BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001B02

Length=573
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009616694.1|  PREDICTED: phosphoethanolamine N-methyltrans...    245   5e-75   Nicotiana tomentosiformis
ref|XP_011084235.1|  PREDICTED: phosphoethanolamine N-methyltrans...    243   2e-74   Sesamum indicum [beniseed]
ref|XP_009757363.1|  PREDICTED: phosphoethanolamine N-methyltrans...    243   2e-74   Nicotiana sylvestris
ref|XP_007209941.1|  hypothetical protein PRUPE_ppa004742mg             243   2e-74   
ref|NP_001234549.1|  phosphoethanolamine N-methyltransferase            243   4e-74   Solanum lycopersicum
ref|XP_007209942.1|  hypothetical protein PRUPE_ppa004742mg             242   7e-74   Prunus persica
ref|XP_007209943.1|  hypothetical protein PRUPE_ppa004742mg             242   8e-74   
ref|XP_002282182.1|  PREDICTED: phosphomethylethanolamine N-methy...    241   1e-73   Vitis vinifera
ref|XP_009614862.1|  PREDICTED: phosphoethanolamine N-methyltrans...    242   1e-73   Nicotiana tomentosiformis
ref|XP_010533969.1|  PREDICTED: phosphomethylethanolamine N-methy...    241   2e-73   Tarenaya hassleriana [spider flower]
ref|XP_008240154.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   9e-73   
emb|CAN64744.1|  hypothetical protein VITISV_041321                     239   1e-72   Vitis vinifera
ref|XP_008240152.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   Prunus mume [ume]
ref|XP_006341528.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   2e-72   Solanum tuberosum [potatoes]
gb|AAP83582.1|  phosphoethanolamine N-methyltransferase                 238   2e-72   Brassica napus [oilseed rape]
ref|XP_010519218.1|  PREDICTED: phosphoethanolamine N-methyltrans...    239   2e-72   Tarenaya hassleriana [spider flower]
ref|XP_009145948.1|  PREDICTED: phosphoethanolamine N-methyltrans...    238   3e-72   Brassica rapa
ref|XP_010487710.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   4e-72   Camelina sativa [gold-of-pleasure]
ref|XP_011084227.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   5e-72   Sesamum indicum [beniseed]
ref|XP_011072995.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   5e-72   Sesamum indicum [beniseed]
ref|XP_010506242.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   6e-72   Camelina sativa [gold-of-pleasure]
ref|XP_010519219.1|  PREDICTED: phosphoethanolamine N-methyltrans...    237   6e-72   Tarenaya hassleriana [spider flower]
ref|XP_002532097.1|  phosphoethanolamine n-methyltransferase, put...    237   6e-72   Ricinus communis
gb|KJB30121.1|  hypothetical protein B456_005G132000                    234   9e-72   Gossypium raimondii
ref|XP_008364653.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   1e-71   
ref|XP_002891445.1|  hypothetical protein ARALYDRAFT_473996             236   1e-71   
ref|XP_010033717.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   1e-71   Eucalyptus grandis [rose gum]
ref|XP_010097563.1|  hypothetical protein L484_017373                   236   1e-71   
ref|XP_010465872.1|  PREDICTED: phosphoethanolamine N-methyltrans...    236   2e-71   Camelina sativa [gold-of-pleasure]
gb|KJB30119.1|  hypothetical protein B456_005G132000                    234   2e-71   Gossypium raimondii
ref|XP_002883100.1|  N-methyltransferase 1                              236   2e-71   
ref|NP_973993.1|  phosphoethanolamine N-methyltransferase 2             235   2e-71   Arabidopsis thaliana [mouse-ear cress]
gb|ABX10444.1|  phosphoethanolamine N-methyltransferase                 235   3e-71   Gossypium hirsutum [American cotton]
ref|XP_008360927.1|  PREDICTED: phosphoethanolamine N-methyltrans...    235   3e-71   
gb|KHG16117.1|  Phosphoethanolamine N-methyltransferase 1 -like p...    235   3e-71   Gossypium arboreum [tree cotton]
gb|KJB30123.1|  hypothetical protein B456_005G132000                    234   3e-71   Gossypium raimondii
emb|CDO98349.1|  unnamed protein product                                234   4e-71   Coffea canephora [robusta coffee]
ref|XP_006406666.1|  hypothetical protein EUTSA_v10020595mg             234   5e-71   Eutrema salsugineum [saltwater cress]
ref|NP_188427.2|  phosphoethanolamine N-methyltransferase 1             234   5e-71   Arabidopsis thaliana [mouse-ear cress]
gb|AAM13092.1|  unknown protein                                         234   5e-71   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB02720.1|  methyl transferase-like protein                        234   6e-71   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487709.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   6e-71   Camelina sativa [gold-of-pleasure]
ref|XP_004299531.1|  PREDICTED: phosphomethylethanolamine N-methy...    234   7e-71   Fragaria vesca subsp. vesca
ref|XP_006297517.1|  hypothetical protein CARUB_v10013541mg             234   7e-71   Capsella rubella
ref|XP_010506234.1|  PREDICTED: phosphoethanolamine N-methyltrans...    234   8e-71   Camelina sativa [gold-of-pleasure]
ref|XP_006376718.1|  hypothetical protein POPTR_0012s044902g            223   9e-71   
gb|KJB30117.1|  hypothetical protein B456_005G132000                    234   1e-70   Gossypium raimondii
gb|KJB30122.1|  hypothetical protein B456_005G132000                    233   1e-70   Gossypium raimondii
ref|XP_009356042.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_008393424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   
ref|XP_006303987.1|  hypothetical protein CARUB_v10008968mg             233   2e-70   Capsella rubella
ref|XP_009360079.1|  PREDICTED: phosphoethanolamine N-methyltrans...    233   2e-70   Pyrus x bretschneideri [bai li]
ref|XP_004252273.1|  PREDICTED: phosphomethylethanolamine N-methy...    233   3e-70   Solanum lycopersicum
ref|XP_007036803.1|  S-adenosyl-L-methionine-dependent methyltran...    233   3e-70   
ref|XP_007036802.1|  S-adenosyl-L-methionine-dependent methyltran...    233   3e-70   
gb|KFK36082.1|  hypothetical protein AALP_AA4G075100                    232   4e-70   Arabis alpina [alpine rockcress]
ref|XP_009147956.1|  PREDICTED: phosphomethylethanolamine N-methy...    232   5e-70   Brassica rapa
gb|EYU33965.1|  hypothetical protein MIMGU_mgv1a005263mg                232   6e-70   Erythranthe guttata [common monkey flower]
ref|XP_010263678.1|  PREDICTED: phosphoethanolamine N-methyltrans...    232   6e-70   Nelumbo nucifera [Indian lotus]
gb|KDP23922.1|  hypothetical protein JCGZ_27082                         232   7e-70   Jatropha curcas
gb|KFK39125.1|  hypothetical protein AALP_AA3G204100                    231   7e-70   Arabis alpina [alpine rockcress]
gb|AFK34653.1|  unknown                                                 222   9e-70   Lotus japonicus
ref|XP_009776424.1|  PREDICTED: phosphoethanolamine N-methyltrans...    231   1e-69   Nicotiana sylvestris
dbj|BAD80838.1|  phosphoethanolamine N-methyltransferase                231   1e-69   Atriplex nummularia
gb|AER10512.1|  phosphoethanolamine N-methyltransferase                 231   1e-69   Pyrus betulifolia
gb|EPS65842.1|  hypothetical protein M569_08933                         231   2e-69   Genlisea aurea
ref|XP_006346642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    231   2e-69   Solanum tuberosum [potatoes]
ref|XP_010461752.1|  PREDICTED: phosphomethylethanolamine N-methy...    230   2e-69   Camelina sativa [gold-of-pleasure]
dbj|BAC57960.1|  phosphoethanolamine N-methyltransferase                230   3e-69   Tripolium pannonicum [sea starwort]
ref|XP_009104804.1|  PREDICTED: phosphoethanolamine N-methyltrans...    230   4e-69   Brassica rapa
emb|CDX68222.1|  BnaA07g22620D                                          230   4e-69   
ref|XP_010461683.1|  PREDICTED: phosphomethylethanolamine N-methy...    229   5e-69   Camelina sativa [gold-of-pleasure]
gb|KDO63824.1|  hypothetical protein CISIN_1g043471mg                   229   5e-69   Citrus sinensis [apfelsine]
gb|AEY75253.1|  phosphoethanolamine N-methyltransferase                 229   7e-69   Atriplex canescens [shadscale]
gb|AFW83641.1|  hypothetical protein ZEAMMB73_560974                    221   8e-69   
ref|XP_010274723.1|  PREDICTED: phosphomethylethanolamine N-methy...    229   8e-69   Nelumbo nucifera [Indian lotus]
dbj|BAD93609.1|  hypothetical protein                                   220   9e-69   Cucumis melo [Oriental melon]
ref|XP_006490771.1|  PREDICTED: phosphoethanolamine N-methyltrans...    229   9e-69   
ref|XP_006451624.1|  hypothetical protein CICLE_v10010749mg             229   1e-68   Citrus clementina [clementine]
gb|AGI56231.1|  phosphoethanolamine N-methyltransferase                 229   1e-68   Lycium barbarum [Duke of Argyll's teatree]
pir||H96762  hypothetical protein F6D5.1 [imported] - Arabidopsis...    230   1e-68
emb|CDY11100.1|  BnaC06g23520D                                          228   2e-68   Brassica napus [oilseed rape]
ref|XP_010097561.1|  Phosphoethanolamine N-methyltransferase 1          228   2e-68   
ref|XP_003528975.2|  PREDICTED: phosphoethanolamine N-methyltrans...    229   2e-68   
sp|Q9M571.1|PEAMT_SPIOL  RecName: Full=Phosphoethanolamine N-meth...    227   3e-68   Spinacia oleracea
ref|XP_010686587.1|  PREDICTED: phosphoethanolamine N-methyltrans...    227   5e-68   Beta vulgaris subsp. vulgaris [field beet]
dbj|BAE07178.1|  phosphoethanolamine N-methyltransferase                227   5e-68   Beta vulgaris [beet]
ref|XP_009782224.1|  PREDICTED: phosphoethanolamine N-methyltrans...    227   5e-68   Nicotiana sylvestris
ref|XP_011039130.1|  PREDICTED: phosphomethylethanolamine N-methy...    226   9e-68   Populus euphratica
ref|XP_011014101.1|  PREDICTED: phosphomethylethanolamine N-methy...    226   9e-68   Populus euphratica
gb|KDP23923.1|  hypothetical protein JCGZ_27083                         226   1e-67   Jatropha curcas
ref|XP_008799221.1|  PREDICTED: phosphomethylethanolamine N-methy...    226   1e-67   Phoenix dactylifera
gb|EYU24136.1|  hypothetical protein MIMGU_mgv1a005261mg                226   1e-67   Erythranthe guttata [common monkey flower]
gb|AAM97038.1|  phosphoethanolamine N-methyltransferase, putative       222   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008799219.1|  PREDICTED: phosphomethylethanolamine N-methy...    225   3e-67   Phoenix dactylifera
ref|NP_177501.2|  putative phosphoethanolamine N-methyltransferase 3    224   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008464197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   4e-67   Cucumis melo [Oriental melon]
ref|XP_010678114.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   4e-67   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_008799258.1|  PREDICTED: phosphomethylethanolamine N-methy...    223   4e-67   
ref|XP_007152684.1|  hypothetical protein PHAVU_004G150500g             224   5e-67   Phaseolus vulgaris [French bean]
ref|XP_006843796.1|  hypothetical protein AMTR_s00007p00250490          224   5e-67   Amborella trichopoda
gb|EMT21187.1|  Phosphoethanolamine N-methyltransferase 1               224   5e-67   
gb|AAF79704.1|AC020889_12  T1N15.22                                     214   6e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006390538.1|  hypothetical protein EUTSA_v10018431mg             224   6e-67   Eutrema salsugineum [saltwater cress]
emb|CDM83845.1|  unnamed protein product                                224   7e-67   Triticum aestivum [Canadian hard winter wheat]
gb|EMS54147.1|  Phosphoethanolamine N-methyltransferase 1               224   7e-67   Triticum urartu
gb|ACV89824.1|  S-adenosyl-L-methionine:phosphoethanolamine N-met...    224   7e-67   Triticum aestivum [Canadian hard winter wheat]
ref|XP_004161835.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   8e-67   
ref|XP_003569614.1|  PREDICTED: phosphoethanolamine N-methyltrans...    224   8e-67   Brachypodium distachyon [annual false brome]
ref|XP_011008809.1|  PREDICTED: phosphomethylethanolamine N-methy...    223   9e-67   Populus euphratica
ref|XP_004503268.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   1e-66   Cicer arietinum [garbanzo]
ref|XP_006644536.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   1e-66   Oryza brachyantha
ref|XP_011008808.1|  PREDICTED: phosphomethylethanolamine N-methy...    224   1e-66   Populus euphratica
ref|XP_010416170.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   1e-66   Camelina sativa [gold-of-pleasure]
gb|ACJ83326.1|  unknown                                                 215   1e-66   Medicago truncatula
dbj|BAH01482.1|  unnamed protein product                                223   1e-66   Oryza sativa Japonica Group [Japonica rice]
ref|XP_009595958.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   1e-66   Nicotiana tomentosiformis
ref|XP_010428286.1|  PREDICTED: phosphoethanolamine N-methyltrans...    223   2e-66   Camelina sativa [gold-of-pleasure]
ref|XP_002322102.2|  hypothetical protein POPTR_0015s04540g             223   2e-66   
gb|KEH21429.1|  phosphoethanolamine N-methyltransferase                 222   2e-66   Medicago truncatula
gb|KEH21430.1|  phosphoethanolamine N-methyltransferase                 221   3e-66   Medicago truncatula
ref|XP_004137500.1|  PREDICTED: phosphoethanolamine N-methyltrans...    222   3e-66   Cucumis sativus [cucumbers]
dbj|BAJ97525.1|  predicted protein                                      222   5e-66   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003631125.1|  Phosphoethanolamine N-methyltransferase            221   6e-66   
gb|AET05600.2|  phosphoethanolamine N-methyltransferase                 221   6e-66   Medicago truncatula
ref|XP_003631124.1|  Phosphoethanolamine N-methyltransferase            221   6e-66   
ref|NP_001148925.1|  LOC100282545                                       221   7e-66   Zea mays [maize]
ref|XP_002887491.1|  predicted protein                                  221   7e-66   
ref|NP_001043957.1|  Os01g0695100                                       221   7e-66   
gb|AAS57723.1|  phosphoethanolamine N-methyltransferase                 221   8e-66   Oryza sativa [red rice]
ref|NP_974139.2|  putative phosphoethanolamine N-methyltransferase 3    221   9e-66   Arabidopsis thaliana [mouse-ear cress]
gb|KFK41794.1|  hypothetical protein AALP_AA2G173000                    221   9e-66   Arabis alpina [alpine rockcress]
gb|EEE55232.1|  hypothetical protein OsJ_03109                          221   1e-65   Oryza sativa Japonica Group [Japonica rice]
ref|XP_006302164.1|  hypothetical protein CARUB_v10020173mg             221   1e-65   Capsella rubella
ref|XP_002456194.1|  hypothetical protein SORBIDRAFT_03g031950          221   1e-65   Sorghum bicolor [broomcorn]
ref|XP_003567962.1|  PREDICTED: phosphomethylethanolamine N-methy...    220   2e-65   Brachypodium distachyon [annual false brome]
ref|XP_004969638.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Setaria italica
ref|XP_006365411.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Solanum tuberosum [potatoes]
ref|XP_010471422.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Camelina sativa [gold-of-pleasure]
ref|XP_010921161.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   2e-65   Elaeis guineensis
gb|AFW83642.1|  phosphoethanolamine N-methyltransferase                 220   2e-65   
ref|XP_006393388.1|  hypothetical protein EUTSA_v10012068mg             213   2e-65   
ref|XP_004137341.1|  PREDICTED: phosphoethanolamine N-methyltrans...    220   3e-65   Cucumis sativus [cucumbers]
ref|XP_004166029.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    220   3e-65   
dbj|BAE99185.1|  putative phosphoethanolamine N-methyltransferase       219   5e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004961340.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   5e-65   Setaria italica
ref|XP_010921197.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   5e-65   Elaeis guineensis
ref|XP_009385384.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   5e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010471421.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   8e-65   Camelina sativa [gold-of-pleasure]
ref|XP_009404071.1|  PREDICTED: phosphomethylethanolamine N-methy...    219   8e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008453479.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   8e-65   Cucumis melo [Oriental melon]
ref|XP_006655550.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   1e-64   Oryza brachyantha
ref|XP_004512744.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   1e-64   Cicer arietinum [garbanzo]
ref|XP_010428285.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   1e-64   Camelina sativa [gold-of-pleasure]
ref|XP_003534138.1|  PREDICTED: phosphoethanolamine N-methyltrans...    218   1e-64   
ref|XP_010921188.1|  PREDICTED: phosphoethanolamine N-methyltrans...    219   2e-64   
dbj|BAC57432.1|  phosphoethanolamine N-methyltransferase                217   3e-64   Suaeda japonica
gb|AFW04224.1|  phosphoethanolamine N-methyl transferase                217   3e-64   Suaeda maritima
gb|ABK42071.1|  phosphoethanolamine N-methyltransferase                 217   4e-64   Suaeda liaotungensis
dbj|BAG50404.1|  methyltransferase                                      206   4e-64   Cardamine sp. SIM-2007
ref|XP_002441466.1|  hypothetical protein SORBIDRAFT_09g027360          217   5e-64   Sorghum bicolor [broomcorn]
ref|NP_001169597.1|  uncharacterized LOC100383478                       216   7e-64   Zea mays [maize]
ref|XP_008799222.1|  PREDICTED: phosphomethylethanolamine N-methy...    216   8e-64   
ref|XP_004512745.1|  PREDICTED: phosphoethanolamine N-methyltrans...    216   1e-63   Cicer arietinum [garbanzo]
ref|XP_004241642.1|  PREDICTED: phosphoethanolamine N-methyltrans...    215   1e-63   Solanum lycopersicum
ref|NP_175293.1|  phosphoethanolamine N-methyltransferase 2             214   3e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004969637.1|  PREDICTED: phosphoethanolamine N-methyltrans...    214   4e-63   Setaria italica
gb|ABG57185.1|  phosphoethanolamine N-methyltransferase                 214   5e-63   Salicornia europaea [chicken-claws]
ref|XP_003619836.1|  Phosphoethanolamine N-methyltransferase            213   7e-63   Medicago truncatula
ref|XP_002317875.2|  Phosphoethanolamine N-methyltransferase 1 fa...    202   8e-63   
emb|CDX93681.1|  BnaA06g03670D                                          213   9e-63   
emb|CDY40594.1|  BnaC06g02100D                                          213   9e-63   Brassica napus [oilseed rape]
ref|XP_006393387.1|  hypothetical protein EUTSA_v10011451mg             212   1e-62   
ref|XP_010461685.1|  PREDICTED: phosphomethylethanolamine N-methy...    203   8e-62   Camelina sativa [gold-of-pleasure]
ref|XP_003525185.1|  PREDICTED: phosphoethanolamine N-methyltrans...    209   3e-61   
ref|XP_007160543.1|  hypothetical protein PHAVU_002G330400g             209   4e-61   Phaseolus vulgaris [French bean]
ref|XP_007160542.1|  hypothetical protein PHAVU_002G330400g             209   4e-61   Phaseolus vulgaris [French bean]
ref|XP_002456193.1|  hypothetical protein SORBIDRAFT_03g031940          208   8e-61   Sorghum bicolor [broomcorn]
ref|XP_008675146.1|  PREDICTED: phosphoethanolamine N-methyltrans...    207   1e-60   Zea mays [maize]
ref|XP_008675144.1|  PREDICTED: phosphoethanolamine N-methyltrans...    207   2e-60   
gb|AFZ78648.1|  methyl transferase                                      207   2e-60   Populus tomentosa [Chinese white poplar]
gb|AAV67950.1|  putative phosphoethanolamine N-methyltransferase        207   2e-60   Zea mays [maize]
tpg|DAA57997.1|  TPA: putative phosphoethanolamine N-methyltransf...    207   3e-60   
gb|AAL40895.1|  phosphoethanolamine methyltransferase                   206   3e-60   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010500398.1|  PREDICTED: phosphomethylethanolamine N-methy...    204   1e-59   Camelina sativa [gold-of-pleasure]
ref|XP_010921205.1|  PREDICTED: phosphoethanolamine N-methyltrans...    201   2e-58   
gb|KJB53041.1|  hypothetical protein B456_008G289900                    200   2e-58   Gossypium raimondii
gb|KJB53038.1|  hypothetical protein B456_008G289900                    200   5e-58   Gossypium raimondii
gb|KJB53040.1|  hypothetical protein B456_008G289900                    200   7e-58   Gossypium raimondii
gb|KJB53039.1|  hypothetical protein B456_008G289900                    200   8e-58   Gossypium raimondii
emb|CDX92181.1|  BnaA05g22260D                                          199   9e-58   
ref|XP_001763293.1|  predicted protein                                  199   2e-57   
ref|XP_002284594.1|  PREDICTED: phosphoethanolamine N-methyltrans...    198   5e-57   Vitis vinifera
ref|XP_002454522.1|  hypothetical protein SORBIDRAFT_04g032625          187   5e-57   
ref|XP_010655650.1|  PREDICTED: phosphomethylethanolamine N-methy...    197   2e-56   Vitis vinifera
gb|KJB30120.1|  hypothetical protein B456_005G132000                    195   3e-56   Gossypium raimondii
ref|XP_006306318.1|  hypothetical protein CARUB_v10012188mg             190   3e-55   
gb|EEC79642.1|  hypothetical protein OsI_20868                          193   6e-55   Oryza sativa Indica Group [Indian rice]
emb|CDX95799.1|  BnaC05g35500D                                          190   5e-54   
gb|ABK24808.1|  unknown                                                 189   8e-54   Picea sitchensis
ref|XP_001768934.1|  predicted protein                                  186   8e-53   
ref|XP_002969650.1|  hypothetical protein SELMODRAFT_146547             185   6e-52   Selaginella moellendorffii
ref|XP_002970912.1|  hypothetical protein SELMODRAFT_270875             184   6e-52   Selaginella moellendorffii
ref|XP_006303561.1|  hypothetical protein CARUB_v10011038mg             179   8e-50   
gb|KHN10536.1|  Phosphoethanolamine N-methyltransferase                 177   4e-49   Glycine soja [wild soybean]
emb|CBI26879.3|  unnamed protein product                                176   8e-49   Vitis vinifera
gb|AGO59019.1|  heat responsive transcription factor protein            175   1e-48   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010540184.1|  PREDICTED: phosphoethanolamine N-methyltrans...    174   2e-48   Tarenaya hassleriana [spider flower]
gb|KDD75565.1|  hypothetical protein H632_c615p0                        167   4e-47   Helicosporidium sp. ATCC 50920
gb|KIZ00652.1|  hypothetical protein MNEG_7307                          165   1e-46   Monoraphidium neglectum
gb|EPS69227.1|  hypothetical protein M569_05544                         166   4e-46   Genlisea aurea
ref|XP_011399976.1|  Phosphoethanolamine N-methyltransferase            165   1e-44   Auxenochlorella protothecoides
ref|XP_002730517.1|  PREDICTED: phosphoethanolamine N-methyltrans...    155   4e-44   Saccoglossus kowalevskii
ref|XP_002594091.1|  hypothetical protein BRAFLDRAFT_68467              156   1e-43   Branchiostoma floridae
gb|EAY75471.1|  hypothetical protein OsI_03371                          160   7e-43   Oryza sativa Indica Group [Indian rice]
ref|XP_004137342.1|  PREDICTED: phosphoethanolamine N-methyltrans...    160   8e-43   Cucumis sativus [cucumbers]
ref|XP_004166030.1|  PREDICTED: LOW QUALITY PROTEIN: phosphoethan...    159   9e-43   
ref|XP_010231068.1|  PREDICTED: phosphomethylethanolamine N-methy...    159   1e-42   Brachypodium distachyon [annual false brome]
ref|XP_002594077.1|  hypothetical protein BRAFLDRAFT_68483              154   3e-42   Branchiostoma floridae
ref|XP_002594089.1|  hypothetical protein BRAFLDRAFT_118790             157   1e-41   Branchiostoma floridae
ref|XP_009011308.1|  hypothetical protein HELRODRAFT_71964              150   2e-41   Helobdella robusta
ref|XP_005643867.1|  S-adenosyl-L-methionine-dependent methyltran...    154   1e-40   Coccomyxa subellipsoidea C-169
ref|XP_005096334.1|  PREDICTED: phosphoethanolamine N-methyltrans...    151   1e-39   Aplysia californica
ref|XP_008324912.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   4e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_008418600.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   5e-39   Poecilia reticulata
ref|XP_008418601.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   5e-39   Poecilia reticulata
ref|XP_008324913.1|  PREDICTED: phosphoethanolamine N-methyltrans...    150   5e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007550439.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   5e-39   Poecilia formosa
