLYRSKLRTQYMLEESRCNDFLVHCCCEPCALCQEYREL  137



>ref|XP_002281039.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2 [Vitis vinifera]
 emb|CBI26859.3| unnamed protein product [Vitis vinifera]
Length=177

 Score =   133 bits (335),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 82/114 (72%), Gaps = 3/114 (3%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I     ++P    PWST LC C SD  NCCIT WCPCITFG+IAEIVDKG+ SC  + A+
Sbjct  33   IISTGNLQPGTEVPWSTCLCGCCSDVSNCCITCWCPCITFGRIAEIVDKGAVSCCASCAV  92

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  LAC     C +SC YR+K+R+Q+MLK   CGDCLVHC CE+C+LCQEYREL
Sbjct  93   YAALACCA---CLFSCSYRTKLRKQFMLKGCSCGDCLVHCCCETCSLCQEYREL  143



>ref|XP_010939439.1| PREDICTED: cell number regulator 1-like [Elaeis guineensis]
Length=185

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = +2

Query  218  HIAPNLQVKPKIRG--PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVN  391
            + +P +   P+ RG  PWSTGLC CF DP NC IT  CPCITFGQ+A+IVD+GS  C  +
Sbjct  31   YTSPAMHAPPQ-RGLTPWSTGLCHCFDDPGNCLITCICPCITFGQVADIVDRGSCPCVAS  89

Query  392  GALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G  Y +L   TG  C YSC YRSK+R QY L+E P  DCLVH  CE CALCQEYREL
Sbjct  90   GIAYGLLLSFTGLGCLYSCLYRSKLRGQYDLEEGPLPDCLVHFCCEPCALCQEYREL  146



>emb|CAN70201.1| hypothetical protein VITISV_021222 [Vitis vinifera]
Length=381

 Score =   138 bits (348),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/100 (69%), Positives = 78/100 (78%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  D  NC IT  CPCITFGQIAEIV KGS++C V+GALY +L C+TG  C Y
Sbjct  249  WSTGLCHCCDDAANCLITCCCPCITFGQIAEIVSKGSSNCAVSGALYALL-CLTGLACLY  307

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS+MR QY L++ PC DCLVH FCE C+LCQEYREL
Sbjct  308  SCAYRSRMRAQYDLEDAPCVDCLVHVFCEGCSLCQEYREL  347


 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 67/100 (67%), Positives = 77/100 (77%), Gaps = 1/100 (1%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP NC IT  CPCITFGQIAEIV KGS++C V+G LY +L C TG  C Y
Sbjct  49   WSTGLCHCTDDPANCLITCCCPCITFGQIAEIVSKGSSNCAVSGTLYALL-CFTGLSCLY  107

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++R +Y L+E+PC DCLVH  CE C+LCQEYREL
Sbjct  108  SCAYRSRLRAEYDLEESPCADCLVHFCCEGCSLCQEYREL  147



>ref|XP_004505208.1| PREDICTED: cell number regulator 1-like [Cicer arietinum]
Length=198

 Score =   134 bits (336),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 80/114 (70%), Gaps = 1/114 (1%)
 Frame = +2

Query  221  IAPNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGAL  400
            I  N +  P+    WSTGLC C  DP  C +T +CPCITFG IAEIVDKG+++C  +G +
Sbjct  51   ITTNSRAAPRAHH-WSTGLCRCLDDPGICLVTCFCPCITFGLIAEIVDKGNSTCTCDGTI  109

Query  401  YTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y  L  +TG  C YSC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  110  YGSLLAMTGLACLYSCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEYREL  163



>ref|XP_010265198.1| PREDICTED: cell number regulator 2-like [Nelumbo nucifera]
Length=158

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/102 (65%), Positives = 77/102 (75%), Gaps = 1/102 (1%)
 Frame = +2

Query  257  GPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPC  436
            G W+TGLCDCF DP NCCIT  CPC+TFGQ AE++DKG+ SCGV G +Y  LA + G  C
Sbjct  20   GQWTTGLCDCFDDPGNCCITFCCPCVTFGQNAEVIDKGTTSCGVAGFIYYALANI-GCSC  78

Query  437  CYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             Y+  YRSK+R  Y L+E PCGD L+HC C SCALCQEYREL
Sbjct  79   LYTFSYRSKLRGLYSLQEAPCGDLLIHCCCLSCALCQEYREL  120