ref|XP_008324914.1|  PREDICTED: phosphoethanolamine N-methyltrans...    149   6e-39   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_006003521.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   9e-39   
ref|XP_005806845.1|  PREDICTED: phosphoethanolamine N-methyltrans...    148   2e-38   Xiphophorus maculatus
ref|XP_005096335.1|  PREDICTED: phosphoethanolamine N-methyltrans...    147   4e-38   Aplysia californica
gb|AHY01341.1|  phosphoethanolamine methyltransferase                   140   5e-38   Carassius gibelio [gibel carp]
ref|NP_001096276.2|  phosphoethanolamine methyltransferase              147   5e-38   Xenopus tropicalis [western clawed frog]
ref|XP_005723167.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   7e-38   Pundamilia nyererei
ref|XP_005723168.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   7e-38   
ref|XP_008453688.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   7e-38   Cucumis melo [Oriental melon]
gb|ETM43048.1|  hypothetical protein L914_11412                         142   8e-38   Phytophthora parasitica
ref|XP_005723169.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   8e-38   Pundamilia nyererei
ref|XP_008278560.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   1e-37   Stegastes partitus
ref|XP_008278559.1|  PREDICTED: phosphoethanolamine N-methyltrans...    146   1e-37   Stegastes partitus
ref|XP_006781399.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   1e-37   Neolamprologus brichardi [lyretail cichlid]
ref|XP_010864863.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   2e-37   Esox lucius
gb|ETK83171.1|  hypothetical protein L915_11577                         139   2e-37   Phytophthora parasitica
ref|XP_004545581.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   
ref|XP_005913450.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   Haplochromis burtoni
gb|EWM27854.1|  phosphoethanolamine n-methyltransferase                 145   3e-37   Nannochloropsis gaditana
ref|XP_004545582.1|  PREDICTED: phosphoethanolamine N-methyltrans...    145   3e-37   
ref|NP_001070105.1|  phosphoethanolamine methyltransferase              145   3e-37   Danio rerio [leopard danio]
ref|XP_005913451.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   3e-37   Haplochromis burtoni
ref|XP_005467627.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   3e-37   Oreochromis niloticus
ref|XP_005467629.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   4e-37   Oreochromis niloticus
ref|XP_003444639.1|  PREDICTED: phosphoethanolamine N-methyltrans...    144   4e-37   Oreochromis niloticus
ref|NP_001167350.1|  phosphoethanolamine N-methyltransferase 3          144   4e-37   Salmo salar
ref|XP_008872791.1|  hypothetical protein H310_08714                    144   6e-37   Aphanomyces invadans
gb|EMT23240.1|  Phosphoethanolamine N-methyltransferase 1               144   6e-37   
gb|ETL36539.1|  hypothetical protein L916_11495                         139   8e-37   Phytophthora parasitica
ref|XP_009832411.1|  hypothetical protein H257_08283                    143   9e-37   Aphanomyces astaci
ref|XP_010730440.1|  PREDICTED: phosphomethylethanolamine N-methy...    143   1e-36   
ref|XP_010730439.1|  PREDICTED: phosphomethylethanolamine N-methy...    143   1e-36   
ref|XP_005855505.1|  phosphoethanolamine n-methyltransferase            143   1e-36   Nannochloropsis gaditana CCMP526
gb|AAI35513.1|  LOC100124841 protein                                    143   1e-36   Xenopus tropicalis [western clawed frog]
gb|KDO18851.1|  hypothetical protein SPRG_15850                         143   2e-36   Saprolegnia parasitica CBS 223.65
ref|XP_008620239.1|  hypothetical protein SDRG_15833                    142   2e-36   Saprolegnia diclina VS20
ref|XP_002898137.1|  phosphoethanolamine N-methyltransferase, put...    142   2e-36   Phytophthora infestans T30-4
ref|XP_009061459.1|  hypothetical protein LOTGIDRAFT_219756             141   4e-36   Lottia gigantea
ref|NP_001087172.1|  phosphoethanolamine methyltransferase              141   6e-36   Xenopus laevis [clawed frog]
ref|XP_004073222.1|  PREDICTED: phosphoethanolamine N-methyltrans...    140   2e-35   
ref|XP_003970259.1|  PREDICTED: phosphoethanolamine N-methyltrans...    139   2e-35   
ref|XP_007440631.1|  PREDICTED: phosphomethylethanolamine N-methy...    138   9e-35   
gb|ETI43103.1|  hypothetical protein F443_11871                         132   1e-34   Phytophthora parasitica P1569
emb|CAG09731.1|  unnamed protein product                                137   2e-34   Tetraodon nigroviridis
gb|ETP27600.1|  hypothetical protein F442_23122                         133   3e-34   Phytophthora parasitica P10297
gb|ETP40954.1|  hypothetical protein F442_11792                         133   3e-34   Phytophthora parasitica P10297
gb|EMT23241.1|  Phosphoethanolamine N-methyltransferase 1               136   4e-34   
gb|EMT23242.1|  Putative phosphoethanolamine N-methyltransferase 2      133   1e-33   
gb|ETL89752.1|  hypothetical protein L917_11366                         132   2e-33   Phytophthora parasitica
emb|CBI26877.3|  unnamed protein product                                134   2e-33   Vitis vinifera
ref|XP_010655490.1|  PREDICTED: phosphomethylethanolamine N-methy...    134   2e-33   Vitis vinifera
gb|ETK83144.1|  hypothetical protein L915_11579                         132   2e-33   
gb|ELU13998.1|  hypothetical protein CAPTEDRAFT_140071                  127   5e-33   
emb|CCI39434.1|  unnamed protein product                                132   9e-33   
ref|XP_009525377.1|  hypothetical protein PHYSODRAFT_354467             130   9e-33   
emb|CAN75113.1|  hypothetical protein VITISV_043577                     131   2e-32   
gb|ELU02022.1|  hypothetical protein CAPTEDRAFT_91785                   126   3e-32   
emb|CCA16454.1|  phosphoethanolamine Nmethyltransferase putative        130   6e-32   
ref|XP_002898136.1|  phosphoethanolamine N-methyltransferase            130   6e-32   
ref|XP_009525359.1|  hypothetical protein PHYSODRAFT_345888             129   9e-32   
gb|ELT87122.1|  hypothetical protein CAPTEDRAFT_189076                  126   1e-30   
ref|XP_011453570.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   2e-30   
ref|XP_011453569.1|  PREDICTED: phosphoethanolamine N-methyltrans...    125   3e-30   
ref|XP_011453571.1|  PREDICTED: phosphoethanolamine N-methyltrans...    124   4e-30   
gb|ETN83758.1|  methyltransferase domain protein                        124   6e-30   
gb|EYC44164.1|  hypothetical protein Y032_0470g2031                     124   7e-30   
emb|CDJ81011.1|  Methyltransferase type 11 domain containing protein    124   8e-30   
ref|NP_494991.1|  Protein PMT-1, isoform b                              122   4e-29   
ref|XP_003108788.1|  CRE-PMT-1 protein                                  120   1e-28   
ref|NP_494990.2|  Protein PMT-1, isoform a                              120   1e-28   
gb|KFM80232.1|  Phosphoethanolamine N-methyltransferase                 116   1e-28   
ref|XP_010677350.1|  PREDICTED: phosphoethanolamine N-methyltrans...    120   1e-28   
ref|NP_871998.1|  Protein PMT-1, isoform d                              120   2e-28   
gb|EFX73213.1|  hypothetical protein DAPPUDRAFT_58148                   120   2e-28   
gb|EGT32041.1|  hypothetical protein CAEBREN_18341                      119   4e-28   
gb|EGT50464.1|  hypothetical protein CAEBREN_10892                      119   4e-28   
ref|XP_002630685.1|  C. briggsae CBR-PMT-1 protein                      119   4e-28   
emb|CDQ92053.1|  unnamed protein product                                112   8e-28   
ref|XP_006824126.1|  PREDICTED: phosphoethanolamine N-methyltrans...    111   6e-27   
pdb|4KRG|A  Chain A, Semet Haemonchus Contortus Phosphoethanolami...    115   1e-26   
ref|XP_009862400.1|  PREDICTED: phosphoethanolamine N-methyltrans...    109   6e-26   
gb|ERG79882.1|  phosphoethanolamine n-methyltransferase                 110   5e-25   
gb|EKE08147.1|  Phosphoethanolamine N-methyltransferase                 104   3e-24   
ref|XP_010481025.1|  PREDICTED: phosphomethylethanolamine N-methy...    104   4e-23   
gb|ETO35874.1|  phosphoethanolamine N-methyltransferase 2 (NMT2)        100   3e-22   
emb|CDM83854.1|  unnamed protein product                              98.2    7e-21   
emb|CDY07952.1|  BnaC03g35710D                                        95.9    4e-20   
emb|CDX74572.1|  BnaA04g08170D                                        93.6    2e-19   
ref|XP_011403472.1|  PREDICTED: phosphoethanolamine N-methyltrans...  94.4    4e-19   
ref|WP_027370305.1|  hypothetical protein                             87.0    1e-17   
emb|CDY35847.1|  BnaC09g37790D                                        87.8    3e-17   
emb|CEF71262.1|  Protein of unknown function DUF858, methyltransf...  87.8    8e-17   
ref|WP_020209191.1|  hypothetical protein                             86.7    2e-16   
ref|WP_013610264.1|  Putative SAM-dependent methyltransferase         84.0    2e-16   
ref|XP_794381.2|  PREDICTED: phosphoethanolamine N-methyltransfer...  82.4    6e-15   
ref|XP_008908105.1|  hypothetical protein PPTG_12690                  78.2    7e-15   
gb|ETO71745.1|  hypothetical protein F444_11961                       78.6    1e-14   
gb|ETO07474.1|  hypothetical protein RFI_29918                        77.8    2e-14   
gb|ETO01952.1|  hypothetical protein RFI_35487                        76.6    2e-14   
ref|XP_007228349.1|  PREDICTED: phosphoethanolamine N-methyltrans...  79.0    1e-13   
ref|XP_010774827.1|  PREDICTED: phosphoethanolamine N-methyltrans...  77.4    2e-13   
gb|KHJ94304.1|  hypothetical protein OESDEN_05765                     76.3    4e-13   
gb|AFK40181.1|  unknown                                               71.2    4e-13   
gb|AFW78992.1|  hypothetical protein ZEAMMB73_932976                  72.0    5e-13   
gb|ETO71769.1|  hypothetical protein F444_11956                       68.9    5e-12   
gb|EMT23239.1|  hypothetical protein F775_30181                       68.6    5e-12   
gb|ETP40963.1|  hypothetical protein F442_11783                       68.9    6e-12   
emb|CEF71482.1|  Protein of unknown function DUF858, methyltransf...  72.4    1e-11   
gb|KFG31924.1|  methyltransferase domain-containing protein           69.7    1e-10   
gb|KFG59470.1|  methyltransferase domain-containing protein           69.7    1e-10   
ref|XP_002370184.1|  calpain, putative                                69.7    1e-10   
emb|CAJ20397.1|  hypothetical protein TgIa.1450                       69.7    1e-10   
gb|KFH03254.1|  methyltransferase domain-containing protein           69.7    1e-10   
ref|XP_010314226.1|  PREDICTED: phosphoethanolamine N-methyltrans...  67.0    7e-10   
ref|XP_008884763.1|  methyltransferase domain-containing protein      66.2    2e-09   
gb|AFK44813.1|  unknown                                               60.5    1e-08   
ref|WP_038474864.1|  hypothetical protein                             61.6    1e-08   
ref|WP_017004055.1|  hypothetical protein                             60.5    6e-08   
ref|WP_016959600.1|  hypothetical protein                             60.5    6e-08   
ref|WP_038589229.1|  methyltransferase type 11                        59.7    8e-08   
ref|WP_042231279.1|  methyltransferase type 11                        59.3    9e-08   
ref|WP_029535633.1|  methyltransferase type 11                        58.9    1e-07   
gb|ETL89780.1|  hypothetical protein L917_11359                       55.5    2e-07   
ref|WP_028552340.1|  methyltransferase type 11                        58.5    2e-07   
ref|WP_030923479.1|  hypothetical protein                             58.9    3e-07   
gb|KIH63696.1|  hypothetical protein ANCDUO_06001                     55.8    3e-07   
ref|WP_020674224.1|  hypothetical protein                             57.8    3e-07   
ref|WP_042175094.1|  methyltransferase type 11                        57.8    3e-07   
ref|WP_002137162.1|  methyltransferase                                58.2    4e-07   
ref|WP_043801196.1|  malonyl-CoA O-methyltransferase                  56.2    4e-07   
ref|WP_028971893.1|  methyltransferase type 11                        57.0    8e-07   
ref|WP_022493475.1|  phosphoethanolamine Nmethyltransferase putative  56.6    9e-07   
gb|KCZ72303.1|  methyltransferase family protein                      56.6    1e-06   
ref|WP_013635800.1|  methyltransferase                                56.6    1e-06   
gb|EQB28536.1|  methylase involved in ubiquinone/menaquinone bios...  56.6    1e-06   
ref|WP_025592905.1|  SAM-dependent methyltransferase                  56.6    1e-06   
gb|KJF71268.1|  SAM-dependent methyltransferase                       56.6    1e-06   
ref|WP_019565359.1|  methyltransferase                                56.6    1e-06   
ref|WP_035218037.1|  SAM-dependent methyltransferase                  56.2    1e-06   
ref|WP_015850956.1|  SAM-dependent methyltransferase                  56.2    1e-06   
ref|WP_041268184.1|  hypothetical protein                             54.7    2e-06   
gb|KIH53398.1|  hypothetical protein ANCDUO_16477                     53.5    2e-06   
ref|WP_039871819.1|  methyltransferase type 11                        56.2    2e-06   
ref|WP_043778158.1|  methyltransferase type 11                        55.5    2e-06   
ref|WP_038490461.1|  SAM-dependent methyltransferase                  55.5    3e-06   
ref|WP_038205258.1|  biotin synthase                                  55.8    3e-06   
ref|WP_038675258.1|  methyltransferase type 11                        55.5    3e-06   
ref|WP_030320182.1|  ubiquinone biosynthesis methyltransferase UbiE   55.8    3e-06   
ref|WP_015365730.1|  Methyltransferase type 11                        55.5    3e-06   
gb|KJF69443.1|  SAM-dependent methyltransferase                       55.5    3e-06   
gb|AIF52542.1|  Methyltransferase type 11                             55.5    3e-06   
ref|WP_009675881.1|  MULTISPECIES: methyltransferase type 11          55.1    3e-06   
gb|ABZ87545.1|  methyltransferase type 11                             54.7    4e-06   
gb|KFM98367.1|  methyltransferase small domain protein                55.1    4e-06   
ref|WP_036624290.1|  rRNA adenine methyltransferase                   55.5    4e-06   
ref|WP_000655494.1|  ubiquinone biosynthesis methlytransferase UbiE   54.7    4e-06   
ref|WP_040217132.1|  hypothetical protein                             55.1    5e-06   
ref|WP_003512256.1|  methyltransferase                                54.7    5e-06   
gb|EEL81767.1|  Methyltransferase type 11                             54.7    5e-06   
ref|WP_006311543.1|  methyltransferase                                54.7    5e-06   
ref|WP_022555903.1|  Methyltransferase                                54.7    5e-06   
ref|WP_044458759.1|  SAM-dependent methyltransferase                  54.7    6e-06   
ref|WP_003501956.1|  methyltransferase                                54.7    6e-06   
ref|WP_043330844.1|  ubiquinone biosynthesis protein                  53.9    6e-06   
ref|WP_035210160.1|  SAM-dependent methyltransferase                  54.3    7e-06   
ref|WP_036343328.1|  ubiquinone biosynthesis protein                  53.9    7e-06   
ref|WP_010971351.1|  MULTISPECIES: methyltransferase                  54.3    7e-06   
ref|WP_009589920.1|  methyltransferase type 11                        53.9    8e-06   
gb|EWM66995.1|  methyltransferase                                     54.3    8e-06   
ref|WP_007154813.1|  biotin biosynthesis protein BioC                 54.3    9e-06   
ref|WP_016134694.1|  ubiquinone/menaquinone biosynthesis methyltr...  53.9    9e-06   
ref|WP_016087553.1|  ubiquinone/menaquinone biosynthesis methyltr...  53.9    9e-06   
gb|ETB50522.1|  methyltransferase type 11                             52.8    9e-06   
ref|WP_037088919.1|  SAM-dependent methyltransferase                  53.9    1e-05   
ref|WP_032708748.1|  SAM-dependent methyltransferase                  53.9    1e-05   
ref|WP_032712033.1|  SAM-dependent methyltransferase                  53.9    1e-05   
ref|WP_042475209.1|  hypothetical protein                             55.1    1e-05   
ref|WP_001987073.1|  Non-ribosomal peptide synthase, putative         55.1    1e-05   
ref|WP_010899034.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_025027294.1|  methyltransferase type 11                        53.9    1e-05   
ref|WP_036809035.1|  ubiquinone biosynthesis methyltransferase UbiE   53.5    1e-05   
ref|WP_002649363.1|  SAM-dependent methyltransferase                  53.5    1e-05   
ref|WP_016129882.1|  hypothetical protein                             53.5    2e-05   
ref|WP_020078296.1|  SAM-dependent methyltransferase                  53.5    2e-05   
gb|ETB43218.1|  methyltransferase type 11                             52.4    2e-05   
ref|WP_003496924.1|  methyltransferase                                53.5    2e-05   
ref|WP_003190381.1|  methyltransferase                                53.5    2e-05   
ref|WP_032714967.1|  SAM-dependent methyltransferase                  53.5    2e-05   
ref|WP_018213222.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_034829698.1|  methyltransferase type 11                        53.5    2e-05   
ref|WP_018718509.1|  hypothetical protein                             53.5    2e-05   
ref|WP_026932721.1|  methyltransferase type 11                        52.8    2e-05   
gb|ELP57482.1|  hypothetical protein F502_19446                       53.5    2e-05   
ref|WP_009954416.1|  MULTISPECIES: methyltransferase type 11          53.5    2e-05   
ref|WP_028608495.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_002066207.1|  methyltransferase                                53.1    2e-05   
ref|WP_004440929.1|  methyltransferase                                53.1    2e-05   
ref|WP_002128087.1|  MULTISPECIES: methyltransferase                  53.1    2e-05   
ref|WP_014381807.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_014941284.1|  methyltransferase type 11                        53.1    2e-05   
ref|WP_014041811.1|  fibrillarin-like rRNA methylase                  52.4    2e-05   
ref|WP_016101074.1|  hypothetical protein                             52.8    2e-05   
ref|WP_035774675.1|  hypothetical protein                             53.1    3e-05   
ref|WP_002033133.1|  MULTISPECIES: methyltransferase                  52.8    3e-05   
ref|WP_028164399.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_014379131.1|  methyltransferase type 11                        53.1    3e-05   
ref|WP_002142407.1|  MULTISPECIES: methyltransferase                  52.8    3e-05   
ref|WP_030171158.1|  ubiquinone biosynthesis methyltransferase UbiE   53.1    3e-05   
ref|WP_006699398.1|  methyltransferase                                52.8    3e-05   
ref|WP_038256373.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_040903760.1|  SAM-dependent methyltransferase                  52.8    3e-05   
ref|WP_031167243.1|  hypothetical protein                             53.1    3e-05   
ref|WP_022595273.1|  putative Biotin biosynthesis protein BioC        52.8    3e-05   
ref|WP_026682185.1|  ubiquinone biosynthesis methyltransferase UbiE   52.8    3e-05   
ref|WP_009366385.1|  S-adenosylmethionine-dependent methyltransfe...  52.4    3e-05   
ref|WP_028025295.1|  biotin synthase                                  52.8    3e-05   
dbj|GAF27217.1|  methylase                                            52.4    3e-05   
gb|EMS98141.1|  methyltransferase                                     52.8    3e-05   
ref|WP_020009542.1|  MULTISPECIES: methyltransferase                  52.4    3e-05   
ref|WP_036547124.1|  hypothetical protein                             52.8    3e-05   
ref|WP_001968674.1|  methyltransferase                                52.4    3e-05   
ref|WP_039983829.1|  biotin synthase                                  52.8    3e-05   
gb|EHM45042.1|  methyltransferase domain protein                      52.4    3e-05   
ref|WP_000812695.1|  methyltransferase                                52.4    3e-05   
ref|WP_035237741.1|  SAM-dependent methyltransferase                  52.4    3e-05   
ref|WP_043281533.1|  hypothetical protein                             50.4    4e-05   
ref|WP_005707515.1|  hypothetical protein                             52.4    4e-05   
ref|WP_009792281.1|  MULTISPECIES: ubiquinone biosynthesis methyl...  52.4    4e-05   
ref|WP_010178217.1|  Biotin biosynthesis protein BioC                 52.8    4e-05   
gb|AFM41472.1|  methylase involved in ubiquinone/menaquinone bios...  51.6    4e-05   
ref|WP_028544807.1|  methyltransferase type 11                        52.0    5e-05   
ref|WP_008253539.1|  methyltransferase-UbiE family protein            52.4    5e-05   
ref|WP_007981656.1|  S-adenosylmethionine-dependent methyltransfe...  51.6    6e-05   
ref|WP_017249948.1|  methyltransferase type 11                        51.6    6e-05   
ref|WP_023866537.1|  methyltransferase type 11                        52.0    6e-05   
ref|WP_000812399.1|  methyltransferase                                51.6    6e-05   
ref|WP_033711115.1|  MULTISPECIES: methyltransferase type 11          52.0    6e-05   
ref|WP_023394424.1|  N-methyltransferase-like protein                 51.6    7e-05   
ref|WP_036885867.1|  methyltransferase type 12                        51.6    7e-05   
gb|EFC74027.1|  methyltransferase domain protein                      51.6    7e-05   
ref|WP_014710950.1|  MULTISPECIES: methyltransferase type 11          51.6    7e-05   
ref|WP_021509832.1|  hypothetical protein                             51.6    7e-05   
gb|AAS02988.1|  hypothetical protein MAP_0671                         52.0    7e-05   
ref|WP_022604334.1|  putative Biotin biosynthesis protein BioC        51.6    8e-05   
ref|WP_013433494.1|  fibrillarin-like rRNA methylase                  50.8    8e-05   
dbj|GAK84382.1|  biotin synthesis protein BioC                        51.2    8e-05   
ref|WP_011710956.1|  methyltransferase type 11                        50.8    8e-05   
ref|WP_004406035.1|  biotin synthase                                  51.6    8e-05   
gb|ELP47551.1|  hypothetical protein D522_03959                       51.6    8e-05   
ref|WP_011322316.1|  S-adenosylmethionine-dependent methyltransfe...  51.2    9e-05   
ref|WP_039987330.1|  biotin synthase                                  51.6    9e-05   
ref|WP_022551161.1|  putative Biotin biosynthesis protein BioC        51.6    9e-05   
ref|WP_023505824.1|  methylase involved in ubiquinone/menaquinone...  51.6    9e-05   
ref|WP_009974977.1|  methyltransferase type 11                        51.6    9e-05   
ref|WP_009548140.1|  methylase involved in ubiquinone/menaquinone...  51.2    9e-05   
dbj|GAJ73064.1|  biotin synthesis protein BioC                        51.6    9e-05   
ref|WP_034771182.1|  SAM-dependent methyltransferase                  51.6    9e-05   
ref|WP_000655497.1|  ubiquinone biosynthesis methyltransferase UbiE   51.2    9e-05   
ref|WP_019733079.1|  methyltransferase type 11                        51.6    9e-05   
dbj|GAK20672.1|  biotin synthesis protein BioC                        51.6    9e-05   
ref|WP_005378220.1|  biotin synthase                                  51.6    9e-05   
ref|WP_020196985.1|  biotin synthase                                  51.6    9e-05   
dbj|GAK14959.1|  biotin synthesis protein BioC                        51.6    1e-04   
ref|WP_025147982.1|  methyltransferase                                51.2    1e-04   
ref|WP_035015125.1|  hypothetical protein                             51.6    1e-04   
ref|WP_023499692.1|  methylase involved in ubiquinone/menaquinone...  51.6    1e-04   
ref|WP_005388087.1|  MULTISPECIES: biotin synthase                    51.2    1e-04   
ref|WP_003452268.1|  Methyltransferase type 11                        51.2    1e-04   
ref|WP_007808703.1|  malonyl-CoA O-methyltransferase                  51.6    1e-04   
gb|ACM13068.1|  methylase                                             51.2    1e-04   
ref|WP_003873068.1|  methyltransferase type 11                        51.2    1e-04   
ref|WP_023160493.1|  biotin synthesis protein BioC                    51.2    1e-04   



>ref|XP_009616694.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
tomentosiformis]
Length=491

 Score =   245 bits (625),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD EV+
Sbjct  121  DLIFSNWLLMYLSDGEVQ  138



>ref|XP_011084235.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Sesamum indicum]
Length=491

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 132/139 (95%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LEL
Sbjct  1    MAAIQEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+
Sbjct  61   GAGIGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSL  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  121  DLIFSNWLLMYLSDEEVEN  139



>ref|XP_009757363.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=491

 Score =   243 bits (621),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQKSYW+EH++ELTVEAMMLDSKAADLDKEERPEV+S+LP YEGKSVLEL
Sbjct  1    MAATSGQEREVQKSYWMEHTAELTVEAMMLDSKAADLDKEERPEVVSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAGQ+IA+DFIE  IKKNE+INGH  N+KFMCADVTS DLNFS ES+
Sbjct  61   GAGIGRFTGELAKKAGQLIALDFIEGAIKKNESINGHHKNVKFMCADVTSPDLNFSPESV  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD EV+
Sbjct  121  DLIFSNWLLMYLSDGEVQ  138



>ref|XP_007209941.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11140.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=463

 Score =   243 bits (619),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            D+IFSNWLLMYLSD+EVE+
Sbjct  121  DMIFSNWLLMYLSDKEVEN  139



>ref|NP_001234549.1| phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
 gb|AAG59894.1|AF328858_1 phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=491

 Score =   243 bits (619),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MAAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQ+IA+DFIE  IKKNE INGH  N+KFMCADVTS +L FS ES+
Sbjct  61   GAGIGRFTGELAQKAGQLIALDFIEGAIKKNENINGHYKNVKFMCADVTSPNLIFSPESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EV++
Sbjct  121  DLIFSNWLLMYLSDEEVKA  139



>ref|XP_007209942.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11141.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=491

 Score =   242 bits (617),  Expect = 7e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            D+IFSNWLLMYLSD+EVE+
Sbjct  121  DMIFSNWLLMYLSDKEVEN  139



>ref|XP_007209943.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
 gb|EMJ11142.1| hypothetical protein PRUPE_ppa004742mg [Prunus persica]
Length=493

 Score =   242 bits (617),  Expect = 8e-74, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLEL
Sbjct  1    MAAPNGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTGELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            D+IFSNWLLMYLSD+EVE+
Sbjct  121  DMIFSNWLLMYLSDKEVEN  139



>ref|XP_002282182.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Vitis 
vinifera]
 emb|CBI15568.3| unnamed protein product [Vitis vinifera]
Length=491

 Score =   241 bits (616),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAAQVGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  61   GAGIGRFTGELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_009614862.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=499

 Score =   242 bits (617),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 131/145 (90%), Gaps = 0/145 (0%)
 Frame = +3

Query  138  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  317
             ++ +A  A  G+ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEG
Sbjct  3    PVISAATTASSGQERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEG  62

Query  318  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  497
            KSVLELGAGIGRFTGELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL 
Sbjct  63   KSVLELGAGIGRFTGELAKNAGQLIALDFIESAIKKNESINRHHKNVKFMCADVTSPDLK  122

Query  498  FSDESIDLIFSNWLLMYLSDQEVES  572
            FS ES+DLIFSNWLLMYLSD+EV+S
Sbjct  123  FSPESVDLIFSNWLLMYLSDEEVQS  147



>ref|XP_010533969.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Tarenaya 
hassleriana]
Length=491

 Score =   241 bits (615),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA+  GEERE+QKSYW+EHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MASSYGEEREIQKSYWMEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMC DVTS DL  +DESI
Sbjct  61   GAGIGRFTGELAQKAGEVIAIDFIESAIKKNESVNGHYKNVKFMCMDVTSPDLKITDESI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DL+FSNWLLMYLSD+EVE
Sbjct  121  DLLFSNWLLMYLSDKEVE  138



>ref|XP_008240154.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Prunus mume]
Length=485

 Score =   239 bits (609),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            D+IFSNWLLMYLSD+EVE+
Sbjct  121  DMIFSNWLLMYLSDKEVEN  139



>emb|CAN64744.1| hypothetical protein VITISV_041321 [Vitis vinifera]
Length=490

 Score =   239 bits (609),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 129/138 (93%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA QG+ERE+QK+YW EHS++LTVEAMMLDSKAADLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAA-QGQEREIQKNYWAEHSADLTVEAMMLDSKAADLDKEERPEVLSLLPPFEGKSVLEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQVI++DFIESVIKKNE+INGH  N+KFMCADV S +LNFS ES+
Sbjct  60   GAGIGRFTXELAQKAGQVISLDFIESVIKKNESINGHYKNVKFMCADVASPELNFSAESV  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  120  DLIFSNWLLMYLSDKEVE  137



>ref|XP_008240152.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Prunus mume]
Length=491

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+EREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAANGQEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQ++A+DFI+SVIKKNE+ NGH  N+KFMCADVTS DL  S+ES+
Sbjct  61   GAGIGRFTAELAQKAGQLVALDFIDSVIKKNESTNGHHKNVKFMCADVTSPDLKISEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            D+IFSNWLLMYLSD+EVE+
Sbjct  121  DMIFSNWLLMYLSDKEVEN  139



>ref|XP_006341528.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Solanum tuberosum]
 ref|XP_006341529.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Solanum tuberosum]
Length=491

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 127/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            M A  G+EREVQKSYWIEH++ELTVEAMMLDSKAADLDKEERPEVLS+LP YEGK+VLEL
Sbjct  1    MDAASGQEREVQKSYWIEHTAELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKTVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA KAGQ+IA+DFIE  IKKNE ING+  N+KFMCADVTS +LNFS ES+
Sbjct  61   GAGIGRFTGELANKAGQLIALDFIEGAIKKNENINGYHKNVKFMCADVTSPNLNFSPESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EV++
Sbjct  121  DLIFSNWLLMYLSDEEVKA  139



>gb|AAP83582.1| phosphoethanolamine N-methyltransferase [Brassica napus]
Length=491

 Score =   238 bits (608),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA    ER+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEAERDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010519218.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Tarenaya hassleriana]
Length=510

 Score =   239 bits (609),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 127/142 (89%), Gaps = 0/142 (0%)
 Frame = +3

Query  144  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
            + S+++   GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKS
Sbjct  7    ISSSLSKHNGEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKS  66

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            VLE GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FS
Sbjct  67   VLEFGAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFS  126

Query  504  DESIDLIFSNWLLMYLSDQEVE  569
            DES+DLIFSNWLLMYLSD+EVE
Sbjct  127  DESVDLIFSNWLLMYLSDKEVE  148



>ref|XP_009145948.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Brassica 
rapa]
Length=492

 Score =   238 bits (607),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 130/139 (94%), Gaps = 1/139 (1%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A A+F+ E R+VQK+YWIEHS++LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLE
Sbjct  2    AAASFEAE-RDVQKNYWIEHSADLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLE  60

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D S
Sbjct  61   LGAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGS  120

Query  513  IDLIFSNWLLMYLSDQEVE  569
            IDLIFSNWLLMYLSD+EVE
Sbjct  121  IDLIFSNWLLMYLSDKEVE  139



>ref|XP_010487710.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Camelina sativa]
Length=491

 Score =   237 bits (605),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_011084227.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Sesamum indicum]
Length=494

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 111/136 (82%), Positives = 129/136 (95%), Gaps = 0/136 (0%)
 Frame = +3

Query  165  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  344
            F  +EREVQKSYWIEHS +LT+EAMMLDSKA+DLDKEERPEVLS+LP YEGKS+LELGAG
Sbjct  7    FVEQEREVQKSYWIEHSVDLTLEAMMLDSKASDLDKEERPEVLSLLPPYEGKSILELGAG  66

Query  345  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  524
            IGRFTGELA+K+GQ+IA+DFIE+VIKKNETINGH  N+KF+CADVTS+DLNFS+ S+DLI
Sbjct  67   IGRFTGELAKKSGQLIALDFIETVIKKNETINGHHKNVKFLCADVTSRDLNFSEGSLDLI  126

Query  525  FSNWLLMYLSDQEVES  572
            FSNWLLMYLSD+EVE+
Sbjct  127  FSNWLLMYLSDEEVEN  142



>ref|XP_011072995.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Sesamum 
indicum]
Length=491

 Score =   237 bits (605),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q +EREVQKSYW+EHS +LT+EAMMLDS A DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAANQEQEREVQKSYWMEHSVDLTLEAMMLDSNACDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAG+++A+DFIESVIKKNETINGH  N+KFMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGELVALDFIESVIKKNETINGHNKNVKFMCADVTSPDLNFPEGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010506242.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X2 [Camelina sativa]
Length=491

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010519219.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Tarenaya hassleriana]
Length=499

 Score =   237 bits (605),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 126/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA+ GEERE+QKSYW EHS +L+VEAMMLDSKAADLDKEERPE+LS+LP YEGKSVLE 
Sbjct  1    MAAY-GEEREIQKSYWTEHSVDLSVEAMMLDSKAADLDKEERPEILSILPPYEGKSVLEF  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGE A KAGQVIA+DFI+SVIKKNE INGH  N+KFMCADVTS +L FSDES+
Sbjct  60   GAGIGRFTGEFALKAGQVIAVDFIDSVIKKNENINGHHKNVKFMCADVTSPELKFSDESV  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  120  DLIFSNWLLMYLSDKEVE  137



>ref|XP_002532097.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
 gb|EEF30287.1| phosphoethanolamine n-methyltransferase, putative [Ricinus communis]
Length=492

 Score =   237 bits (604),  Expect = 6e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 128/138 (93%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQG-EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            MAA Q  EEREVQK+YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP+YEGKSVLE
Sbjct  1    MAAAQNVEEREVQKNYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPSYEGKSVLE  60

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
             GAGIGRFTGELAQKAGQ++A+DFIESVIKKNE INGH  N+KFMCADVTS+ L FS+ES
Sbjct  61   FGAGIGRFTGELAQKAGQLVAVDFIESVIKKNENINGHHKNVKFMCADVTSQGLKFSEES  120

Query  513  IDLIFSNWLLMYLSDQEV  566
            +DLIFSNWLLMYLSD+EV
Sbjct  121  VDLIFSNWLLMYLSDEEV  138



>gb|KJB30121.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=422

 Score =   234 bits (598),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>ref|XP_008364653.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  156  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            MAAF  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISENS  120

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DL+FSNWLLMYLSD EVE+
Sbjct  121  VDLVFSNWLLMYLSDXEVEN  140



>ref|XP_002891445.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH67704.1| hypothetical protein ARALYDRAFT_473996 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA    +ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKKERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  NIKFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNIKFMCADVTSPDLKIADGSI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010033717.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Eucalyptus 
grandis]
 gb|KCW84063.1| hypothetical protein EUGRSUZ_B00946 [Eucalyptus grandis]
Length=491

 Score =   236 bits (602),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 126/139 (91%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA QG+ER VQKSYW EHS+ LTVEAMMLDSKA+DLDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAAAQGDERHVQKSYWAEHSASLTVEAMMLDSKASDLDKEERPEILSLLPPYEGKTVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAGQ++A+DFI+  IKKNE+INGH  N+KF CADVTS DLN ++ES+
Sbjct  61   GAGIGRFTGELAQKAGQLLALDFIDGAIKKNESINGHHKNVKFQCADVTSPDLNIAEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD EVE+
Sbjct  121  DLIFSNWLLMYLSDTEVEN  139



>ref|XP_010097563.1| hypothetical protein L484_017373 [Morus notabilis]
 gb|EXB69095.1| hypothetical protein L484_017373 [Morus notabilis]
Length=503

 Score =   236 bits (603),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 111/144 (77%), Positives = 129/144 (90%), Gaps = 0/144 (0%)
 Frame = +3

Query  141  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            +  +A     G+ERE QK YW++HS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK
Sbjct  1    MADAATVNANGQEREKQKIYWMQHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGK  60

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
            SVLELGAGIGRFT ELAQKAGQ++AMDFIESVIKKNE+INGH  N+KFMCADVTS DLN 
Sbjct  61   SVLELGAGIGRFTSELAQKAGQLVAMDFIESVIKKNESINGHYKNVKFMCADVTSPDLNI  120

Query  501  SDESIDLIFSNWLLMYLSDQEVES  572
            S++S+DLIFSNWLLMYLSD+EVE+
Sbjct  121  SEDSVDLIFSNWLLMYLSDKEVEN  144



>ref|XP_010465872.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Camelina 
sativa]
Length=491

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAATYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVI+KNET+NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIEKNETVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|KJB30119.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=443

 Score =   234 bits (597),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>ref|XP_002883100.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH59359.1| N-methyltransferase 1 [Arabidopsis lyrata subsp. lyrata]
Length=491

 Score =   236 bits (601),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 129/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|NP_973993.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 sp|Q944H0.2|PEAM2_ARATH RecName: Full=Phosphomethylethanolamine N-methyltransferase; 
Short=AtPMEAMT; AltName: Full=Phosphoethanolamine N-methyltransferase 
2 [Arabidopsis thaliana]
 gb|AEE32323.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=491

 Score =   235 bits (600),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA    EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLEL
Sbjct  1    MATPYKEERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SI
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|ABX10444.1| phosphoethanolamine N-methyltransferase [Gossypium hirsutum]
Length=475

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>ref|XP_008360927.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 [Malus domestica]
Length=492

 Score =   235 bits (600),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 110/137 (80%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  159  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  338
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  339  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  518
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  519  LIFSNWLLMYLSDQEVE  569
            LIFSNWLLMYLSD+EVE
Sbjct  123  LIFSNWLLMYLSDKEVE  139



>gb|KHG16117.1| Phosphoethanolamine N-methyltransferase 1 -like protein [Gossypium 
arboreum]
Length=486

 Score =   235 bits (599),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 109/140 (78%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   F G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGFVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>gb|KJB30123.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=464

 Score =   234 bits (597),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>emb|CDO98349.1| unnamed protein product [Coffea canephora]
Length=491

 Score =   234 bits (598),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA +G+EREVQKSYWIEH+++LTVEAMMLDS AADLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVEGQEREVQKSYWIEHTADLTVEAMMLDSMAADLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE+ING+L N KF+CADVTS +L+FS ES+
Sbjct  61   GAGIGRFTGELAKKAGQIVALDFIEGAIKKNESINGNLKNTKFICADVTSPELHFSAESM  120

Query  516  DLIFSNWLLMYLSDQEV  566
            DLIFSNWLLMYLSD+EV
Sbjct  121  DLIFSNWLLMYLSDEEV  137



>ref|XP_006406666.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
 gb|ESQ48119.1| hypothetical protein EUTSA_v10020595mg [Eutrema salsugineum]
Length=491

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP +EGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPFEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DL  +D SI
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLKITDGSI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|NP_188427.2| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
 sp|Q9FR44.1|PEAM1_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 1; Short=AtNMT1; 
Short=PEAMT 1; AltName: Full=Protein XIPOTL 1 [Arabidopsis 
thaliana]
 gb|AAG41121.1|AF197940_1 SAM:phospho-ethanolamine N-methyltransferase [Arabidopsis thaliana]
 gb|AAK32886.1|AF367299_1 AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAL25589.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AAM10282.1| AT3g18000/MEB5_22 [Arabidopsis thaliana]
 gb|AEE76033.1| phosphoethanolamine N-methyltransferase 1 [Arabidopsis thaliana]
Length=491

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|AAM13092.1| unknown protein [Arabidopsis thaliana]
Length=491

 Score =   234 bits (598),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>dbj|BAB02720.1| methyl transferase-like protein [Arabidopsis thaliana]
Length=498

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI++VIKKNE+INGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDNVIKKNESINGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010487709.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Camelina sativa]
Length=494

 Score =   234 bits (598),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 126/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPSYEGKSVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  130  WLLMYLSDKEVE  141



>ref|XP_004299531.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Fragaria vesca subsp. vesca]
Length=500

 Score =   234 bits (598),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 112/142 (79%), Positives = 130/142 (92%), Gaps = 0/142 (0%)
 Frame = +3

Query  147  QSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  326
            ++A A   G+ERE+QKSYW E+S+ELTVE+MMLDSKA+DLDKEERPEVL+MLP YEGKSV
Sbjct  7    RTATANGSGKEREIQKSYWEENSTELTVESMMLDSKASDLDKEERPEVLAMLPPYEGKSV  66

Query  327  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  506
            LELGAGIGRFTGELAQKAGQ+IAMDFIE+VIKKNE+ING+  N+KFMCADVTS DL  S+
Sbjct  67   LELGAGIGRFTGELAQKAGQLIAMDFIENVIKKNESINGNHKNVKFMCADVTSPDLKISE  126

Query  507  ESIDLIFSNWLLMYLSDQEVES  572
            ES+DLIFSNWLLMYL D+EVE+
Sbjct  127  ESVDLIFSNWLLMYLCDKEVEN  148



>ref|XP_006297517.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
 gb|EOA30415.1| hypothetical protein CARUB_v10013541mg [Capsella rubella]
Length=491

 Score =   234 bits (597),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 128/138 (93%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVIKKNESINGHYKNVKFLCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_010506234.1| PREDICTED: phosphoethanolamine N-methyltransferase 1 isoform 
X1 [Camelina sativa]
Length=494

 Score =   234 bits (597),  Expect = 8e-71, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 125/132 (95%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QK+YWIEHS++LTVEAMMLDS+A+DLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  10   EERDIQKNYWIEHSADLTVEAMMLDSRASDLDKEERPEVLSLLPPYEGKSVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG++IA+DFI+SVIKKNET+NGH  N+KFMCADVTS DL  +D S+DLIFSN
Sbjct  70   FTGELAQKAGELIALDFIDSVIKKNETVNGHYKNVKFMCADVTSPDLKITDGSLDLIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  130  WLLMYLSDKEVE  141



>ref|XP_006376718.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 ref|XP_006376719.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54515.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
 gb|ERP54516.1| hypothetical protein POPTR_0012s044902g, partial [Populus trichocarpa]
Length=135

 Score =   223 bits (567),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+DLIFSN
Sbjct  66   FTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSVDLIFSN  125