>ref|XP_004142270.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Cucumis sativus]
 ref|XP_004168538.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Cucumis sativus]
 gb|KGN49620.1| hypothetical protein Csa_5G027940 [Cucumis sativus]
Length=150

 Score =   132 bits (332),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 62/101 (61%), Positives = 79/101 (78%), Gaps = 0/101 (0%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
            PWS+GLCDCFSD  +CC T WCPC+ FGQ +EI+D+GS SC  NG ++ ++A  T   C 
Sbjct  16   PWSSGLCDCFSDMGSCCCTAWCPCVPFGQASEIIDEGSTSCFGNGLIFCLIATFTPCICL  75

Query  440  YSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            Y+C YRS++R++Y LKETPC DC VHC+C SCA+CQEYREL
Sbjct  76   YTCSYRSRLRKKYNLKETPCNDCCVHCWCWSCAMCQEYREL  116



>ref|XP_006406603.1| hypothetical protein EUTSA_v10021908mg [Eutrema salsugineum]
 gb|ESQ48056.1| hypothetical protein EUTSA_v10021908mg [Eutrema salsugineum]
Length=133

 Score =   132 bits (331),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  251  IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGF  430
            +   W +GLC C  D  N C+T +CPCITFG+IAE+VD+G   CG  G  Y ++ CVTG 
Sbjct  1    MEKEWKSGLCSCMEDGENACLTCFCPCITFGRIAEVVDEGETGCGKCGMFYGLICCVTGL  60

Query  431  PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            PC +S  YR+KMRE Y L+E+P  DC+ HCFCE CALCQEYREL
Sbjct  61   PCLFSYMYRTKMREMYELQESPASDCITHCFCECCALCQEYREL  104



>gb|KJB12052.1| hypothetical protein B456_002G174600 [Gossypium raimondii]
Length=185

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 79/111 (71%), Gaps = 0/111 (0%)
 Frame = +2

Query  230  NLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTI  409
            N  + P  +  WSTGLCDC  D  NC IT +CPCITFGQIAEIVD GS SC  +G LY+I
Sbjct  38   NYYMHPAGKVLWSTGLCDCCYDIPNCIITCFCPCITFGQIAEIVDNGSVSCLASGVLYSI  97

Query  410  LACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            +  ++G  C YSCFYRS+MR QYML ETP  D  +H  CE CALCQEYREL
Sbjct  98   IFWMSGLACMYSCFYRSRMRNQYMLAETPYPDWCLHLCCEVCALCQEYREL  148



>gb|AES90190.2| fruit weight 2.2 protein [Medicago truncatula]
Length=197

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP  C +T +CPC+TFG IAEIVDKG+++C  +G +Y  L  VTG  C Y
Sbjct  64   WSTGLCRCLDDPGICLVTCFCPCVTFGLIAEIVDKGNSTCTCDGTIYGALLAVTGLACLY  123

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  124  SCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEYREL  163



>ref|XP_003607993.1| Placenta-specific gene 8 protein [Medicago truncatula]
Length=190

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 64/100 (64%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  DP  C +T +CPC+TFG IAEIVDKG+++C  +G +Y  L  VTG  C Y
Sbjct  57   WSTGLCRCLDDPGICLVTCFCPCVTFGLIAEIVDKGNSTCTCDGTIYGALLAVTGLACLY  116

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  117  SCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEYREL  156



>ref|XP_010527540.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 11 [Tarenaya hassleriana]
Length=171

 Score =   132 bits (333),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 66/100 (66%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WSTGLC C  D   CC+T WCPCI FG+IAEIVD+GS SCG+NG LY  +  VTG    Y
Sbjct  38   WSTGLCQCCLDVHACCLTCWCPCIAFGRIAEIVDRGSTSCGMNGLLYGAITMVTGCGWMY  97

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SCFYR+K+R QY LKE+PC DC VH  CE CALCQEYR+L
Sbjct  98   SCFYRTKLRGQYELKESPCSDCCVHFCCERCALCQEYRQL  137



>ref|XP_008373159.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Malus domestica]
Length=200

 Score =   133 bits (335),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/103 (66%), Positives = 72/103 (70%), Gaps = 0/103 (0%)
 Frame = +2