Query  534  WLLMYLSDQE  563
            WLLMYLSD+E
Sbjct  126  WLLMYLSDKE  135



>gb|KJB30117.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=494

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 108/140 (77%), Positives = 128/140 (91%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            A   + G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LE
Sbjct  2    AANGYVGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILE  61

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S
Sbjct  62   LGAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGS  121

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  122  LDLIFSNWLLMYLSDKEVEN  141



>gb|KJB30122.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=491

 Score =   233 bits (595),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA  G+ER+VQK+YWIEHS +LTVEAMMLDSKAAD+DKEERPEVLS+LP YEGK++LEL
Sbjct  1    MAA-NGDERKVQKNYWIEHSVDLTVEAMMLDSKAADIDKEERPEVLSLLPPYEGKTILEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTG+LA+KAG VIA+DFIE+VIKKNETINGH  N+KF+CADVTS DL F++ S+
Sbjct  60   GAGIGRFTGDLAKKAGHVIALDFIENVIKKNETINGHYKNVKFLCADVTSPDLAFTEGSL  119

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  120  DLIFSNWLLMYLSDKEVEN  138



>ref|XP_009356042.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 129/140 (92%), Gaps = 1/140 (1%)
 Frame = +3

Query  156  MAAF-QGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            MAAF  GEER VQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+E
Sbjct  1    MAAFANGEERAVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKSVVE  60

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTGELA+KAGQ+ A+DFI+SVIKKNE+INGH  N+KF+CADVTS DL  S+ S
Sbjct  61   LGAGIGRFTGELAEKAGQLFALDFIDSVIKKNESINGHHKNVKFICADVTSPDLKISENS  120

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DL+FSNWLLMYLSD+EVE+
Sbjct  121  VDLVFSNWLLMYLSDKEVEN  140



>ref|XP_008393424.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Malus 
domestica]
Length=492

 Score =   233 bits (595),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  159  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  338
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+S +ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSXVELG  62

Query  339  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  518
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVTSPDLKISEGSVD  122

Query  519  LIFSNWLLMYLSDQEVE  569
            LIFSNWLLMYLSD+EVE
Sbjct  123  LIFSNWLLMYLSDKEVE  139



>ref|XP_006303987.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
 gb|EOA36885.1| hypothetical protein CARUB_v10008968mg [Capsella rubella]
Length=491

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA    EER +QKSYW+EHSS+LTVEAMMLDSKA DLDKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERHIQKSYWMEHSSDLTVEAMMLDSKATDLDKEERPEVLSLIPPYEGKTVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSV  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_009360079.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Pyrus 
x bretschneideri]
Length=492

 Score =   233 bits (594),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/137 (80%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  159  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  338
            A+  GEEREVQK+YW+EHS++LTVEAMMLDSKA+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  339  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  518
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  519  LIFSNWLLMYLSDQEVE  569
            LIFSNWLLMYLSD+EVE
Sbjct  123  LIFSNWLLMYLSDKEVE  139



>ref|XP_004252273.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Solanum lycopersicum]
Length=500

 Score =   233 bits (594),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/141 (78%), Positives = 126/141 (89%), Gaps = 0/141 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +   A  G+ER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVL
Sbjct  8    AGAGAKSGQERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVL  67

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL FS E
Sbjct  68   ELGAGIGRFTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKFSPE  127

Query  510  SIDLIFSNWLLMYLSDQEVES  572
            S+DLIFSNWLLMYLSD+EV+S
Sbjct  128  SVDLIFSNWLLMYLSDEEVQS  148



>ref|XP_007036803.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
 gb|EOY21304.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 2 [Theobroma cacao]
Length=494

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+E+E+
Sbjct  129  WLLMYLSDKEIEN  141



>ref|XP_007036802.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
 gb|EOY21303.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein isoform 1 [Theobroma cacao]
Length=493

 Score =   233 bits (593),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 110/133 (83%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREVQK YW+EHS +LTVEAMMLDSKAADLDKEERPEVLS+LP YEGKS+LELGAGIGR
Sbjct  9    DEREVQKDYWMEHSLDLTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSILELGAGIGR  68

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG VIA+DFIESVIKKNE+INGH  N KF+CADVTS DL FS+ S+DLIFSN
Sbjct  69   FTGELAQKAGHVIALDFIESVIKKNESINGHYKNAKFLCADVTSPDLKFSEGSLDLIFSN  128

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+E+E+
Sbjct  129  WLLMYLSDKEIEN  141



>gb|KFK36082.1| hypothetical protein AALP_AA4G075100 [Arabis alpina]
Length=492

 Score =   232 bits (592),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 109/132 (83%), Positives = 123/132 (93%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGR
Sbjct  8    EERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGR  67

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG+VIA+DFIES IKKNE+ NGH  N+KFMCADVTS DL  +D SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIKKNESDNGHYKNVKFMCADVTSPDLKITDGSIDLIFSN  127

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  128  WLLMYLSDKEVE  139



>ref|XP_009147956.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Brassica 
rapa]
Length=489

 Score =   232 bits (591),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA     ER++QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLEL
Sbjct  1    MATPYKAERDIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG+VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+
Sbjct  61   GAGIGRFTGELAQKAGEVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSV  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|EYU33965.1| hypothetical protein MIMGU_mgv1a005263mg [Erythranthe guttata]
Length=491

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q EERE+QKSYW+EHS +LT+E+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAAVQDEEREMQKSYWVEHSVDLTLESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAGQ++A+DFIE  IKKNE INGH  N+KFMCADVTS  L+F D S 
Sbjct  61   GAGIGRFTGELAKKAGQLVALDFIEGSIKKNEIINGHHKNVKFMCADVTSPSLSFPDGSF  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  121  DLIFSNWLLMYLSDKEVEN  139



>ref|XP_010263678.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nelumbo 
nucifera]
Length=489

 Score =   232 bits (591),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 111/139 (80%), Positives = 129/139 (93%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA QG ERE+QKSYWIEHS +LTVEAMMLDSKA+DLDKEERPEVLS+LP ++GKSVLEL
Sbjct  1    MAA-QGGEREIQKSYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSLLPPFKGKSVLEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA++AGQV+A+DFIE+VIKKNE+INGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTGELAKEAGQVLALDFIENVIKKNESINGHHKNVKFLCADVTSPDLQIASESV  119

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  120  DLIFSNWLLMYLSDKEVEN  138



>gb|KDP23922.1| hypothetical protein JCGZ_27082 [Jatropha curcas]
Length=510

 Score =   232 bits (592),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 126/133 (95%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+Q++YW+EHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP+YEGKSVLE GAGIGR
Sbjct  26   EEREIQRNYWMEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPSYEGKSVLEFGAGIGR  85

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGE+AQ AGQ++A+DFI+SVIKKNE+INGH  N+KF+CADVTS+DL FS+ S+DLIFSN
Sbjct  86   FTGEIAQNAGQLVALDFIDSVIKKNESINGHYKNVKFICADVTSQDLKFSEGSVDLIFSN  145

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  146  WLLMYLSDKEVEN  158



>gb|KFK39125.1| hypothetical protein AALP_AA3G204100 [Arabis alpina]
Length=491

 Score =   231 bits (590),  Expect = 7e-70, Method: Compositional matrix adjust.
 Identities = 109/138 (79%), Positives = 126/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EER++QK+YWIEHS +LTVE+MMLDSKA+DLDKEERPEVLS+LP YEGKSVLEL
Sbjct  1    MAASYEEERDIQKNYWIEHSVDLTVESMMLDSKASDLDKEERPEVLSLLPPYEGKSVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKAG++IA+DFI+SVI KNE++NGH  N+KFMCADVTS DL  +D S+
Sbjct  61   GAGIGRFTGELAQKAGELIALDFIDSVINKNESVNGHYKNVKFMCADVTSPDLKITDGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>gb|AFK34653.1| unknown [Lotus japonicus]
Length=198

 Score =   222 bits (566),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EEREVQKSYWIEHSS+L++E+MMLDS A++LDKEERPEVLS+LPA E KSV+ELGAGIGR
Sbjct  15   EEREVQKSYWIEHSSDLSMESMMLDSNASNLDKEERPEVLSLLPAIESKSVIELGAGIGR  74

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+K+GQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  75   FTGELAKKSGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLHVSEGSVDLIFSN  134

Query  534  WLLMYLSDQEVES  572
            WLLMYLSDQEVE+
Sbjct  135  WLLMYLSDQEVEN  147



>ref|XP_009776424.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
sylvestris]
Length=499

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 124/133 (93%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER+VQK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  15   QERDVQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  74

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELA+ AGQ++A+DFIES IKKNE+IN H  N+KFMCADVTS DL FS ES+DLIFSN
Sbjct  75   FTSELAKNAGQLLALDFIESAIKKNESINSHHKNVKFMCADVTSPDLKFSPESVDLIFSN  134

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EV+S
Sbjct  135  WLLMYLSDEEVQS  147



>dbj|BAD80838.1| phosphoethanolamine N-methyltransferase [Atriplex nummularia]
Length=503

 Score =   231 bits (590),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 113/140 (81%), Positives = 123/140 (88%), Gaps = 2/140 (1%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            SAM     EEREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVL
Sbjct  4    SAMGV--NEEREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVL  61

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPN  121

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S+D+IFSNWLLMYLSD+EVE
Sbjct  122  SVDIIFSNWLLMYLSDEEVE  141



>gb|AER10512.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
 gb|AER10513.1| phosphoethanolamine N-methyltransferase [Pyrus betulifolia]
Length=492

 Score =   231 bits (589),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 108/137 (79%), Positives = 126/137 (92%), Gaps = 0/137 (0%)
 Frame = +3

Query  159  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  338
            A+  GEEREVQK+YW+EHS++LTVEAMMLDS A+DLDKEERPEVLSMLP YEG+SV+ELG
Sbjct  3    ASANGEEREVQKNYWVEHSADLTVEAMMLDSNASDLDKEERPEVLSMLPPYEGQSVVELG  62

Query  339  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  518
            AGIGRFTGELA+KAGQ++A+DFI+SVIKKNE+INGH  N+KFMCADV S DL  S+ S+D
Sbjct  63   AGIGRFTGELAEKAGQLVALDFIDSVIKKNESINGHHKNVKFMCADVASPDLKISEGSVD  122

Query  519  LIFSNWLLMYLSDQEVE  569
            LIFSNWLLMYLSD+EVE
Sbjct  123  LIFSNWLLMYLSDKEVE  139



>gb|EPS65842.1| hypothetical protein M569_08933, partial [Genlisea aurea]
Length=487

 Score =   231 bits (588),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 109/133 (82%), Positives = 125/133 (94%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREVQKSYWIEHS +LTVEAMMLDSKA++LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  2    QEREVQKSYWIEHSGDLTVEAMMLDSKASELDKEERPEVLSLLPSYEGKSVLELGAGIGR  61

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGE+A+KA QV+A+DFIESVIKKNE INGH  N+KFMCADVTS DL+F + S+DLIFSN
Sbjct  62   FTGEIAKKADQVVALDFIESVIKKNEIINGHHKNVKFMCADVTSSDLSFPEGSLDLIFSN  121

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  122  WLLMYLSDEEVEN  134



>ref|XP_006346642.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Solanum 
tuberosum]
Length=500

 Score =   231 bits (589),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/134 (81%), Positives = 124/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            GEER++QK+YW+EH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIG
Sbjct  15   GEERDIQKNYWMEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIG  74

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFT ELA+ AGQ+IA+DFI+S IKKN++IN H  N+KFMCADVTS DL FS ES+DLIFS
Sbjct  75   RFTSELAKNAGQLIALDFIDSAIKKNKSINKHHKNVKFMCADVTSPDLKFSPESVDLIFS  134

Query  531  NWLLMYLSDQEVES  572
            NWLLMYLSD+EV+S
Sbjct  135  NWLLMYLSDEEVQS  148



>ref|XP_010461752.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Camelina 
sativa]
Length=492

 Score =   230 bits (587),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  128  WLLMYLSDKEVE  139



>dbj|BAC57960.1| phosphoethanolamine N-methyltransferase [Aster tripolium]
Length=493

 Score =   230 bits (586),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 107/137 (78%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  159  AAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELG  338
                G+ERE+QK+YW+EHS +LTVE+MMLDS A+DLDKEERPEVLS+LP+YEGK VLELG
Sbjct  3    GVINGDEREIQKNYWVEHSVDLTVESMMLDSMASDLDKEERPEVLSLLPSYEGKRVLELG  62

Query  339  AGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESID  518
            AGIGRFTGELA+ AG+VIA+DFIESV+KKNE+INGH  N+KFMCADVTS DL F  ESID
Sbjct  63   AGIGRFTGELAKTAGEVIALDFIESVVKKNESINGHCKNVKFMCADVTSPDLRFPAESID  122

Query  519  LIFSNWLLMYLSDQEVE  569
            LIFSNWLLMYLSD+EVE
Sbjct  123  LIFSNWLLMYLSDKEVE  139



>ref|XP_009104804.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 [Brassica 
rapa]
Length=506

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  501  SDESIDLIFSNWLLMYLSDQEVE  569
            S+ES+DLIFSNWLLMYLSD+EVE
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVE  152



>emb|CDX68222.1| BnaA07g22620D [Brassica napus]
Length=506

 Score =   230 bits (586),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 110/143 (77%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
            +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  501  SDESIDLIFSNWLLMYLSDQEVE  569
            S+ES+DLIFSNWLLMYLSD+EVE
Sbjct  130  SNESMDLIFSNWLLMYLSDKEVE  152



>ref|XP_010461683.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=492

 Score =   229 bits (585),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 122/132 (92%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER +QKSYW+EHSS+LTVEAMMLDSKA+DLD+EERPEVLS++P YEGKSVLELGAGIGR
Sbjct  8    EERHIQKSYWMEHSSDLTVEAMMLDSKASDLDREERPEVLSLIPPYEGKSVLELGAGIGR  67

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +  SIDLIFSN
Sbjct  68   FTGELAQKAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIAVGSIDLIFSN  127

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  128  WLLMYLSDKEVE  139



>gb|KDO63824.1| hypothetical protein CISIN_1g043471mg [Citrus sinensis]
Length=485

 Score =   229 bits (584),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EVE
Sbjct  129  LLMYLSDKEVE  139



>gb|AEY75253.1| phosphoethanolamine N-methyltransferase [Atriplex canescens]
Length=494

 Score =   229 bits (584),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            EREV K YW+EHS +LTVEAMMLDS+A+DLDKEERPEVLSMLP YEGKSVLELGAGIGRF
Sbjct  11   EREVFKKYWVEHSVDLTVEAMMLDSQASDLDKEERPEVLSMLPPYEGKSVLELGAGIGRF  70

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA+KAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS  LN S  S+D+IFSNW
Sbjct  71   TGELAEKAGQVIALDFIESVIKKNECINGHYKNVKFMCADVTSPSLNISPNSVDIIFSNW  130

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EVE
Sbjct  131  LLMYLSDEEVE  141



>gb|AFW83641.1| hypothetical protein ZEAMMB73_560974 [Zea mays]
Length=244

 Score =   221 bits (564),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 106/133 (80%), Positives = 116/133 (87%), Gaps = 0/133 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
             EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIG
Sbjct  18   AEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIG  77

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFS
Sbjct  78   RFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFS  137

Query  531  NWLLMYLSDQEVE  569
            NWLLMYLSD+EVE
Sbjct  138  NWLLMYLSDEEVE  150



>ref|XP_010274723.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Nelumbo nucifera]
Length=489

 Score =   229 bits (583),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q EEREVQKSYWIEHSSELT+EAMMLDSKAADLDKEERPEVLS+LP ++GK VLEL
Sbjct  1    MAA-QVEEREVQKSYWIEHSSELTIEAMMLDSKAADLDKEERPEVLSLLPPFKGKDVLEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT E A++A QV+A+DFIESVIKKNE++NGH  N+KF+CADVTS DL  + ES+
Sbjct  60   GAGIGRFTSEFAKEANQVLALDFIESVIKKNESVNGHFKNVKFLCADVTSPDLKIAPESV  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  120  DLIFSNWLLMYLSDKEVE  137



>dbj|BAD93609.1| hypothetical protein [Cucumis melo]
Length=211

 Score =   220 bits (561),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 121/143 (85%), Gaps = 0/143 (0%)
 Frame = +3

Query  144  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
              +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKS
Sbjct  3    TPTPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKS  62

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            VLELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S
Sbjct  63   VLELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKIS  122

Query  504  DESIDLIFSNWLLMYLSDQEVES  572
            + S+DLIFSNWLLMYLSD EV++
Sbjct  123  ENSVDLIFSNWLLMYLSDIEVKN  145



>ref|XP_006490771.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Citrus sinensis]
Length=489

 Score =   229 bits (583),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 125/136 (92%), Gaps = 1/136 (1%)
 Frame = +3

Query  162  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  341
            A QGE RE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GA
Sbjct  2    AGQGE-REIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGA  60

Query  342  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  521
            GIGRFTGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D+
Sbjct  61   GIGRFTGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDM  120

Query  522  IFSNWLLMYLSDQEVE  569
            +FSNWLLMYLSD+EVE
Sbjct  121  MFSNWLLMYLSDKEVE  136



>ref|XP_006451624.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
 ref|XP_006490770.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Citrus sinensis]
 gb|ESR64864.1| hypothetical protein CICLE_v10010749mg [Citrus clementina]
Length=492

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 104/131 (79%), Positives = 122/131 (93%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ERE+QK+YW+EHS+ LTVEAMMLDSKA+DLDKEERPEVLS+LP YEGK+VLE GAGIGRF
Sbjct  9    EREIQKNYWMEHSANLTVEAMMLDSKASDLDKEERPEVLSLLPPYEGKTVLEFGAGIGRF  68

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA+KAG VIA+DFI+SVIKKNE +NGH  N+KFMCADVTS DL FS++S+D++FSNW
Sbjct  69   TGELAKKAGHVIALDFIDSVIKKNEEVNGHFENVKFMCADVTSPDLTFSEDSVDMMFSNW  128

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EVE
Sbjct  129  LLMYLSDKEVE  139



>gb|AGI56231.1| phosphoethanolamine N-methyltransferase [Lycium barbarum]
Length=498

 Score =   229 bits (583),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 108/133 (81%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER++QK+YWIEH+SELTVEAMMLDSKAADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  15   QERDIQKNYWIEHTSELTVEAMMLDSKAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  74

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELA+ AGQ+IA+DFIES IKKNE+IN H  N+KFMCADVTS DL  S ES+DLIFSN
Sbjct  75   FTSELAKNAGQLIALDFIESAIKKNESINKHHKNVKFMCADVTSPDLKISPESVDLIFSN  134

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EV+S
Sbjct  135  WLLMYLSDEEVQS  147



>pir||H96762 hypothetical protein F6D5.1 [imported] - Arabidopsis thaliana
 gb|AAG51806.1|AC079676_1 phosphoethanolamine N-methyltransferase, putative; 6854-3993 
[Arabidopsis thaliana]
Length=555

 Score =   230 bits (586),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/163 (69%), Positives = 134/163 (82%), Gaps = 2/163 (1%)
 Frame = +3

Query  84   FSV-RIAFPGFLDFFYLFTAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAA  260
            FS+ R  +P      +LF ++    MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+
Sbjct  41   FSIHRFHYPREKIVSFLFPSVFSRIMASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKAS  99

Query  261  DLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETIN  440
            DLDKEERPE+L+ LP  EG +VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE IN
Sbjct  100  DLDKEERPEILAFLPPIEGTTVLEFGAGIGRFTTELAQKAGQVIAVDFIESVIKKNENIN  159

Query  441  GHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            GH  N+KF+CADVTS ++NF +ES+DLIFSNWLLMYLSDQEVE
Sbjct  160  GHYKNVKFLCADVTSPNMNFPNESMDLIFSNWLLMYLSDQEVE  202



>emb|CDY11100.1| BnaC06g23520D [Brassica napus]
Length=506

 Score =   228 bits (581),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/143 (76%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            I  S   ++ GEERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EG+
Sbjct  10   ISPSFPNSYSGEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGE  69

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
             VLE GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KFMCADVTS D+ F
Sbjct  70   KVLEFGAGIGRFTSELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFMCADVTSPDMKF  129

Query  501  SDESIDLIFSNWLLMYLSDQEVE  569
            S ES+DL+FSNWLLMYLSD+EVE
Sbjct  130  SSESMDLVFSNWLLMYLSDKEVE  152



>ref|XP_010097561.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
 gb|EXB69093.1| Phosphoethanolamine N-methyltransferase 1 [Morus notabilis]
Length=519

 Score =   228 bits (582),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/134 (80%), Positives = 125/134 (93%), Gaps = 0/134 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            GEERE+QK+YW E+S++LT+E+MMLDSKA+DLDKEERPEVLS+LP +EGKSVLELGAGIG
Sbjct  11   GEEREIQKTYWTENSADLTIESMMLDSKASDLDKEERPEVLSVLPPFEGKSVLELGAGIG  70

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELAQKAGQV+A+DFIESVIKKNE INGH  N+KFMCADVTS +L  S+ S+DLIFS
Sbjct  71   RFTGELAQKAGQVLALDFIESVIKKNEEINGHYENVKFMCADVTSPELKISEGSVDLIFS  130

Query  531  NWLLMYLSDQEVES  572
            NWLLMYLSD+EVE+
Sbjct  131  NWLLMYLSDKEVEN  144



>ref|XP_003528975.2| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN44632.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=531

 Score =   229 bits (583),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 107/151 (71%), Positives = 134/151 (89%), Gaps = 2/151 (1%)
 Frame = +3

Query  126  YLFTAIVQSAMAAFQG--EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSM  299
            +LF++  Q  MA+     +ER VQ+SYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+
Sbjct  30   FLFSSFCQPYMASLATVQDERCVQRSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSL  89

Query  300  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  479
            LPAYEGKSV+ELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADV
Sbjct  90   LPAYEGKSVVELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADV  149

Query  480  TSKDLNFSDESIDLIFSNWLLMYLSDQEVES  572
            TS +L+ S+ S+DL+FSNWLLMYLSD+EVE+
Sbjct  150  TSPNLHISEGSVDLMFSNWLLMYLSDKEVEN  180



>sp|Q9M571.1|PEAMT_SPIOL RecName: Full=Phosphoethanolamine N-methyltransferase [Spinacia 
oleracea]
 gb|AAF61950.1|AF237633_1 phosphoethanolamine N-methyltransferase [Spinacia oleracea]
Length=494

 Score =   227 bits (579),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 112/140 (80%), Positives = 122/140 (87%), Gaps = 2/140 (1%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            SAM   Q  EREV K YWIEHS +LTVEAMMLDS+A+DLDK ERPEVLSMLP YEGKSVL
Sbjct  4    SAMGVLQ--EREVFKKYWIEHSVDLTVEAMMLDSQASDLDKVERPEVLSMLPPYEGKSVL  61

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTGELA+KA QVIA+DFIESVIKKNE+INGH  N+KFMCADVTS  LN S  
Sbjct  62   ELGAGIGRFTGELAEKASQVIALDFIESVIKKNESINGHYKNVKFMCADVTSPSLNISPN  121

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S+D+IFSNWLLMYLSD+EVE
Sbjct  122  SVDIIFSNWLLMYLSDEEVE  141



>ref|XP_010686587.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EV+
Sbjct  130  WLLMYLSDEEVQ  141



>dbj|BAE07178.1| phosphoethanolamine N-methyltransferase [Beta vulgaris]
Length=494

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   QEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTG+LA+KAGQVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLAKKAGQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EV+
Sbjct  130  WLLMYLSDEEVQ  141



>ref|XP_009782224.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Nicotiana 
sylvestris]
Length=496

 Score =   227 bits (578),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 105/138 (76%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            +AA   +ERE+QKSYW+E ++ELT+EAMMLDS+A+DLDKE+RPEVLS+LP+YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWMEQAAELTLEAMMLDSEASDLDKEDRPEVLSLLPSYEGKSVLEL  65

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTG+LA+KAGQ+ A+DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGDLAEKAGQLTALDFVEGVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EV+
Sbjct  126  DLIFSNWLLMYLSDKEVQ  143



>ref|XP_011039130.1| PREDICTED: phosphomethylethanolamine N-methyltransferase [Populus 
euphratica]
Length=490

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 126/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  120  DLIFSNWLLMYLSDKEVEN  138



>ref|XP_011014101.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Populus euphratica]
Length=490

 Score =   226 bits (576),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 108/139 (78%), Positives = 126/139 (91%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA Q EERE+QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLEL
Sbjct  1    MAA-QVEEREIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELAQKA QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLNFS+ S+
Sbjct  60   GAGIGRFTGELAQKASQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNFSEGSV  119

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  120  DLIFSNWLLMYLSDKEVEN  138



>gb|KDP23923.1| hypothetical protein JCGZ_27083 [Jatropha curcas]
Length=491

 Score =   226 bits (576),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/139 (77%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   EERE+QK+YWIE+S  LTVEAMMLDS A+ LDKEERPEVLSMLP YEGKSVLE 
Sbjct  1    MAAAHVEEREIQKNYWIENSDGLTVEAMMLDSNASLLDKEERPEVLSMLPPYEGKSVLEF  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGE+AQ AGQ++A+DFI++VIKKNE INGH  N+KF+CADVTS+DL FS+ES+
Sbjct  61   GAGIGRFTGEIAQNAGQLVAVDFIDNVIKKNERINGHHKNVKFICADVTSEDLKFSEESV  120

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+E+E+
Sbjct  121  DLIFSNWLLMYLSDKEIEN  139



>ref|XP_008799221.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Phoenix dactylifera]
Length=492

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 122/139 (88%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEE-REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            MAAF GEE R VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLE
Sbjct  1    MAAFSGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLE  60

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES
Sbjct  61   LGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAES  120

Query  513  IDLIFSNWLLMYLSDQEVE  569
            +DLIFSNWLLMYLSD EVE
Sbjct  121  VDLIFSNWLLMYLSDNEVE  139



>gb|EYU24136.1| hypothetical protein MIMGU_mgv1a005261mg [Erythranthe guttata]
Length=491

 Score =   226 bits (575),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA   +EREVQK+YW+EHS  LT+E MMLDSKA+DLDKEERPEVL+MLP YEGKS+LEL
Sbjct  1    MAAITEQEREVQKNYWVEHSVNLTLEDMMLDSKASDLDKEERPEVLAMLPPYEGKSILEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA+KAG V A+DFIESVIKKNE IN H  N++FMCADVTS DLNF + S+
Sbjct  61   GAGIGRFTGELAKKAGHVTALDFIESVIKKNEAINKHHKNVEFMCADVTSPDLNFPEGSL  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            D+IFSNWLLMYLSD EVE
Sbjct  121  DMIFSNWLLMYLSDAEVE  138



>gb|AAM97038.1| phosphoethanolamine N-methyltransferase, putative [Arabidopsis 
thaliana]
Length=376

 Score =   222 bits (565),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSDQEVE
Sbjct  140  WLLMYLSDQEVE  151



>ref|XP_008799219.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Phoenix dactylifera]
Length=494

 Score =   225 bits (573),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 122/141 (87%), Gaps = 3/141 (2%)
 Frame = +3

Query  156  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  326
            MAAF G   EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAFSGAGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSV  60

Query  327  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  506
            LELGAGIGRFTGELA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    
Sbjct  61   LELGAGIGRFTGELAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEA  120

Query  507  ESIDLIFSNWLLMYLSDQEVE  569
            ES+DLIFSNWLLMYLSD EVE
Sbjct  121  ESVDLIFSNWLLMYLSDNEVE  141



>ref|NP_177501.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 sp|Q9C6B9.2|PEAM3_ARATH RecName: Full=Phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35481.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=490

 Score =   224 bits (572),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA++ GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE 
Sbjct  1    MASY-GEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEF  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+
Sbjct  60   GAGIGRFTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESM  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSDQEVE
Sbjct  120  DLIFSNWLLMYLSDQEVE  137



>ref|XP_008464197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=493

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 104/134 (78%), Positives = 123/134 (92%), Gaps = 0/134 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPE+LS+LP Y+GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEILSLLPPYDGKTVLELGAGIG  67

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELAQKAG VIA+DFIE+ IKKNE IN H  N+KF+CADVTS +L  SDES+DLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNERINSHHKNVKFVCADVTSSELKISDESVDLIFS  127

Query  531  NWLLMYLSDQEVES  572
            NWLLMYLSD+EVE+
Sbjct  128  NWLLMYLSDKEVEN  141



>ref|XP_010678114.1| PREDICTED: phosphoethanolamine N-methyltransferase [Beta vulgaris 
subsp. vulgaris]
Length=494

 Score =   224 bits (572),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EEREV K YWIEHS +LTVEAMMLDSKA+DLDKEERPEVLSMLP YEGKSVLELGAGIGR
Sbjct  10   EEREVFKKYWIEHSVDLTVEAMMLDSKASDLDKEERPEVLSMLPPYEGKSVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTG+LA KA QVIA+DFIES IKKNE +NGH  N+KFMCADVTS  LN S  S+D+IFSN
Sbjct  70   FTGDLANKADQVIALDFIESAIKKNECVNGHYKNVKFMCADVTSPSLNISPNSVDIIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EV+
Sbjct  130  WLLMYLSDEEVQ  141



>ref|XP_008799258.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Phoenix dactylifera]
Length=447

 Score =   223 bits (568),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 109/142 (77%), Positives = 123/142 (87%), Gaps = 4/142 (3%)
 Frame = +3

Query  156  MAAFQG----EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
            MAA  G    EER VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS
Sbjct  1    MAAINGGGGEEERMVQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKS  60

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            VLELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+ NGHL NI F+CADVTS DL   
Sbjct  61   VLELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESANGHLKNISFVCADVTSPDLMIE  120

Query  504  DESIDLIFSNWLLMYLSDQEVE  569
             ES+DLIFSNWLLMYLSD EVE
Sbjct  121  AESVDLIFSNWLLMYLSDNEVE  142



>ref|XP_007152684.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
 gb|ESW24678.1| hypothetical protein PHAVU_004G150500g [Phaseolus vulgaris]
Length=497

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/144 (75%), Positives = 128/144 (89%), Gaps = 3/144 (2%)
 Frame = +3

Query  150  SAMAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            +++A  QG   +ER VQKSYWIEH++EL+VE+MMLDS A+ LDKEERPEVLS+LPAYEGK
Sbjct  2    ASLAMVQGGGVDERCVQKSYWIEHTTELSVESMMLDSNASHLDKEERPEVLSLLPAYEGK  61

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
            SVLELGAGIGRFTGELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L  
Sbjct  62   SVLELGAGIGRFTGELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLQI  121

Query  501  SDESIDLIFSNWLLMYLSDQEVES  572
            S+ S+DLIFSNWLLMYLSD+EVE+
Sbjct  122  SEGSVDLIFSNWLLMYLSDKEVEN  145



>ref|XP_006843796.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
 gb|ERN05471.1| hypothetical protein AMTR_s00007p00250490 [Amborella trichopoda]
Length=489

 Score =   224 bits (571),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 110/138 (80%), Positives = 126/138 (91%), Gaps = 2/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA QGE RE+QKSYWIEHSS+LTVEAMMLDSKAA+LDKEERPEVLS+LP ++GK+VLEL
Sbjct  1    MAA-QGE-REIQKSYWIEHSSDLTVEAMMLDSKAAELDKEERPEVLSLLPPFKGKNVLEL  58

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTGELA++AG V A+DFI+SVIKKNE INGH  NIKF+CADVTS +L F+ ES+
Sbjct  59   GAGIGRFTGELAKEAGHVTALDFIKSVIKKNEKINGHYKNIKFVCADVTSPELQFAPESV  118

Query  516  DLIFSNWLLMYLSDQEVE  569
            DL+FSNWLLMYLSD EVE
Sbjct  119  DLLFSNWLLMYLSDAEVE  136



>gb|EMT21187.1| Phosphoethanolamine N-methyltransferase 1 [Aegilops tauschii]
Length=503

 Score =   224 bits (572),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  20   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  80   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  140  WLLMYLSDAEVE  151



>gb|AAF79704.1|AC020889_12 T1N15.22 [Arabidopsis thaliana]
Length=180

 Score =   214 bits (546),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>ref|XP_006390538.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
 gb|ESQ27824.1| hypothetical protein EUTSA_v10018431mg [Eutrema salsugineum]
Length=504

 Score =   224 bits (571),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 105/142 (74%), Positives = 125/142 (88%), Gaps = 0/142 (0%)
 Frame = +3

Query  144  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
            + S+ +    EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  +G++
Sbjct  10   IASSFSKNSWEEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIDGRT  69

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            VLE GAGIGRFT ELAQKAG+VIA+DFI+SVIKKNE INGH  N++FMCADVTS D+NFS
Sbjct  70   VLEFGAGIGRFTSELAQKAGKVIAVDFIDSVIKKNENINGHYKNVEFMCADVTSPDMNFS  129

Query  504  DESIDLIFSNWLLMYLSDQEVE  569
            DES+DLIFSNWLLMYLSD+EVE
Sbjct  130  DESMDLIFSNWLLMYLSDKEVE  151



>emb|CDM83845.1| unnamed protein product [Triticum aestivum]
Length=504

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  141  WLLMYLSDAEVE  152



>gb|EMS54147.1| Phosphoethanolamine N-methyltransferase 1 [Triticum urartu]
Length=504

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  21   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  80

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  81   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  140

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  141  WLLMYLSDAEVE  152



>gb|ACV89824.1| S-adenosyl-L-methionine:phosphoethanolamine N-methyltransferase 
[Triticum aestivum]
Length=505

 Score =   224 bits (571),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  22   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  81

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  82   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  141

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  142  WLLMYLSDAEVE  153



>ref|XP_004161835.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
1 [Cucumis sativus]
Length=527

 Score =   224 bits (572),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 106/136 (78%), Positives = 123/136 (90%), Gaps = 0/136 (0%)
 Frame = +3

Query  165  FQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAG  344
            F G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAG
Sbjct  40   FTGQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAG  99

Query  345  IGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLI  524
            IGRFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLI
Sbjct  100  IGRFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLI  159

Query  525  FSNWLLMYLSDQEVES  572
            FSNWLLMYLSD+EVES
Sbjct  160  FSNWLLMYLSDKEVES  175



>ref|XP_003569614.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Brachypodium 
distachyon]
Length=502

 Score =   224 bits (570),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  19   EEREAQKKYWEEHSRDLTVEAMMLDSHAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  78

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  79   FTGELAKTAGHVLAMDFIESVIKKNESINGHYKNASFMCADVTSPDLVIEDNSIDLIFSN  138

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  139  WLLMYLSDEEVE  150



>ref|XP_011008809.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X2 [Populus euphratica]
Length=490

 Score =   223 bits (569),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  6    EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  65

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  66   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  125

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  126  WLLMYLSDKEVEN  138



>ref|XP_004503268.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cicer 
arietinum]
Length=490

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 123/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYW++H ++L+VEAMMLDSKA+DLDKEERPEVLS+LPAYEGKSV+ELGAGIGR
Sbjct  6    DEREIQKSYWVQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPAYEGKSVIELGAGIGR  65

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS ++  S+ S+D+IFSN
Sbjct  66   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPNMKVSEGSVDVIFSN  125

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  126  WLLMYLSDNEVEN  138



>ref|XP_006644536.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=499

 Score =   223 bits (569),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS +LTVEAMMLDS+A DLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRATDLDKEERPEILSLLPSYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFIESVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  76   FTGELAKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTSPDLMIEDNSIDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  136  WLLMYLSDEEVE  147



>ref|XP_011008808.1| PREDICTED: phosphomethylethanolamine N-methyltransferase isoform 
X1 [Populus euphratica]
Length=506

 Score =   224 bits (570),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  142  WLLMYLSDKEVEN  154



>ref|XP_010416170.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Camelina 
sativa]
Length=490

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYRNVKFMCADVTSPDMKFPNDSM  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  120  DLIFSNWLLMYLSDKEVE  137



>gb|ACJ83326.1| unknown [Medicago truncatula]
Length=221

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EV++
Sbjct  126  VDLIFSNWLLMYLSDEEVKN  145



>dbj|BAH01482.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE64589.1| hypothetical protein OsJ_19441 [Oryza sativa Japonica Group]
Length=495

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 106/131 (81%), Positives = 118/131 (90%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+ Q+SYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRAADLDKEERPEVLSVLPSYKGKSVLELGAGIGRF  72

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDNSIDLIFSNW  132

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EVE
Sbjct  133  LLMYLSDEEVE  143



>ref|XP_009595958.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Nicotiana 
tomentosiformis]
Length=496

 Score =   223 bits (568),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/138 (75%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            +AA   +ERE+QKSYWIE ++ELT++AMMLDS+A+DLDKE+RPEVLS+LP YEGKSVLEL
Sbjct  6    IAAAPEQEREIQKSYWIEQAAELTLKAMMLDSEASDLDKEDRPEVLSLLPPYEGKSVLEL  65

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFTG LA+KAGQ+  +DF+E VIKKNE+INGH  N+KFMCADVTS DL FS ES+
Sbjct  66   GAGIGRFTGGLAEKAGQLTTLDFVEDVIKKNESINGHHKNVKFMCADVTSPDLTFSPESV  125

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EV+
Sbjct  126  DLIFSNWLLMYLSDKEVQ  143



>ref|XP_010428286.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X2 [Camelina sativa]
Length=492

 Score =   223 bits (568),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 107/138 (78%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA+ GEERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  3    MAAY-GEEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  61

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  62   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSM  121

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  122  DLIFSNWLLMYLSDKEVE  139



>ref|XP_002322102.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
 gb|EEF06229.2| hypothetical protein POPTR_0015s04540g [Populus trichocarpa]
Length=516

 Score =   223 bits (569),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER++QK YW+++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGR
Sbjct  22   EERDIQKKYWMDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGR  81

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSN
Sbjct  82   FTGELAQKAGQVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSN  141

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  142  WLLMYLSDKEVEN  154



>gb|KEH21429.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=469

 Score =   222 bits (565),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  131  WLLMYLSDNEVEN  143



>gb|KEH21430.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=456

 Score =   221 bits (564),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  131  WLLMYLSDNEVEN  143



>ref|XP_004137500.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 ref|XP_004161836.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
2 [Cucumis sativus]
 gb|KGN64173.1| hypothetical protein Csa_1G042800 [Cucumis sativus]
Length=493

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 105/134 (78%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            G+EREVQK+YWIEH+++LTVEAMMLDS+A+ LDKEERPEVLS+LP  +GK+VLELGAGIG
Sbjct  8    GQEREVQKNYWIEHTADLTVEAMMLDSQASYLDKEERPEVLSLLPPCDGKTVLELGAGIG  67

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELAQKAG VIA+DFIE+ IKKNE+ N H  N+KF+CADVTS +L  SDESIDLIFS
Sbjct  68   RFTGELAQKAGNVIALDFIENAIKKNESTNSHHKNVKFVCADVTSSELKISDESIDLIFS  127

Query  531  NWLLMYLSDQEVES  572
            NWLLMYLSD+EVES
Sbjct  128  NWLLMYLSDKEVES  141



>dbj|BAJ97525.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=508

 Score =   222 bits (565),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE QK YW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP+YEGKSVLELGAGIGR
Sbjct  25   EEREAQKRYWEEHSRDLTVEAMMLDSRAADLDKEERPEILSLLPSYEGKSVLELGAGIGR  84

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+AMDFI SVIKKNE+INGH  N  FMCADVTS DL   D SIDLIFSN
Sbjct  85   FTGELAKTAGHVLAMDFIGSVIKKNESINGHYENASFMCADVTSPDLVIEDNSIDLIFSN  144

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  145  WLLMYLSDEEVE  156



>ref|XP_003631125.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AET05601.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=488

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  5    DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  64

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  65   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  124

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  125  WLLMYLSDNEVEN  137



>gb|AET05600.2| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=494

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  131  WLLMYLSDNEVEN  143



>ref|XP_003631124.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=495

 Score =   221 bits (564),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 102/133 (77%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE+QKSYWI+H ++L+VEAMMLDSKA+DLDKEERPEVLS+LP YEGKSV+ELGAGIGR
Sbjct  11   DEREIQKSYWIQHCADLSVEAMMLDSKASDLDKEERPEVLSLLPEYEGKSVIELGAGIGR  70

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELAQKAGQ++A+DFIES IKKNE+INGH  N KF+CADVTS  ++ S+ S+D+IFSN
Sbjct  71   FTGELAQKAGQLLAVDFIESAIKKNESINGHYKNAKFLCADVTSPKMDVSEGSVDVIFSN  130

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD EVE+
Sbjct  131  WLLMYLSDNEVEN  143



>ref|NP_001148925.1| LOC100282545 [Zea mays]
 gb|ACG33501.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 109/144 (76%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +3

Query  138  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  317
            A V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEG
Sbjct  7    ATVVSLNGKMGAEERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEG  66

Query  318  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  497
            KSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL 
Sbjct  67   KSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLV  126

Query  498  FSDESIDLIFSNWLLMYLSDQEVE  569
                SIDLIFSNWLLMYLSD+EVE
Sbjct  127  LQANSIDLIFSNWLLMYLSDEEVE  150



>ref|XP_002887491.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH63750.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=490

 Score =   221 bits (563),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 103/136 (76%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  162  AFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGA  341
            A  GEERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L++LP  EGK+VLE GA
Sbjct  2    AVYGEEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILALLPPIEGKTVLEFGA  61

Query  342  GIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDL  521
            GIGRFT  LA KAGQ+IA+DFIESVIKKN+ INGH  N+KF+CADVTS D+NF +ES+DL
Sbjct  62   GIGRFTTNLAHKAGQLIAVDFIESVIKKNQNINGHYKNVKFLCADVTSPDMNFPNESMDL  121

Query  522  IFSNWLLMYLSDQEVE  569
            IFSNWLLMYLSD+EVE
Sbjct  122  IFSNWLLMYLSDREVE  137



>ref|NP_001043957.1| Os01g0695100 [Oryza sativa Japonica Group]
 dbj|BAF05871.1| Os01g0695100 [Oryza sativa Japonica Group]
Length=499

 Score =   221 bits (564),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  136  WLLMYLSDEEVE  147



>gb|AAS57723.1| phosphoethanolamine N-methyltransferase [Oryza sativa]
Length=499

 Score =   221 bits (564),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  136  WLLMYLSDEEVE  147



>ref|NP_974139.2| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
 gb|AEE35480.1| putative phosphoethanolamine N-methyltransferase 3 [Arabidopsis 
thaliana]
Length=504

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 104/132 (79%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG +VLE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTVLEFGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSDQEVE
Sbjct  140  WLLMYLSDQEVE  151



>gb|KFK41794.1| hypothetical protein AALP_AA2G173000 [Arabis alpina]
Length=505

 Score =   221 bits (564),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 125/143 (87%), Gaps = 0/143 (0%)
 Frame = +3

Query  141  IVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGK  320
            ++ S+     GEERE+QK+YW EHS++L+VE+MMLDS+AADLDKEERPE++++LP  EGK
Sbjct  10   MISSSFPKNLGEEREIQKNYWKEHSADLSVESMMLDSQAADLDKEERPEIVALLPPIEGK  69

Query  321  SVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNF  500
            +VLE GAGIGRFT ELA+KAG VIA+DFI++ IKKN+ INGH  N+KFMCADVTS D+ F
Sbjct  70   TVLEFGAGIGRFTTELARKAGHVIAVDFIDNAIKKNQNINGHYKNVKFMCADVTSPDMKF  129

Query  501  SDESIDLIFSNWLLMYLSDQEVE  569
            SDES+DLIFSNWLLMYLSD+EVE
Sbjct  130  SDESMDLIFSNWLLMYLSDKEVE  152



>gb|EEE55232.1| hypothetical protein OsJ_03109 [Oryza sativa Japonica Group]
Length=509

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPE+LS+LP YEGKSVLELGAGIGR
Sbjct  16   EERKAQKSYWEEHSKDLTVEAMMLDSRAADLDKEERPEILSLLPPYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGEL + AG V+AMDFIESVIKKNE+INGH  N  FMCADVT  DL   D SIDLIFSN
Sbjct  76   FTGELVKTAGHVLAMDFIESVIKKNESINGHHKNASFMCADVTCPDLMIEDNSIDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  136  WLLMYLSDEEVE  147



>ref|XP_006302164.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
 gb|EOA35062.1| hypothetical protein CARUB_v10020173mg [Capsella rubella]
Length=503

 Score =   221 bits (563),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW EHS  L+VEAMMLDSKAADLDKEERPE+L++LP  EGK+VLE GAGIGR
Sbjct  19   EEREIQKNYWKEHSVGLSVEAMMLDSKAADLDKEERPEILALLPPIEGKTVLEFGAGIGR  78

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  79   FTTELAQKAGQLIAVDFIESVIKKNKKINGHYKNVKFMCADVTSPDMKFPNDSVDLIFSN  138

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  139  WLLMYLSDKEVE  150



>ref|XP_002456194.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
 gb|EES01314.1| hypothetical protein SORBIDRAFT_03g031950 [Sorghum bicolor]
Length=501