Query  254  RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFP  433
            RG WST LC C  DP NC IT +CPCITFGQIAEIV +GS  C   G  Y IL   T   
Sbjct  64   RGNWSTSLCHCCDDPENCMITFFCPCITFGQIAEIVSQGSTPCASGGVCYCILLSTTANA  123

Query  434  CCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C YSC YRSKMR QY L+ETPC DCLVH  C +CALCQEYREL
Sbjct  124  CLYSCSYRSKMRAQYDLEETPCVDCLVHFCCATCALCQEYREL  166



>ref|NP_001051784.1| Os03g0830200 [Oryza sativa Japonica Group]
 gb|AAO39879.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|AAP46253.1| hypothetical protein [Oryza sativa Japonica Group]
 gb|ABF99695.1| expressed protein [Oryza sativa Japonica Group]
 dbj|BAF13698.1| Os03g0830200 [Oryza sativa Japonica Group]
 gb|EAY92437.1| hypothetical protein OsI_14170 [Oryza sativa Indica Group]
 gb|EAZ29158.1| hypothetical protein OsJ_13218 [Oryza sativa Japonica Group]
Length=150

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 67/106 (63%), Positives = 73/106 (69%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P     WSTGLCDCF D   CC+T WCPCITFG++AE+VD+GS SCG  GALY +L   T
Sbjct  13   PVGSAAWSTGLCDCFDDCGLCCLTCWCPCITFGRVAEMVDRGSTSCGTGGALYGLLCAFT  72

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G    YSC YR KMR QY L E  C DC VH  CE CALCQEYREL
Sbjct  73   GCQWIYSCTYRGKMRTQYGLAEAGCADCCVHFCCEPCALCQEYREL  118



>ref|XP_006406602.1| hypothetical protein EUTSA_v10022218mg, partial [Eutrema salsugineum]
 gb|ESQ48055.1| hypothetical protein EUTSA_v10022218mg, partial [Eutrema salsugineum]
Length=114

 Score =   130 bits (328),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 74/104 (71%), Gaps = 0/104 (0%)
 Frame = +2

Query  251  IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGF  430
            +   WS+GLC C  D    C+T +CPCITFG+IA+I+DKGS  CG  G  Y ++ CV G 
Sbjct  1    MENKWSSGLCSCMEDGETACLTCFCPCITFGRIADILDKGSTGCGKCGMFYGLICCVIGL  60

Query  431  PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            PC +S  YR+KMRE Y L+E+P  DC+ HCFCE CALCQEYREL
Sbjct  61   PCLFSYMYRTKMREMYELQESPASDCITHCFCECCALCQEYREL  104



>ref|NP_001052997.1| Os04g0461600 [Oryza sativa Japonica Group]
 dbj|BAF14911.1| Os04g0461600, partial [Oryza sativa Japonica Group]
Length=179

 Score =   132 bits (333),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/100 (62%), Positives = 75/100 (75%), Gaps = 0/100 (0%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCCY  442
            WS+GLCDC+ D   CC+T +CPC+ FG+IAEIVD+G+ SC   G LY +LA  TGF C Y
Sbjct  45   WSSGLCDCYDDVGGCCLTFFCPCVAFGRIAEIVDQGATSCCARGTLYMLLAMATGFACAY  104

Query  443  SCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            SC YRS++ +QY L+E PCGDC VH  C  CALCQEYREL
Sbjct  105  SCCYRSRLHQQYGLQEKPCGDCCVHWCCGPCALCQEYREL  144



>ref|XP_003524372.1| PREDICTED: protein PLANT CADMIUM RESISTANCE 2-like [Glycine max]
Length=203

 Score =   133 bits (334),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/111 (58%), Positives = 80/111 (72%), Gaps = 11/111 (10%)
 Frame = +2

Query  263  WSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACV-------  421
            WSTGLCDCFSD  N C+T WCPC+TFG++AEIVD+GS SC  +GA+Y++++ +       
Sbjct  55   WSTGLCDCFSDWGNSCMTFWCPCVTFGRVAEIVDRGSPSCVTSGAIYSVISAIFFVIGVR  114