 Score =   221 bits (562),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 109/145 (75%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +3

Query  135  TAIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYE  314
            TA V S       EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP++E
Sbjct  5    TAAVVSVNGKMGVEERQAQKSYWEEHSRNLTVEAMMLDSRAADLDKEERPEVLSLLPSFE  64

Query  315  GKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL  494
            GKSVLELGAGIGRFTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL
Sbjct  65   GKSVLELGAGIGRFTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSEDL  124

Query  495  NFSDESIDLIFSNWLLMYLSDQEVE  569
                 SIDLIFSNWLLMYLSD+EVE
Sbjct  125  VLPASSIDLIFSNWLLMYLSDEEVE  149



>ref|XP_003567962.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Brachypodium distachyon]
Length=501

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/145 (73%), Positives = 124/145 (86%), Gaps = 1/145 (1%)
 Frame = +3

Query  138  AIVQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  317
            A++      F G ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVLS+LP+YEG
Sbjct  5    AVIAVVENGFVGVERKVQKSYWEEHSRDLTVESMMLDSRAKDLDKEERPEVLSILPSYEG  64

Query  318  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDL  494
            K+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE INGH+  NI FMCADVTS +L
Sbjct  65   KTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEEINGHIHNNITFMCADVTSPEL  124

Query  495  NFSDESIDLIFSNWLLMYLSDQEVE  569
               D SIDL+FSNWLLMYLSD+EVE
Sbjct  125  KIEDNSIDLVFSNWLLMYLSDEEVE  149



>ref|XP_004969638.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   220 bits (561),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS +LTVEAMMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGR
Sbjct  16   EERQAQKSYWEEHSRDLTVEAMMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SID+IFSN
Sbjct  76   FTGELAKTAGNVLALDFIESAIKKNESINGHFKNASFMCADVTSQDLVIQANSIDMIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  136  WLLMYLSDEEVE  147



>ref|XP_006365411.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Solanum 
tuberosum]
Length=494

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 126/140 (90%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +A+A   G+ERE+QKSYW+E ++EL +EAMMLDS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPGVGQEREIQKSYWMEQTTELNLEAMMLDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG++A+KAG+++ +DFIE VIKKNE+INGH  N+KF+CADVTS DL F  E
Sbjct  62   ELGAGIGRFTGDIAEKAGELVTVDFIEEVIKKNESINGHHKNVKFVCADVTSPDLTFLPE  121

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S+DLIFSNWLLMYLSD+EV+
Sbjct  122  SVDLIFSNWLLMYLSDEEVQ  141



>ref|XP_010471422.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Camelina sativa]
Length=490

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/138 (77%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MAA+  EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE 
Sbjct  1    MAAYV-EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEF  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+
Sbjct  60   GAGIGRFTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSM  119

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  120  DLIFSNWLLMYLSDKEVE  137



>ref|XP_010921161.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Elaeis 
guineensis]
Length=494

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 107/141 (76%), Positives = 121/141 (86%), Gaps = 3/141 (2%)
 Frame = +3

Query  156  MAAFQG---EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSV  326
            MAA  G   EER VQKSYW+EHS +LTV AMMLDS+A +LDKEERPEVLS+LP Y+GKSV
Sbjct  1    MAAVSGAGEEERMVQKSYWMEHSKDLTVAAMMLDSRATNLDKEERPEVLSLLPPYKGKSV  60

Query  327  LELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSD  506
            LELGAGIGRFTGELA++AG V+A+DFIE+VIKKNE+INGH  N  FMCADVTS DL   +
Sbjct  61   LELGAGIGRFTGELAKEAGHVLALDFIENVIKKNESINGHFTNTSFMCADVTSPDLLIEE  120

Query  507  ESIDLIFSNWLLMYLSDQEVE  569
            ES+DLIFSNWLLMYLSD EVE
Sbjct  121  ESVDLIFSNWLLMYLSDNEVE  141



>gb|AFW83642.1| phosphoethanolamine N-methyltransferase [Zea mays]
Length=502

 Score =   220 bits (560),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ QKSYW EHS  LTVEAMMLDS+AADLDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  19   EERKAQKSYWEEHSKNLTVEAMMLDSRAADLDKEERPEVLSLLPSYEGKSVLELGAGIGR  78

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V+A+DFIES IKKNE+INGH  N  FMCADVTS+DL     SIDLIFSN
Sbjct  79   FTGELAKTAGNVLALDFIESAIKKNESINGHYKNASFMCADVTSQDLVLQANSIDLIFSN  138

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  139  WLLMYLSDEEVE  150



>ref|XP_006393388.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
 gb|ESQ30674.1| hypothetical protein EUTSA_v10012068mg, partial [Eutrema salsugineum]
Length=258

 Score =   213 bits (542),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 103/138 (75%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA    EER +QKSY  E+SS+LTVEA+MLDSK +D DKEERPEVLS++P YEGK+VLEL
Sbjct  1    MATPYKEERVIQKSYLKENSSDLTVEAIMLDSKDSDPDKEERPEVLSLIPPYEGKTVLEL  60

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIG FTGELAQKAG+VIA+DFIES IKKN ++NGH  N+KFMCADV S DL  +D SI
Sbjct  61   GAGIGHFTGELAQKAGEVIALDFIESAIKKNASVNGHYKNVKFMCADVRSPDLKITDASI  120

Query  516  DLIFSNWLLMYLSDQEVE  569
            DLIFSNWLLMYLSD+EVE
Sbjct  121  DLIFSNWLLMYLSDKEVE  138



>ref|XP_004137341.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
sativus]
Length=500

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  510  SIDLIFSNWLLMYLSDQEVES  572
            S+DLIFSNWLLMYLSD EV++
Sbjct  125  SVDLIFSNWLLMYLSDIEVKN  145



>ref|XP_004166029.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase-like 
[Cucumis sativus]
Length=500

 Score =   220 bits (560),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +   A   EER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDEERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  510  SIDLIFSNWLLMYLSDQEVES  572
            S+DLIFSNWLLMYLSD EV++
Sbjct  125  SVDLIFSNWLLMYLSDIEVKN  145



>dbj|BAE99185.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
Length=504

 Score =   219 bits (559),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW EHS  L+VEAMMLDSKA+DLDKEERPE+L+ LP  EG + LE GAGIGR
Sbjct  20   EEREIQKNYWKEHSVGLSVEAMMLDSKASDLDKEERPEILAFLPPIEGTTALEFGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQVIA+DFIESVIKKNE INGH  N+KF+CADVTS ++NF +ES+DLIFSN
Sbjct  80   FTTELAQKAGQVIAVDFIESVIKKNENINGHYKNVKFLCADVTSPNMNFPNESMDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSDQEVE
Sbjct  140  WLLMYLSDQEVE  151



>ref|XP_004961340.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=498

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 107/140 (76%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +3

Query  153  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  7    AVANGIGEVERKVQKSYWEEHSKSLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  66

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKNE+INGH  NI FMCADVTS +L   D 
Sbjct  67   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNESINGHHKNITFMCADVTSPNLKIEDN  126

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S DLIFSNWLLMYLSD+EVE
Sbjct  127  SFDLIFSNWLLMYLSDEEVE  146



>ref|XP_010921197.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Elaeis guineensis]
Length=499

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  10   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  70   FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  130  WLLMYLSDNEVE  141



>ref|XP_009385384.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Musa 
acuminata subsp. malaccensis]
Length=497

 Score =   219 bits (558),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 104/133 (78%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            GEEREVQK YWIEHS ELTVEAMMLDS A++LDKEERPEVLS+LP Y+GKSVLELGAGIG
Sbjct  12   GEEREVQKIYWIEHSKELTVEAMMLDSHASELDKEERPEVLSLLPPYKGKSVLELGAGIG  71

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELA++AG V+A+DFIESVI+KNE++NGH  N  FMCADV+S DL+   +S DLIFS
Sbjct  72   RFTGELAKEAGHVLALDFIESVIEKNESLNGHYKNTSFMCADVSSPDLSIEADSFDLIFS  131

Query  531  NWLLMYLSDQEVE  569
            NWLLMYLSD+EVE
Sbjct  132  NWLLMYLSDKEVE  144



>ref|XP_010471421.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Camelina sativa]
Length=504

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKNINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  140  WLLMYLSDKEVE  151



>ref|XP_009404071.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Musa acuminata subsp. malaccensis]
Length=497

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 119/132 (90%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EEREVQKSYW+EHS +LT+EAMMLDS+A++LDKEERPEVLS+LP Y+GKSVLELGAGIGR
Sbjct  13   EEREVQKSYWMEHSRDLTLEAMMLDSRASELDKEERPEVLSLLPPYKGKSVLELGAGIGR  72

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELA++AG V+A+DFIESVIKKNE++NGH  N  FMCADVTS DL    +S+DLIFSN
Sbjct  73   FTSELAKEAGHVLALDFIESVIKKNESLNGHYKNTSFMCADVTSPDLTIEADSVDLIFSN  132

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  133  WLLMYLSDKEVE  144



>ref|XP_008453479.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
melo]
Length=500

 Score =   219 bits (557),  Expect = 8e-65, Method: Compositional matrix adjust.
 Identities = 104/141 (74%), Positives = 121/141 (86%), Gaps = 0/141 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +   A   +ER +QK YWIEHS+ LTVEAM+LDS A+DLDKEERPEVLS+LP YEGKSVL
Sbjct  5    TPAPALNDDERLIQKKYWIEHSARLTVEAMLLDSNASDLDKEERPEVLSLLPPYEGKSVL  64

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA KAGQV+A+DFIESVIKKNE+IN H  N+KFMCADVTS +L  S+ 
Sbjct  65   ELGAGIGRFTGDLAVKAGQVLALDFIESVIKKNESINRHHKNVKFMCADVTSPELKISEN  124

Query  510  SIDLIFSNWLLMYLSDQEVES  572
            S+DLIFSNWLLMYLSD EV++
Sbjct  125  SVDLIFSNWLLMYLSDIEVKN  145



>ref|XP_006655550.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Oryza 
brachyantha]
Length=495

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/131 (79%), Positives = 116/131 (89%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+ Q+SYW EHS  LTVEAMMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  13   ERKAQRSYWEEHSKALTVEAMMLDSRAADLDKEERPEILSVLPSYKGKSVLELGAGIGRF  72

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA++AG V+A+DFIESVIKKNE  NGH  NI FMCADVTS DL   D SIDLIFSNW
Sbjct  73   TGELAKEAGHVLALDFIESVIKKNENTNGHHKNITFMCADVTSADLKIEDNSIDLIFSNW  132

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EV+
Sbjct  133  LLMYLSDEEVK  143



>ref|XP_004512744.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X1 [Cicer arietinum]
Length=497

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 123/140 (88%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            AM   + +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LE
Sbjct  6    AMTQVEEDEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILE  65

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGS  125

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EVE+
Sbjct  126  VDLIFSNWLLMYLSDEEVEN  145



>ref|XP_010428285.1| PREDICTED: phosphoethanolamine N-methyltransferase 3 isoform 
X1 [Camelina sativa]
Length=504

 Score =   218 bits (556),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 103/132 (78%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EERE+QK+YW  HS  L+VEAMMLDSKAADLDKEERPE+LS+LP  EGK+VLE GAGIGR
Sbjct  20   EEREIQKNYWKVHSVGLSVEAMMLDSKAADLDKEERPEILSLLPPIEGKTVLEFGAGIGR  79

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELAQKAGQ+IA+DFIESVIKKN+ INGH  N+KFMCADVTS D+ F ++S+DLIFSN
Sbjct  80   FTTELAQKAGQLIAVDFIESVIKKNKYINGHYKNVKFMCADVTSPDMKFPNDSMDLIFSN  139

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  140  WLLMYLSDKEVE  151



>ref|XP_003534138.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
 gb|KHN43631.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=490

 Score =   218 bits (555),  Expect = 1e-64, Method: Compositional matrix adjust.
 Identities = 105/139 (76%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  156  MAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLEL  335
            MA  Q +ER VQKSYWIEH+++L+VE+MMLDS A+DLDKEERPEVLS+LP YEGKSV+EL
Sbjct  1    MAMVQ-DERCVQKSYWIEHTTDLSVESMMLDSNASDLDKEERPEVLSLLPPYEGKSVVEL  59

Query  336  GAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESI  515
            GAGIGRFT ELA+KAGQ++A+DFIES IKKNE+INGH  N+KFMCADVTS +L  S+ S+
Sbjct  60   GAGIGRFTVELAKKAGQLLAVDFIESAIKKNESINGHHKNVKFMCADVTSPNLYISEGSV  119

Query  516  DLIFSNWLLMYLSDQEVES  572
            DLIFSNWLLMYLSD+EVE+
Sbjct  120  DLIFSNWLLMYLSDKEVEN  138



>ref|XP_010921188.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Elaeis guineensis]
Length=537

 Score =   219 bits (557),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER VQKS+W+EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGR
Sbjct  48   EERTVQKSFWMEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGR  107

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA++AG V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSN
Sbjct  108  FTGELAKEAGHVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSN  167

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD EVE
Sbjct  168  WLLMYLSDNEVE  179



>dbj|BAC57432.1| phosphoethanolamine N-methyltransferase [Suaeda japonica]
Length=494

 Score =   217 bits (553),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 118/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  130  WLLMYLSDEEVEN  142



>gb|AFW04224.1| phosphoethanolamine N-methyl transferase [Suaeda maritima]
Length=494

 Score =   217 bits (552),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  130  WLLMYLSDEEVE  141



>gb|ABK42071.1| phosphoethanolamine N-methyltransferase [Suaeda liaotungensis]
Length=494

 Score =   217 bits (552),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER+V K YW+EH+ +LT+EAMMLDS+A+DLDKEERPE+LSMLP  EGK +LELGAGIGR
Sbjct  10   QERDVFKKYWVEHTVDLTIEAMMLDSQASDLDKEERPEILSMLPPLEGKCLLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+KAGQVIA+DFIES IKKNE INGH  N+KFMCADVTS  L+F   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIESAIKKNEVINGHYKNVKFMCADVTSPTLSFPPHSLDVIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  130  WLLMYLSDEEVE  141



>dbj|BAG50404.1| methyltransferase [Cardamine sp. SIM-2007]
Length=148

 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/120 (81%), Positives = 112/120 (93%), Gaps = 0/120 (0%)
 Frame = +3

Query  210  HSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQV  389
            HS++LTVEAMMLDS+A+DLDKEERP VLS+LP+YEGKSVLELGAGIGRFT ELAQKAG++
Sbjct  1    HSADLTVEAMMLDSRASDLDKEERPGVLSLLPSYEGKSVLELGAGIGRFTSELAQKAGEL  60

Query  390  IAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            IA+DFI+SVIKKNE+INGH  N+KFMCADVTS DL  +D S+DLIFSNWLLMYLSD+EVE
Sbjct  61   IALDFIDSVIKKNESINGHYKNVKFMCADVTSPDLKITDGSLDLIFSNWLLMYLSDKEVE  120



>ref|XP_002441466.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
 gb|EES19896.1| hypothetical protein SORBIDRAFT_09g027360 [Sorghum bicolor]
Length=510

 Score =   217 bits (552),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 101/131 (77%), Positives = 119/131 (91%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+VQKSYW EHS +LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVLELGAGIGRF
Sbjct  28   ERKVQKSYWEEHSKDLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVLELGAGIGRF  87

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS +L   D S+DLIFSNW
Sbjct  88   TGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFKCADVTSPELKIEDNSVDLIFSNW  147

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EVE
Sbjct  148  LLMYLSDEEVE  158



>ref|NP_001169597.1| uncharacterized LOC100383478 [Zea mays]
 gb|ABF83429.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
 gb|ACN34220.1| unknown [Zea mays]
 gb|AFW78993.1| S-adenosyl-L-methionine: phosphoethanolamine N-methyltransferase 
[Zea mays]
Length=501

 Score =   216 bits (550),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 105/140 (75%), Positives = 123/140 (88%), Gaps = 1/140 (1%)
 Frame = +3

Query  153  AMAAFQGE-EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            A+A   GE ER+VQKSYW EHS  LTVE+MMLDS+AADLDKEERPE+LS+LP+Y+GKSVL
Sbjct  10   AVANGIGEVERKVQKSYWEEHSKCLTVESMMLDSRAADLDKEERPEILSLLPSYKGKSVL  69

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA++AG V+A+DFIESVIKKN++INGH  NI F CADVTS DL   D 
Sbjct  70   ELGAGIGRFTGDLAKEAGHVLALDFIESVIKKNQSINGHHKNITFRCADVTSNDLKIEDN  129

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S+DLIFSNWLLMYLSD+EV+
Sbjct  130  SVDLIFSNWLLMYLSDEEVQ  149



>ref|XP_008799222.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X3 [Phoenix dactylifera]
Length=482

 Score =   216 bits (549),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 101/128 (79%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  186  VQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGE  365
            VQKSYW+EHS +LTVEAMMLDS+A+DLDKEERPEVLS+LP Y+GKSVLELGAGIGRFTGE
Sbjct  2    VQKSYWMEHSKDLTVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSVLELGAGIGRFTGE  61

Query  366  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  545
            LA++AG V+AMDFI++VIKKNE+INGH  N  FMC DVTS DL    ES+DLIFSNWLLM
Sbjct  62   LAKEAGHVLAMDFIKNVIKKNESINGHFKNTSFMCTDVTSPDLMIEAESVDLIFSNWLLM  121

Query  546  YLSDQEVE  569
            YLSD EVE
Sbjct  122  YLSDNEVE  129



>ref|XP_004512745.1| PREDICTED: phosphoethanolamine N-methyltransferase-like isoform 
X2 [Cicer arietinum]
Length=496

 Score =   216 bits (549),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +EREVQ++YW EH + L+VE+MMLDS A+ LDKEERPEVLS+LPAYEGKS+LELGAGIGR
Sbjct  12   DEREVQRNYWREHCANLSVESMMLDSNASHLDKEERPEVLSLLPAYEGKSILELGAGIGR  71

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT ELA+KAGQ++A+DFIES IKKNE INGH  N+KFMCADVTS +L+ S+ S+DLIFSN
Sbjct  72   FTSELAKKAGQLLAVDFIESAIKKNENINGHHKNVKFMCADVTSPNLHISEGSVDLIFSN  131

Query  534  WLLMYLSDQEVES  572
            WLLMYLSD+EVE+
Sbjct  132  WLLMYLSDEEVEN  144



>ref|XP_004241642.1| PREDICTED: phosphoethanolamine N-methyltransferase [Solanum lycopersicum]
Length=494

 Score =   215 bits (548),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 101/140 (72%), Positives = 124/140 (89%), Gaps = 0/140 (0%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +A+A   GEERE+QKSYW+E +SEL +EAMM DS A+DLDKE+RPEVLS+LP+YEGKSVL
Sbjct  2    AAIAPEVGEEREIQKSYWMEQTSELNLEAMMRDSAASDLDKEDRPEVLSLLPSYEGKSVL  61

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTG+LA+KAG+++A+DFIE V KKNE+INGH  N+KF+CADVTS DL    E
Sbjct  62   ELGAGIGRFTGDLAEKAGELVAVDFIEEVTKKNESINGHHKNVKFVCADVTSPDLTVLPE  121

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            S+DLIFSNWLLMYLS++EV+
Sbjct  122  SVDLIFSNWLLMYLSNEEVQ  141



>ref|NP_175293.1| phosphoethanolamine N-methyltransferase 2 [Arabidopsis thaliana]
 gb|AAL16223.1|AF428454_1 At1g48600/T1N15_20 [Arabidopsis thaliana]
 gb|AAL36222.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AAM91745.1| putative phosphoethanolamine N-methyltransferase [Arabidopsis 
thaliana]
 gb|AEE32324.1| putative phosphoethanolamine N-methyltransferase 2 [Arabidopsis 
thaliana]
Length=475

 Score =   214 bits (545),  Expect = 3e-63, Method: Compositional matrix adjust.
 Identities = 102/122 (84%), Positives = 113/122 (93%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGKSVLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKSVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            +VIA+DFIES I+KNE++NGH  NIKFMCADVTS DL   D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIQKNESVNGHYKNIKFMCADVTSPDLKIKDGSIDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>ref|XP_004969637.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Setaria 
italica]
Length=499

 Score =   214 bits (545),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 100/132 (76%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER+ Q+SYW EHS +LTVEAMMLDS+AA+LDKE+RPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   EERKAQRSYWEEHSRDLTVEAMMLDSRAAELDKEDRPEVLSLLPSYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ AG V A+DFIESVIKKNE+ NGH  N  FMCADVTS DL   + S+DLIFSN
Sbjct  76   FTGELAKTAGHVFALDFIESVIKKNESTNGHYKNTSFMCADVTSPDLIIEENSVDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+E++
Sbjct  136  WLLMYLSDEEID  147



>gb|ABG57185.1| phosphoethanolamine N-methyltransferase [Salicornia europaea]
Length=494

 Score =   214 bits (544),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 99/132 (75%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER V K YW+EH+++LTVE+MMLDS+A+DLDKEERPE+LS+LP  EGK VLELGAGIGR
Sbjct  10   EERNVFKKYWVEHTTDLTVESMMLDSQASDLDKEERPEILSLLPNLEGKCVLELGAGIGR  69

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+KAGQVIA+DFI+  IKKNE I+GH  N+KFMCADVTS  LNF   S+D+IFSN
Sbjct  70   FTGELAEKAGQVIALDFIDKAIKKNEYIDGHYKNVKFMCADVTSPTLNFPPNSLDVIFSN  129

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+EVE
Sbjct  130  WLLMYLSDEEVE  141



>ref|XP_003619836.1| Phosphoethanolamine N-methyltransferase [Medicago truncatula]
 gb|AES76054.1| phosphoethanolamine N-methyltransferase [Medicago truncatula]
Length=497

 Score =   213 bits (543),  Expect = 7e-63, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +3

Query  153  AMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLE  332
            AM     +EREVQ+SYW EH   L+VE+MMLDS A+ LDKEERPEVLS+LP+YEGKSVLE
Sbjct  6    AMKQGGEDEREVQRSYWKEHCVNLSVESMMLDSNASHLDKEERPEVLSLLPSYEGKSVLE  65

Query  333  LGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDES  512
            LGAGIGRFT ELAQKAGQ++A+DFIES IKKNE  NGH  N+KFMCADVTS +L+ S+ S
Sbjct  66   LGAGIGRFTAELAQKAGQLLAVDFIESAIKKNENTNGHHKNVKFMCADVTSPNLHISEGS  125