Query  422  ----TGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
                 G+   YSCFYRS MR+QY L+   C DCL+H FCE CALCQEYREL
Sbjct  115  WWCGWGWGWVYSCFYRSYMRQQYDLRGNACTDCLIHFFCEPCALCQEYREL  165



>sp|D9HP26.1|CNR10_MAIZE RecName: Full=Cell number regulator 10; AltName: Full=ZmCNR10 
[Zea mays]
 gb|ADI48424.1| cell number regulator 10 [Zea mays]
Length=157

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P     WS+GL DCF D   CC+T WCPCITFG++AEIVD+G+ SCG  GALY +LA  T
Sbjct  25   PAASSQWSSGLLDCFDDCGLCCLTCWCPCITFGRVAEIVDRGATSCGTAGALYAVLAYFT  84

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G    YSC YR+KMR Q  L ETPC DCLVH  CE CALCQ+Y+EL
Sbjct  85   GCQWIYSCTYRAKMRAQLGLPETPCCDCLVHFCCEPCALCQQYKEL  130



>ref|NP_001151128.1| cell number regulator 10 [Zea mays]
 gb|ACG41719.1| PGPS/D12 [Zea mays]
Length=158

 Score =   131 bits (330),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P     WS+GL DCF D   CC+T WCPCITFG++AEIVD+G+ SCG  GALY +LA  T
Sbjct  24   PAASSQWSSGLLDCFDDCGLCCLTCWCPCITFGRVAEIVDRGATSCGTAGALYAVLAYFT  83

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G    YSC YR+KMR Q  L ETPC DCLVH  CE CALCQ+Y+EL
Sbjct  84   GCQWIYSCTYRAKMRAQLGLPETPCCDCLVHFCCEPCALCQQYKEL  129



>ref|XP_007042410.1| Plant cadmium resistance 2, putative [Theobroma cacao]
 gb|EOX98241.1| Plant cadmium resistance 2, putative [Theobroma cacao]
Length=190

 Score =   132 bits (332),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 68/104 (65%), Positives = 78/104 (75%), Gaps = 1/104 (1%)
 Frame = +2

Query  251  IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGF  430
            + G W++GLC CF DP NC IT  CPCITFGQI EIV++GS SC   G L+ +LA +TG 
Sbjct  54   VSGQWTSGLCHCFDDPVNCVITCVCPCITFGQITEIVNRGSKSCVSRGLLFGLLA-LTGC  112

Query  431  PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
             C YSCFYRSK+R QY L+E PC DCLVH  C SCALCQEYREL
Sbjct  113  ACFYSCFYRSKLRGQYDLQEEPCTDCLVHFCCWSCALCQEYREL  156



>gb|AES90189.2| fruit weight 2.2 protein [Medicago truncatula]
Length=161

 Score =   130 bits (328),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 66/113 (58%), Positives = 77/113 (68%), Gaps = 0/113 (0%)
 Frame = +2

Query  224  APNLQVKPKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALY  403
            AP   V       WST LC C  DP  C +T +CPC+TFG IAEIVDKG+++C  +G +Y
Sbjct  38   APVQGVITPRTHQWSTRLCRCLDDPGICLVTCFCPCVTFGMIAEIVDKGNSTCTCDGTIY  97

Query  404  TILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
              L  VTG  C YSC+YRSK+R QY L E PC DCLVH  CE+CALCQEYREL
Sbjct  98   GALLAVTGLACLYSCYYRSKLRAQYDLPEAPCMDCLVHFCCETCALCQEYREL  150



>ref|NP_001051787.1| Os03g0830500 [Oryza sativa Japonica Group]
 gb|AAO39868.1| unknown protein [Oryza sativa Japonica Group]
 gb|AAP46225.1| unknown protein [Oryza sativa Japonica Group]
 gb|ABF99698.1| PGP224, putative, expressed [Oryza sativa Japonica Group]
 dbj|BAF13701.1| Os03g0830500 [Oryza sativa Japonica Group]
 gb|EAY92440.1| hypothetical protein OsI_14173 [Oryza sativa Indica Group]
 gb|EAZ29161.1| hypothetical protein OsJ_13220 [Oryza sativa Japonica Group]
 dbj|BAG92353.1| unnamed protein product [Oryza sativa Japonica Group]
Length=141

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 74/102 (73%), Gaps = 1/102 (1%)
 Frame = +2