Query  513  IDLIFSNWLLMYLSDQEVES  572
            +DLIFSNWLLMYLSD+EV++
Sbjct  126  VDLIFSNWLLMYLSDEEVKN  145



>ref|XP_002317875.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
 gb|EEE96095.2| Phosphoethanolamine N-methyltransferase 1 family protein, partial 
[Populus trichocarpa]
Length=129

 Score =   202 bits (514),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 94/121 (78%), Positives = 110/121 (91%), Gaps = 0/121 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +++ S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKA 
Sbjct  1    MDNISDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAS  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            QV+A+DFIES IKKNE INGH  N+KFMCADV S DLNFS+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVKSPDLNFSEGSVDLIFSNWLLMYLSDKE  120

Query  564  V  566
            V
Sbjct  121  V  121



>emb|CDX93681.1| BnaA06g03670D [Brassica napus]
Length=473

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>emb|CDY40594.1| BnaC06g02100D [Brassica napus]
Length=473

 Score =   213 bits (541),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 112/122 (92%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHSS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK VLELGAGIGRFTGELAQKAG
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKKVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS DL   D S+DLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSPDLKIEDGSVDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>ref|XP_006393387.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
 gb|ESQ30673.1| hypothetical protein EUTSA_v10011451mg [Eutrema salsugineum]
Length=475

 Score =   212 bits (540),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 100/122 (82%), Positives = 115/122 (94%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +E+SS+LTVEAMMLDSKA+DLDKEERPEVLS++P YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MENSSDLTVEAMMLDSKASDLDKEERPEVLSLIPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            +VIA+DFIES IKKNE++NGH  N+KFMCADVTS+DL  +D SIDLIFSNWLLMYLSD+E
Sbjct  61   EVIALDFIESAIKKNESVNGHYKNVKFMCADVTSQDLKITDGSIDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>ref|XP_010461685.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
 ref|XP_010461686.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=234

 Score =   203 bits (516),  Expect = 8e-62, Method: Compositional matrix adjust.
 Identities = 100/123 (81%), Positives = 112/123 (91%), Gaps = 1/123 (1%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  380
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFT ELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLVPPYEGKSVLELGAGIGRFTVELAQKA  60

Query  381  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  560
            G+VIA+DFIES I+KNE+INGH   +KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIAVDFIESDIQKNESINGHYKKVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  561  EVE  569
            EVE
Sbjct  121  EVE  123



>ref|XP_003525185.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Glycine 
max]
Length=488

 Score =   209 bits (531),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 97/134 (72%), Positives = 121/134 (90%), Gaps = 2/134 (1%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER +QKSYW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGR
Sbjct  2    DERHIQKSYWLQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGR  61

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIF  527
            FTGELA KAGQ++A+DFI++ IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++F
Sbjct  62   FTGELALKAGQLLAVDFIDTAIKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVF  121

Query  528  SNWLLMYLSDQEVE  569
            SNWLLMYLSD EVE
Sbjct  122  SNWLLMYLSDIEVE  135



>ref|XP_007160543.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32537.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=517

 Score =   209 bits (533),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  530
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  531  NWLLMYLSDQEVE  569
            NWLLMYLSD EVE
Sbjct  131  NWLLMYLSDNEVE  143



>ref|XP_007160542.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
 gb|ESW32536.1| hypothetical protein PHAVU_002G330400g [Phaseolus vulgaris]
Length=496

 Score =   209 bits (531),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 99/133 (74%), Positives = 120/133 (90%), Gaps = 2/133 (2%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER++QK YW++HS++L+VEAMMLDSKAA LDKEERPEVLS+LP  EGKSV+ELGAGIGRF
Sbjct  11   ERDMQKLYWVQHSADLSVEAMMLDSKAAHLDKEERPEVLSLLPPCEGKSVIELGAGIGRF  70

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFS  530
            TGELAQKAGQ++A+DFIES IKKNE+INGH  N+KF+CADVTS ++  + S+ S+D+IFS
Sbjct  71   TGELAQKAGQLLAVDFIESAIKKNESINGHHKNVKFLCADVTSPNMSSSVSEGSVDVIFS  130

Query  531  NWLLMYLSDQEVE  569
            NWLLMYLSD EVE
Sbjct  131  NWLLMYLSDNEVE  143



>ref|XP_002456193.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
 gb|EES01313.1| hypothetical protein SORBIDRAFT_03g031940 [Sorghum bicolor]
Length=499

 Score =   208 bits (529),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
             ER+ Q+SYW EHS ELT+EAMMLDS+AA+LDKEERPEVLS+LP+YEGKSVLELGAGIGR
Sbjct  16   HERKAQRSYWEEHSGELTLEAMMLDSRAAELDKEERPEVLSLLPSYEGKSVLELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ +G V A+DFIES IKKNE+ NGH  N  FMCADVTS +L     SIDLIFSN
Sbjct  76   FTGELAKTSGHVFAVDFIESAIKKNESTNGHYDNTSFMCADVTSPNLMIEANSIDLIFSN  135

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+E++
Sbjct  136  WLLMYLSDEEID  147



>ref|XP_008675146.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Zea mays]
Length=483

 Score =   207 bits (527),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  144  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  504  DESIDLIFSNWLLMYLSDQEVE  569
              SIDLIFSNWLLMYLSD+E++
Sbjct  128  ANSIDLIFSNWLLMYLSDEEID  149



>ref|XP_008675144.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X1 [Zea mays]
 ref|XP_008675145.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X2 [Zea mays]
Length=501

 Score =   207 bits (527),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 98/142 (69%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +3

Query  144  VQSAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKS  323
            V  ++      ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS
Sbjct  8    VNGSLDRLDVHERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKS  67

Query  324  VLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFS  503
            +LELGAGIGRFTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL   
Sbjct  68   ILELGAGIGRFTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIE  127

Query  504  DESIDLIFSNWLLMYLSDQEVE  569
              SIDLIFSNWLLMYLSD+E++
Sbjct  128  ANSIDLIFSNWLLMYLSDEEID  149



>gb|AFZ78648.1| methyl transferase [Populus tomentosa]
Length=485

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 114/123 (93%), Gaps = 0/123 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            ++++S+L+V AMMLDSKA++LDKEERPE+LS+LP YEGK+VLELGAGIGRFTGELAQKAG
Sbjct  1    MDNTSDLSVNAMMLDSKASELDKEERPEILSLLPPYEGKTVLELGAGIGRFTGELAQKAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            QV+A+DFIES IKKNE INGH  N+KFMCADVTS DLN S+ S+DLIFSNWLLMYLSD+E
Sbjct  61   QVVALDFIESAIKKNENINGHYKNVKFMCADVTSPDLNISEGSVDLIFSNWLLMYLSDKE  120

Query  564  VES  572
            VE+
Sbjct  121  VEN  123



>gb|AAV67950.1| putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=495

 Score =   207 bits (526),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  12   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  71

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  72   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSPDLMIEANSIDLIFSN  131

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+E++
Sbjct  132  WLLMYLSDEEID  143



>tpg|DAA57997.1| TPA: putative phosphoethanolamine N-methyltransferase [Zea mays]
Length=498

 Score =   207 bits (526),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 113/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
             ER+ QKSYW EHS EL +EA+MLDS+AA+LDKEERPEVLS+LP+YEGKS+LELGAGIGR
Sbjct  15   HERKAQKSYWEEHSGELNLEAIMLDSRAAELDKEERPEVLSLLPSYEGKSILELGAGIGR  74

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA+ +G V A+DF+ESVIKKN +IN H GN  FMCADVTS DL     SIDLIFSN
Sbjct  75   FTGELAKTSGHVFAVDFVESVIKKNGSINDHYGNTSFMCADVTSTDLMIEANSIDLIFSN  134

Query  534  WLLMYLSDQEVE  569
            WLLMYLSD+E++
Sbjct  135  WLLMYLSDEEID  146



>gb|AAL40895.1| phosphoethanolamine methyltransferase [Triticum aestivum]
Length=498

 Score =   206 bits (525),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 98/132 (74%), Positives = 117/132 (89%), Gaps = 1/132 (1%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+VQKSYW EHS +LTVE+MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRF
Sbjct  15   ERKVQKSYWEEHSKDLTVESMMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRF  74

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSN  533
            TGELA++AG VIA+DFI+SVIKKNE ING +  NI FMCADVTS +L   D S+D++FSN
Sbjct  75   TGELAKEAGHVIALDFIDSVIKKNEEINGDIYKNITFMCADVTSPELKIEDNSVDIVFSN  134

Query  534  WLLMYLSDQEVE  569
            WLLMYL+D+EVE
Sbjct  135  WLLMYLNDEEVE  146



>ref|XP_010500398.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
[Camelina sativa]
Length=474

 Score =   204 bits (520),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 99/123 (80%), Positives = 113/123 (92%), Gaps = 1/123 (1%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPE-VLSMLPAYEGKSVLELGAGIGRFTGELAQKA  380
            +EHSS+LTVEAMMLDSKA+DLDKEERPE VLS++P YEGKSVLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDLTVEAMMLDSKASDLDKEERPEEVLSLIPPYEGKSVLELGAGIGRFTGELAQKA  60

Query  381  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  560
            G+VIA+DFIES I+KNE++NG   N+KF+CADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  61   GEVIALDFIESAIQKNESVNGQYKNVKFICADVTSPDLKIADGSIDLIFSNWLLMYLSDK  120

Query  561  EVE  569
            EVE
Sbjct  121  EVE  123



>ref|XP_010921205.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921212.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921222.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921230.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
 ref|XP_010921238.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like isoform 
X3 [Elaeis guineensis]
Length=480

 Score =   201 bits (512),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 108/122 (89%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHS +L VEAMMLDS+A+DLDKEERPEVLS+LP Y+GKS+LELGAGIGRFTGELA++AG
Sbjct  1    MEHSKDLNVEAMMLDSRASDLDKEERPEVLSLLPPYKGKSILELGAGIGRFTGELAKEAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
             V+A+DFIE VIKKNE++NGH  NI FMCADVTS DL    ES+DLIFSNWLLMYLSD E
Sbjct  61   HVLALDFIEDVIKKNESVNGHFKNISFMCADVTSPDLMIEAESVDLIFSNWLLMYLSDNE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>gb|KJB53041.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=448

 Score =   200 bits (509),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  537  LLMYLSDQEVES  572
            LLMYLS++EVE+
Sbjct  126  LLMYLSNEEVEN  137



>gb|KJB53038.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=480

 Score =   200 bits (509),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  537  LLMYLSDQEVES  572
            LLMYLS++EVE+
Sbjct  126  LLMYLSNEEVEN  137



>gb|KJB53040.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=489

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  6    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  65

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  66   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  125

Query  537  LLMYLSDQEVES  572
            LLMYLS++EVE+
Sbjct  126  LLMYLSNEEVEN  137



>gb|KJB53039.1| hypothetical protein B456_008G289900 [Gossypium raimondii]
Length=488

 Score =   200 bits (508),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 97/132 (73%), Positives = 114/132 (86%), Gaps = 0/132 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            EREVQK+YW+EHS +LT +  +LDSK ADLDKE+R EVLS+LP YEGK +LELGAGIGRF
Sbjct  5    EREVQKNYWMEHSIDLTEDGTILDSKDADLDKEDRLEVLSLLPPYEGKCILELGAGIGRF  64

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELAQKA  VIA+DFIE VIKKNE+INGH  NIKF+CAD TS DL+ S+ S+DLIFSN 
Sbjct  65   TGELAQKADSVIALDFIEDVIKKNESINGHYKNIKFLCADATSPDLDISEGSMDLIFSNL  124

Query  537  LLMYLSDQEVES  572
            LLMYLS++EVE+
Sbjct  125  LLMYLSNEEVEN  136



>emb|CDX92181.1| BnaA05g22260D [Brassica napus]
Length=464

 Score =   199 bits (506),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 93/111 (84%), Positives = 105/111 (95%), Gaps = 0/111 (0%)
 Frame = +3

Query  237  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  416
            MMLDS+AADLDKEERPEVLS+LP YEGKSVLELGAGIGRFTGELAQKAG++IA+DFI+SV
Sbjct  1    MMLDSRAADLDKEERPEVLSLLPPYEGKSVLELGAGIGRFTGELAQKAGELIALDFIDSV  60

Query  417  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            IKKN+++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLMYLSD+EVE
Sbjct  61   IKKNKSVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLMYLSDKEVE  111



>ref|XP_001763293.1| predicted protein [Physcomitrella patens]
 gb|EDQ71823.1| predicted protein [Physcomitrella patens]
Length=491

 Score =   199 bits (505),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 92/131 (70%), Positives = 110/131 (84%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER +Q +YW EHS E +VEAMMLDS+A+ LDKEERPE+LS+LP YE K V+ELGAGIGRF
Sbjct  6    ERSLQSTYWKEHSVEPSVEAMMLDSQASKLDKEERPEILSLLPPYENKDVMELGAGIGRF  65

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TGELA+ AG V+AMDF+E++IKKNE +NGH  NI F CADVTS DLN +  S DL+FSNW
Sbjct  66   TGELAKHAGHVLAMDFMENLIKKNEDVNGHYNNIDFKCADVTSPDLNIAAGSADLVFSNW  125

Query  537  LLMYLSDQEVE  569
            LLMYLSD+EV+
Sbjct  126  LLMYLSDEEVK  136



>ref|XP_002284594.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Vitis vinifera]
Length=490

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 103/133 (77%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  531  NWLLMYLSDQEVE  569
            NWLLMYLSD+EVE
Sbjct  125  NWLLMYLSDKEVE  137



>ref|XP_002454522.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
 gb|EES07498.1| hypothetical protein SORBIDRAFT_04g032625 [Sorghum bicolor]
Length=136

 Score =   187 bits (476),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/115 (78%), Positives = 101/115 (88%), Gaps = 0/115 (0%)
 Frame = +3

Query  222  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  401
            LTVEAMMLDS+AADL++EERPEVLS+LP+YEGKSVLELGAGIG FTGELA+ AG V+A+D
Sbjct  19   LTVEAMMLDSRAADLNREERPEVLSLLPSYEGKSVLELGAGIGHFTGELAKIAGNVLALD  78

Query  402  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  566
            FIES IKKNE+INGH  N  FMCA VTS+DL     SIDLIFSNWLLMYLSD+EV
Sbjct  79   FIESAIKKNESINGHYNNASFMCAYVTSEDLVLPASSIDLIFSNWLLMYLSDEEV  133



>ref|XP_010655650.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X1 [Vitis vinifera]
Length=494

 Score =   197 bits (500),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 102/132 (77%), Positives = 120/132 (91%), Gaps = 0/132 (0%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
            GEER+VQKSYW+EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIG
Sbjct  5    GEERDVQKSYWMEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIG  64

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTGELA++AGQV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFS
Sbjct  65   RFTGELAKQAGQVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFS  124

Query  531  NWLLMYLSDQEV  566
            NWLLMYLSD+EV
Sbjct  125  NWLLMYLSDKEV  136



>gb|KJB30120.1| hypothetical protein B456_005G132000 [Gossypium raimondii]
Length=465

 Score =   195 bits (496),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 90/112 (80%), Positives = 105/112 (94%), Gaps = 0/112 (0%)
 Frame = +3

Query  237  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  416
            MMLDSKAAD+DKEERPEVLS+LP YEGK++LELGAGIGRFTG+LA+KAG VIA+DFIE+V
Sbjct  1    MMLDSKAADIDKEERPEVLSLLPPYEGKTILELGAGIGRFTGDLAKKAGHVIALDFIENV  60

Query  417  IKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVES  572
            IKKNETINGH  N+KF+CADVTS DL F++ S+DLIFSNWLLMYLSD+EVE+
Sbjct  61   IKKNETINGHYKNVKFLCADVTSPDLAFTEGSLDLIFSNWLLMYLSDKEVEN  112



>ref|XP_006306318.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
 gb|EOA39216.1| hypothetical protein CARUB_v10012188mg, partial [Capsella rubella]
Length=354

 Score =   190 bits (482),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 93/125 (74%), Positives = 111/125 (89%), Gaps = 3/125 (2%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDS-KAADLDKEE--RPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  374
            +EHSS+LT EAMMLDS +A+DLD+EE  RPEVLS++P YEGKSVLELGAGI RF GE+AQ
Sbjct  1    MEHSSDLTAEAMMLDSTEASDLDEEEERRPEVLSLIPPYEGKSVLELGAGIDRFIGEVAQ  60

Query  375  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  554
            KAG+VIA+DFIES I+KNE++NGH  N+KFMCADVTS DL  +D S++LIFSNWLLMYLS
Sbjct  61   KAGEVIALDFIESAIQKNESVNGHYKNVKFMCADVTSPDLKIADGSVELIFSNWLLMYLS  120

Query  555  DQEVE  569
            D+EVE
Sbjct  121  DKEVE  125



>gb|EEC79642.1| hypothetical protein OsI_20868 [Oryza sativa Indica Group]
Length=504

 Score =   193 bits (490),  Expect = 6e-55, Method: Compositional matrix adjust.
 Identities = 96/140 (69%), Positives = 110/140 (79%), Gaps = 9/140 (6%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERP---------EVLSMLPAYEGKSVL  329
            ER+ Q+SYW EHS +LTVEAMMLDS+     +   P         +VLS+LP+Y+GKSVL
Sbjct  13   ERKAQRSYWEEHSKDLTVEAMMLDSRPRRPRQGGAPRGLIGTVDAQVLSVLPSYKGKSVL  72

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTGELA++AG V+A+DFIESVIKKNE INGH  NI FMCADVTS DL   D 
Sbjct  73   ELGAGIGRFTGELAKEAGHVLALDFIESVIKKNENINGHHKNITFMCADVTSPDLTIEDN  132

Query  510  SIDLIFSNWLLMYLSDQEVE  569
            SIDLIFSNWLLMYLSD+EVE
Sbjct  133  SIDLIFSNWLLMYLSDEEVE  152



>emb|CDX95799.1| BnaC05g35500D [Brassica napus]
Length=481

 Score =   190 bits (482),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 105/128 (82%), Gaps = 17/128 (13%)
 Frame = +3

Query  237  MMLDSKAADLDKEERPE-----------------VLSMLPAYEGKSVLELGAGIGRFTGE  365
            MMLDS+AADLDKEERPE                 VLS+LP YEGKSVLELGAGIGRFTGE
Sbjct  1    MMLDSRAADLDKEERPEEMFSLSLSLLRFRESDGVLSLLPPYEGKSVLELGAGIGRFTGE  60

Query  366  LAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLM  545
            LAQKAG++IA+DFI+SVIKKNE++NGH  N+KFMCADVTS DLN +D SIDLIFSNWLLM
Sbjct  61   LAQKAGELIALDFIDSVIKKNESVNGHYKNVKFMCADVTSPDLNITDGSIDLIFSNWLLM  120

Query  546  YLSDQEVE  569
            YLSD+EVE
Sbjct  121  YLSDKEVE  128



>gb|ABK24808.1| unknown [Picea sitchensis]
Length=472

 Score =   189 bits (480),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 107/130 (82%), Gaps = 0/130 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER +Q +YW EHS  L++EAMMLDS+A+ LD+EERPE++S+LP  EGKSV+ELGAGIGR+
Sbjct  6    ERALQLNYWKEHSVVLSLEAMMLDSQASKLDQEERPEIISLLPPLEGKSVIELGAGIGRY  65

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            T ELAQKA  ++AMDFIES IKKNE  NGH  N++FMCADVTS DL     S DL+FSNW
Sbjct  66   TVELAQKADHILAMDFIESAIKKNEETNGHFKNVEFMCADVTSADLKIEPGSADLVFSNW  125

Query  537  LLMYLSDQEV  566
            LLMYLSD+EV
Sbjct  126  LLMYLSDEEV  135



>ref|XP_001768934.1| predicted protein [Physcomitrella patens]
 gb|EDQ66288.1| predicted protein [Physcomitrella patens]
Length=431

 Score =   186 bits (471),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 106/131 (81%), Gaps = 0/131 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER +Q +YW EHS   +VE MMLDS+A  LD EERPE+LS+LP Y+GK V+ELGAGIGRF
Sbjct  17   ERTLQSNYWKEHSVNPSVETMMLDSQAPKLDLEERPEILSLLPPYKGKDVIELGAGIGRF  76

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TG+LA+ AG V+AMDF+E++IKKNE ++GH+ NI F CADVTS  L+ S  S DL+FSNW
Sbjct  77   TGDLAKSAGHVLAMDFMENLIKKNEDVHGHMNNIDFKCADVTSPQLDISSASADLVFSNW  136

Query  537  LLMYLSDQEVE  569
            LLM LSD+EVE
Sbjct  137  LLMSLSDEEVE  147



>ref|XP_002969650.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
 gb|EFJ29738.1| hypothetical protein SELMODRAFT_146547 [Selaginella moellendorffii]
Length=495

 Score =   185 bits (469),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHKNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  537  LLMYLSDQEV  566
            LLMYLSD EV
Sbjct  129  LLMYLSDDEV  138



>ref|XP_002970912.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
 gb|EFJ28238.1| hypothetical protein SELMODRAFT_270875 [Selaginella moellendorffii]
Length=495

 Score =   184 bits (468),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 105/130 (81%), Gaps = 0/130 (0%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER+ Q SYW EHS+ LTVE M+LDS+AA LD+EERPE+LSMLP  EG SV+ELGAGIGRF
Sbjct  9    ERDAQLSYWKEHSTALTVEEMLLDSQAAKLDQEERPEILSMLPPLEGISVVELGAGIGRF  68

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            TG+LA+ A  V+AMDF++SVI KN+ +NG   N++F+CADVTS  L F   S DLIFSNW
Sbjct  69   TGDLAKSAKHVVAMDFVQSVIDKNKEVNGCHRNVEFLCADVTSPSLTFPRSSKDLIFSNW  128

Query  537  LLMYLSDQEV  566
            LLMYLSD EV
Sbjct  129  LLMYLSDDEV  138



>ref|XP_006303561.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
 gb|EOA36459.1| hypothetical protein CARUB_v10011038mg [Capsella rubella]
Length=475

 Score =   179 bits (453),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 87/123 (71%), Positives = 106/123 (86%), Gaps = 5/123 (4%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERP-EVLSMLPAYEGKSVLELGAGIGRFTGELAQKA  380
            +EHSS++ V++    ++A+DLDKEE P E+L ++P YEGK+VLELGAGIGRFTGELAQKA
Sbjct  1    MEHSSDVMVDS----TEASDLDKEELPHELLCLIPPYEGKTVLELGAGIGRFTGELAQKA  56

Query  381  GQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQ  560
            G+VIA+DFIES I KNE++NGH  N+KFMCADVTS DL  +D SIDLIFSNWLLMYLSD+
Sbjct  57   GEVIALDFIESAIHKNESVNGHYKNVKFMCADVTSPDLKIADGSIDLIFSNWLLMYLSDK  116