Query  260  PWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFPCC  439
             WSTGL DCF D   CC+T WCPCITFG++AE+VD+GS SCG +GALY +LA VTG    
Sbjct  8    AWSTGLLDCFDDCGLCCMTCWCPCITFGRVAEMVDRGSTSCGTSGALYALLATVTGCQFV  67

Query  440  YSCFYRSKMREQYML-KETPCGDCLVHCFCESCALCQEYREL  562
            YSC YR KMR QY L  +  C DC VH +C  CALCQEYREL
Sbjct  68   YSCVYRGKMRAQYGLGDDAACADCCVHFWCNKCALCQEYREL  109



>ref|XP_008464696.1| PREDICTED: cell number regulator 2-like [Cucumis melo]
Length=150

 Score =   130 bits (327),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/103 (59%), Positives = 77/103 (75%), Gaps = 0/103 (0%)
 Frame = +2

Query  254  RGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGFP  433
              PWS+GLCDCFSD  +CC T WCPC+ FGQ +EI+D+GS SC  N  ++ ++A  T   
Sbjct  14   ESPWSSGLCDCFSDMGSCCCTTWCPCVPFGQASEIIDEGSTSCFGNALIFCLIASFTPCI  73

Query  434  CCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            C Y+C YRS++R +Y LKETPC DC VHC+C SCA+CQEYREL
Sbjct  74   CLYTCSYRSRLRRKYNLKETPCNDCCVHCWCWSCAMCQEYREL  116



>gb|KJB77671.1| hypothetical protein B456_012G150200 [Gossypium raimondii]
Length=180

 Score =   131 bits (329),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 70/117 (60%), Positives = 81/117 (69%), Gaps = 3/117 (3%)
 Frame = +2

Query  218  HIAPNLQVKPK--IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVN  391
            +I  NL   P   + G W++GLC CF DP NC IT  CPCITFGQI EI+++GS SC   
Sbjct  50   YIPHNLSRIPSAPLPGQWTSGLCHCFDDPVNCAITCVCPCITFGQITEIINRGSKSCVSR  109

Query  392  GALYTILACVTGFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G L+ +LA V G  C YSCFYRSK+R QY L E PC DCLVH  C +CALCQEYREL
Sbjct  110  GFLFGMLAMVGG-ACFYSCFYRSKLRGQYDLPEEPCTDCLVHFCCAACALCQEYREL  165



>ref|XP_010229876.1| PREDICTED: cell number regulator 11-like [Brachypodium distachyon]
Length=145

 Score =   130 bits (326),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/104 (63%), Positives = 75/104 (72%), Gaps = 1/104 (1%)
 Frame = +2

Query  251  IRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVTGF  430
            + G WS GL DCF D   CC+T WCPC+TFG+IAEIVDKGS SC +NG LY  L  + GF
Sbjct  1    MVGEWSVGLFDCFGDFGTCCLTFWCPCVTFGRIAEIVDKGSTSCCMNGTLYVCLGTI-GF  59

Query  431  PCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
               YSC  RS MR QY L+E+PC DC VH  CESCALCQEY+EL
Sbjct  60   HWLYSCTKRSAMRSQYNLQESPCMDCCVHLCCESCALCQEYKEL  103



>gb|AFW67070.1| PGPS/D12 [Zea mays]
Length=238

 Score =   132 bits (333),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 66/106 (62%), Positives = 76/106 (72%), Gaps = 0/106 (0%)
 Frame = +2

Query  245  PKIRGPWSTGLCDCFSDPRNCCITLWCPCITFGQIAEIVDKGSNSCGVNGALYTILACVT  424
            P     WS+GL DCF D   CC+T WCPCITFG++AEIVD+G+ SCG  GALY +LA  T
Sbjct  106  PAASSQWSSGLLDCFDDCGLCCLTCWCPCITFGRVAEIVDRGATSCGTAGALYAVLAYFT  165

Query  425  GFPCCYSCFYRSKMREQYMLKETPCGDCLVHCFCESCALCQEYREL  562
            G    YSC YR+KMR Q  L ETPC DCLVH  CE CALCQ+Y+EL
Sbjct  166  GCQWIYSCTYRAKMRAQLGLPETPCCDCLVHFCCEPCALCQQYKEL  211



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 644970849880