Query  561  EVE  569
            EVE
Sbjct  117  EVE  119



>gb|KHN10536.1| Phosphoethanolamine N-methyltransferase [Glycine soja]
Length=466

 Score =   177 bits (448),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 84/113 (74%), Positives = 101/113 (89%), Gaps = 2/113 (2%)
 Frame = +3

Query  237  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  416
            MMLDSKAA LDKEERPEVLS+LP +EGKSV+ELGAGIGRFTGELA KAGQ++A+DFI++ 
Sbjct  1    MMLDSKAAHLDKEERPEVLSLLPPFEGKSVIELGAGIGRFTGELALKAGQLLAVDFIDTA  60

Query  417  IKKNETINGHLGNIKFMCADVTSKDL--NFSDESIDLIFSNWLLMYLSDQEVE  569
            IKKNETINGH  ++KF+CADVTS ++  N S+ S+D++FSNWLLMYLSD EVE
Sbjct  61   IKKNETINGHHNHVKFLCADVTSPNMSNNVSEGSVDVVFSNWLLMYLSDIEVE  113



>emb|CBI26879.3| unnamed protein product [Vitis vinifera]
Length=475

 Score =   176 bits (446),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 93/122 (76%), Positives = 110/122 (90%), Gaps = 0/122 (0%)
 Frame = +3

Query  204  IEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAG  383
            +EHS+ELTVEAMMLDS+A+DLDKEERPE+LS+LP  EGK V+ELGAGIGRFTGELA++AG
Sbjct  1    MEHSAELTVEAMMLDSQASDLDKEERPELLSLLPPLEGKYVVELGAGIGRFTGELAKQAG  60

Query  384  QVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQE  563
            QV+A+DFIESVI++NE ING   N KF+CADVTS DL+ S  S+DLIFSNWLLMYLSD+E
Sbjct  61   QVLAIDFIESVIRENEVINGRFKNTKFVCADVTSPDLDISPGSVDLIFSNWLLMYLSDKE  120

Query  564  VE  569
            VE
Sbjct  121  VE  122



>gb|AGO59019.1| heat responsive transcription factor protein, partial [Triticum 
aestivum]
Length=460

 Score =   175 bits (444),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 84/112 (75%), Positives = 99/112 (88%), Gaps = 1/112 (1%)
 Frame = +3

Query  237  MMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESV  416
            MMLDS+A DLDKEERPEVL++LP+Y GK+VLELGAGIGRFTGELA++AG VIA+DFI+SV
Sbjct  1    MMLDSRAKDLDKEERPEVLAILPSYAGKTVLELGAGIGRFTGELAKEAGHVIALDFIDSV  60

Query  417  IKKNETINGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            IKKNE ING +  NI FMCADVTS +L   D SID++FSNWLLMYL+D+EVE
Sbjct  61   IKKNEEINGDIYKNITFMCADVTSPELKIEDNSIDIVFSNWLLMYLNDEEVE  112



>ref|XP_010540184.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Tarenaya hassleriana]
Length=457

 Score =   174 bits (442),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 81/98 (83%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  276  ERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGN  455
            ERPE+LS+LP +EGKSVLE GAGIGRFTGE AQ+A QVIA+DFIESVIKKNE INGH  N
Sbjct  6    ERPEILSVLPPFEGKSVLEFGAGIGRFTGEFAQRASQVIAVDFIESVIKKNEDINGHHKN  65

Query  456  IKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            +KFMCADVTS DL FSDES+DLIFSNWLLMYLSD+EVE
Sbjct  66   VKFMCADVTSPDLKFSDESVDLIFSNWLLMYLSDKEVE  103



>gb|KDD75565.1| hypothetical protein H632_c615p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=278

 Score =   167 bits (422),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 81/131 (62%), Positives = 96/131 (73%), Gaps = 2/131 (2%)
 Frame = +3

Query  177  EREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRF  356
            ER VQK YWIEHS+  TVE MMLDSKAAD+DK ERPEVL +L + EGK V+ELGAGIGRF
Sbjct  10   ERAVQKQYWIEHSANATVETMMLDSKAADIDKMERPEVLELLGSVEGKDVVELGAGIGRF  69

Query  357  TGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNW  536
            T  LA  A  V+A+DF+E++I++N   N H GNI F C D T  +L     S DL+FSNW
Sbjct  70   TAPLASTAKSVVALDFMENLIEENRRTNSHYGNIDFRCGDAT--ELELPASSQDLVFSNW  127

Query  537  LLMYLSDQEVE  569
            LLMYL+D EV 
Sbjct  128  LLMYLNDDEVR  138



>gb|KIZ00652.1| hypothetical protein MNEG_7307 [Monoraphidium neglectum]
Length=252

 Score =   165 bits (417),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/139 (60%), Positives = 102/139 (73%), Gaps = 2/139 (1%)
 Frame = +3

Query  150  SAMAAFQGEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVL  329
            +A A    +EREVQ +YW+EHS E TVEAMMLDSKA+++D+ ERPEVLS L + +GK VL
Sbjct  2    AAAAEVGVQEREVQLNYWLEHSKEPTVEAMMLDSKASEIDQMERPEVLSTLGSIKGKRVL  61

Query  330  ELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDE  509
            ELGAGIGRFTGE+A+ A  V+A DF+E  I +N   NGHL N+ F  ADVT   L     
Sbjct  62   ELGAGIGRFTGEIAKTASSVLACDFMEVSIDENRRRNGHLPNVDFRVADVT--QLRCEPR  119

Query  510  SIDLIFSNWLLMYLSDQEV  566
              D++FSNWLLMYLSD+EV
Sbjct  120  QFDVVFSNWLLMYLSDEEV  138



>gb|EPS69227.1| hypothetical protein M569_05544 [Genlisea aurea]
Length=333

 Score =   166 bits (419),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 74/115 (64%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +3

Query  222  LTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMD  401
            L++E MM D+KA+DLD+EERPEVLS++P Y+GKS+LELGAG+GRFT E A+ A Q++A++
Sbjct  69   LSIEDMMADTKASDLDREERPEVLSLVPPYDGKSILELGAGVGRFTAEFAKTAAQIVAVE  128

Query  402  FIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEV  566
             IES  +KNE  NGH  N KF+CADV S DL+F D S DLIFSNWLL+YLS+ EV
Sbjct  129  LIESAAEKNEITNGHHKNAKFICADVRSPDLSFPDGSFDLIFSNWLLLYLSENEV  183



>ref|XP_011399976.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
 gb|KFM27020.1| Phosphoethanolamine N-methyltransferase [Auxenochlorella protothecoides]
Length=503

 Score =   165 bits (418),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 99/131 (76%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ERE QKSYW EHSS  TVE+MMLDS+AAD+DK ERPEVL +L + +G  V+ELGAGIGR
Sbjct  5    QEREAQKSYWAEHSSNATVESMMLDSQAADIDKLERPEVLKLLGSVDGLDVVELGAGIGR  64

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT  LA++A  V+A+DF+ ++I++N   NGHLGNI F C D T  DL       DL+FSN
Sbjct  65   FTRPLAEEARSVVALDFMPNLIEQNRVDNGHLGNIDFRCGDATELDLPAG--CADLVFSN  122

Query  534  WLLMYLSDQEV  566
            WLLMYL+D EV
Sbjct  123  WLLMYLADDEV  133



>ref|XP_002730517.1| PREDICTED: phosphoethanolamine N-methyltransferase-like, partial 
[Saccoglossus kowalevskii]
Length=160

 Score =   155 bits (392),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 73/132 (55%), Positives = 98/132 (74%), Gaps = 2/132 (2%)
 Frame = +3

Query  171  GEEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIG  350
             E R+V  SYW++HS + ++E MMLD++A  L + E PE+LS+LP YEGK ++ELGAGIG
Sbjct  4    NEVRQVMSSYWMDHSKDASLEEMMLDTQAESLAQSEHPEILSLLPPYEGKRIIELGAGIG  63

Query  351  RFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFS  530
            RFTG LA+KA  V A+DF+ES IKKN+  N H  N+ F  ADVT   L   ++S DL+FS
Sbjct  64   RFTGVLAKKASHVTAVDFMESFIKKNKDANSHHKNVDFKQADVTV--LKCPEKSFDLVFS  121

Query  531  NWLLMYLSDQEV  566
            NWL+MYL+++EV
Sbjct  122  NWLMMYLTNEEV  133



>ref|XP_002594091.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
 gb|EEN50102.1| hypothetical protein BRAFLDRAFT_68467 [Branchiostoma floridae]
Length=242

 Score =   156 bits (395),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R+    +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EGK++LELGAGIGR+T
Sbjct  10   RDKMSQFWREHSSQASIEEMMLDDAAKELSKDELPEILSLLPGIEGKTILELGAGIGRYT  69

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
              LAQ+A  V A+DF+E  I+KNE +NGH  N++FM ADVT   L    +S D++FSNWL
Sbjct  70   APLAQQAKHVTAVDFMEPFIRKNEEVNGHHKNVRFMQADVTK--LEMPPKSFDIVFSNWL  127

Query  540  LMYLSDQEVES  572
            +MYLSD EV++
Sbjct  128  MMYLSDAEVQA  138



>gb|EAY75471.1| hypothetical protein OsI_03371 [Oryza sativa Indica Group]
Length=456

 Score =   160 bits (404),  Expect = 7e-43, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 84/105 (80%), Gaps = 0/105 (0%)
 Frame = +3

Query  255  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  434
             ADLD      +LS+LP YEGKSVLELGAGIGRFTGEL + AG V+AMDFIESVIKKNE+
Sbjct  8    TADLDIVASHRILSLLPPYEGKSVLELGAGIGRFTGELVKTAGHVLAMDFIESVIKKNES  67

Query  435  INGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            INGH  N  FMCADVT  DL   D SIDLIFSNWLLMYLSD+EVE
Sbjct  68   INGHHKNASFMCADVTCPDLMIEDNSIDLIFSNWLLMYLSDEEVE  112



>ref|XP_004137342.1| PREDICTED: phosphoethanolamine N-methyltransferase 1-like [Cucumis 
sativus]
 gb|KGN63873.1| hypothetical protein Csa_1G025050 [Cucumis sativus]
Length=468

 Score =   160 bits (404),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  407
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  408  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVK  114



>ref|XP_004166030.1| PREDICTED: LOW QUALITY PROTEIN: phosphoethanolamine N-methyltransferase 
1-like [Cucumis sativus]
Length=468

 Score =   159 bits (403),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 96/114 (84%), Gaps = 0/114 (0%)
 Frame = +3

Query  228  VEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFI  407
            +E+MM+DS + +LD EE  EV+S+LP YEGK+V+ELGAGIGRFT ELAQ+A QVIA+DF+
Sbjct  1    MESMMVDSDSHELDSEETAEVISLLPPYEGKTVVELGAGIGRFTSELAQRAAQVIAVDFV  60

Query  408  ESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            E VI+KNE+INGH  N+KF CADVT  +L+  ++S+D IFSN LLMYLSD+EV+
Sbjct  61   EDVIRKNESINGHHKNVKFQCADVTFSELDIHEDSVDFIFSNLLLMYLSDEEVK  114



>ref|XP_010231068.1| PREDICTED: phosphomethylethanolamine N-methyltransferase-like 
isoform X2 [Brachypodium distachyon]
Length=472

 Score =   159 bits (403),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 78/106 (74%), Positives = 91/106 (86%), Gaps = 1/106 (1%)
 Frame = +3

Query  255  AADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNET  434
            AA+LD E    VLS+LP+YEGK+VLELGAGIGRFTGELA++AG V+A+DFI+SVIKKNE 
Sbjct  15   AAELDPESDQWVLSILPSYEGKTVLELGAGIGRFTGELAKEAGHVLALDFIDSVIKKNEE  74

Query  435  INGHL-GNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            INGH+  NI FMCADVTS +L   D SIDL+FSNWLLMYLSD+EVE
Sbjct  75   INGHIHNNITFMCADVTSPELKIEDNSIDLVFSNWLLMYLSDEEVE  120



>ref|XP_002594077.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
 gb|EEN50088.1| hypothetical protein BRAFLDRAFT_68483 [Branchiostoma floridae]
Length=274

 Score =   154 bits (389),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 96/125 (77%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W E S + +++ MMLD  A +LD+EERPE+L+MLP  +GK VLELGAGIGRFT  LA++
Sbjct  56   FWREQSHDGSLQEMMLDENADELDQEERPEILAMLPDLKGKRVLELGAGIGRFTPSLARQ  115

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+ES IKKNE  N HLGNI F+ ADVT  DL    ES+D++FSNWL+MYL+D
Sbjct  116  ADHVTAVDFMESFIKKNEEANRHLGNINFLQADVTRLDL--PQESVDVVFSNWLMMYLAD  173

Query  558  QEVES  572
            +EV +
Sbjct  174  EEVSA  178



>ref|XP_002594089.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
 gb|EEN50100.1| hypothetical protein BRAFLDRAFT_118790 [Branchiostoma floridae]
Length=577

 Score =   157 bits (398),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 105/145 (72%), Gaps = 8/145 (6%)
 Frame = +3

Query  156  MAAFQGEEREVQKS------YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEG  317
            M++ QGE  E + +      +W EHSS+ ++E MMLD  A +L K+E PE+LS+LP  EG
Sbjct  1    MSSDQGESAEYEATRDKMSQFWREHSSKASLEEMMLDDNAKELSKDELPEILSLLPGIEG  60

Query  318  KSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLN  497
            K++LELGAGIGR+T  LAQ+A  V A+DF+ES I+KNE +NGH  N++FM ADVT   L 
Sbjct  61   KTILELGAGIGRYTAPLAQQAKHVTAVDFMESFIRKNEEVNGHHKNVRFMQADVTK--LE  118

Query  498  FSDESIDLIFSNWLLMYLSDQEVES  572
               +S D++FSNWL+MYLSD EV++
Sbjct  119  MPPKSFDIVFSNWLMMYLSDAEVQA  143



>ref|XP_009011308.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
 gb|ESO11039.1| hypothetical protein HELRODRAFT_71964 [Helobdella robusta]
Length=215

 Score =   150 bits (379),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = +3

Query  192  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  371
            +++W EHS++   E MMLDS A  L +EE PE+LS+LP  EGKSVLELGAGIGRF+G +A
Sbjct  2    QNFWKEHSTKANEEEMMLDSDADTLGREEVPEILSLLPGLEGKSVLELGAGIGRFSGRIA  61

Query  372  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  551
             KA  V+A+DF+E+ IK NE+ NGH GNI+F+ ADV    L F + S DL+FSNWLLMYL
Sbjct  62   AKAKSVVAVDFMENFIKCNESTNGHHGNIQFVQADVML--LKFPENSFDLVFSNWLLMYL  119

Query  552  SDQEV  566
             + EV
Sbjct  120  EEDEV  124



>ref|XP_005643867.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
 gb|EIE19323.1| S-adenosyl-L-methionine-dependent methyltransferase [Coccomyxa 
subellipsoidea C-169]
Length=498

 Score =   154 bits (389),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 97/131 (74%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            EER  QKSYW +HS+  +VEAMMLDS+A+ +DKEERPEVL+ML   EG  ++ELGAGIGR
Sbjct  16   EERAAQKSYWADHSATASVEAMMLDSQASVIDKEERPEVLTMLGCVEGARIVELGAGIGR  75

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FTGELA  A  V+A+DF+E++I +N   N H  N+++   D T  +L     S D++FSN
Sbjct  76   FTGELAVAARSVLAVDFMENLIAENRRANSHRRNVRWQVGDAT--ELELPAGSADVVFSN  133

Query  534  WLLMYLSDQEV  566
            WLLMYLSD+EV
Sbjct  134  WLLMYLSDKEV  144



>ref|XP_005096334.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Aplysia californica]
Length=494

 Score =   151 bits (382),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 76/132 (58%), Positives = 96/132 (73%), Gaps = 2/132 (2%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            E R+V  +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGR
Sbjct  4    EVRQVMAAYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGR  63

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT E+A+KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSN
Sbjct  64   FTTEIAKKAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSN  121

Query  534  WLLMYLSDQEVE  569
            WLLMYL+D EV+
Sbjct  122  WLLMYLNDNEVQ  133



>ref|XP_008324912.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Cynoglossus semilaevis]
Length=495

 Score =   150 bits (378),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  540  LMYLSDQEVES  572
            LMYLSD E++ 
Sbjct  123  LMYLSDDEIQP  133



>ref|XP_008418600.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Poecilia reticulata]
Length=492

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E++S
Sbjct  129  EELKS  133



>ref|XP_008418601.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Poecilia reticulata]
Length=491

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  69

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  127

Query  558  QEVES  572
            +E++S
Sbjct  128  EELKS  132



>ref|XP_008324913.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Cynoglossus semilaevis]
Length=491

 Score =   150 bits (378),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 92/131 (70%), Gaps = 2/131 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R    ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T
Sbjct  5    RNNMAAFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYT  64

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
             +L  KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWL
Sbjct  65   SQLLTKAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWL  122

Query  540  LMYLSDQEVES  572
            LMYLSD E++ 
Sbjct  123  LMYLSDDEIQP  133



>ref|XP_007550439.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Poecilia 
formosa]
Length=492

 Score =   149 bits (377),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 90/125 (72%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKGATVEEMMLDSRAKELTEHELPEILSMLPSLEGRRVLELGAGIGRFTSHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E++S
Sbjct  129  EELKS  133



>ref|XP_008324914.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324916.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
 ref|XP_008324917.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Cynoglossus semilaevis]
Length=488

 Score =   149 bits (377),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 2/126 (2%)
 Frame = +3

Query  195  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  374
            ++W EHS+E TVE MMLD++A DL ++E PE+LS+LP   G  VLELGAGIGR+T +L  
Sbjct  3    AFWKEHSTEATVEEMMLDTQARDLTQQEMPEILSLLPRLTGYKVLELGAGIGRYTSQLLT  62

Query  375  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  554
            KA  V A+DF+ES I+KN  +NGH  N+ F+ ADVT   L     S+D IFSNWLLMYLS
Sbjct  63   KAAHVTAVDFMESFIEKNREVNGHHKNVTFLHADVTK--LEIPKTSLDFIFSNWLLMYLS  120

Query  555  DQEVES  572
            D E++ 
Sbjct  121  DDEIQP  126



>ref|XP_006003521.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like, partial 
[Latimeria chalumnae]
Length=264

 Score =   144 bits (364),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 2/125 (2%)
 Frame = +3

Query  192  KSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELA  371
            K +W EHS E +VE MMLDS A  + +E+R E+++MLP  EGK VLELGAGIGRF+G+LA
Sbjct  2    KQFWEEHSKEASVEEMMLDSNAQAIAEEDRSEIIAMLPCVEGKDVLELGAGIGRFSGQLA  61

Query  372  QKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYL  551
            +KA +V A+DF+++ ++KN  +N   GN+ F+ ADVT+ DL     S DLIFSNWL MYL
Sbjct  62   KKARRVTAVDFMKTFMEKNREVNKVYGNVTFLQADVTNLDL--PPNSFDLIFSNWLFMYL  119

Query  552  SDQEV  566
            +D+E+
Sbjct  120  TDKEL  124



>ref|XP_005806845.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Xiphophorus 
maculatus]
Length=492

 Score =   148 bits (374),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A  L + E PE+LSMLP  EG+ VLELGAGIGRFT  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSQAKKLTEHELPEILSMLPPLEGRRVLELGAGIGRFTSHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF++S + KN   NGH  N+ F+ ADVT  D+     SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMQSFVDKNRQNNGHHSNVSFVQADVTKLDI--PQHSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E++S
Sbjct  129  EELKS  133



>ref|XP_005096335.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Aplysia californica]
 ref|XP_005096336.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Aplysia californica]
Length=486

 Score =   147 bits (371),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 92/125 (74%), Gaps = 2/125 (2%)
 Frame = +3

Query  195  SYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQ  374
            +YW EHS + +VE MMLD+ A +L KEE PE+LS LP Y GK V+ELGAGIGRFT E+A+
Sbjct  3    AYWKEHSKQGSVEEMMLDNTAEELSKEELPEILSYLPEYAGKDVIELGAGIGRFTTEIAK  62

Query  375  KAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLS  554
            KA  V A+DF+E  I KN+  N +  NI+++ ADVT   L+   ES DLIFSNWLLMYL+
Sbjct  63   KAKSVAAVDFMEEFINKNKKTNQNFNNIEYVVADVTK--LDRPKESADLIFSNWLLMYLN  120

Query  555  DQEVE  569
            D EV+
Sbjct  121  DNEVQ  125



>gb|AHY01341.1| phosphoethanolamine methyltransferase, partial [Carassius gibelio]
Length=172

 Score =   140 bits (352),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLD+ A +L + E PE+LS+LP+     VLELGAGIGRFT  L  K
Sbjct  4    FWKEHSKFATVEEMMLDTNAQELTQHELPEILSLLPSLAASDVLELGAGIGRFTRHLIGK  63

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  ++KN+  N HLG+++F+ ADVT   L+F     D++FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNKKDNSHLGSVEFIQADVTK--LDFPKHGFDVVFSNWLLMYLSD  121

Query  558  QEVES  572
            QE++S
Sbjct  122  QELKS  126



>ref|NP_001096276.2| phosphoethanolamine methyltransferase [Xenopus (Silurana) tropicalis]
Length=494

 Score =   147 bits (370),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 72/131 (55%), Positives = 94/131 (72%), Gaps = 2/131 (2%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            + R+V   +W EHS + TVE MMLDS A  L  EE+PE++ +LP  +G SVLELGAGIGR
Sbjct  4    DTRQVMTQFWEEHSRDATVEEMMLDSSAKLLSLEEKPEIILLLPCLDGHSVLELGAGIGR  63

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            +TG LA+ A  V A+DF+++ I+KN+  NG  GNI F+ ADVT+ DL   +ES D IFSN
Sbjct  64   YTGHLAKLASHVTAVDFMQNFIEKNQKDNGFRGNITFLQADVTNLDL--PNESFDFIFSN  121

Query  534  WLLMYLSDQEV  566
            WL MYL+D E+
Sbjct  122  WLFMYLTDAEL  132



>ref|XP_005723167.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Pundamilia nyererei]
Length=492

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E+ S
Sbjct  129  EELNS  133



>ref|XP_005723168.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Pundamilia nyererei]
Length=491

 Score =   146 bits (369),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  127

Query  558  QEVES  572
            +E+ S
Sbjct  128  EELNS  132



>ref|XP_008453688.1| PREDICTED: phosphoethanolamine N-methyltransferase-like [Cucumis 
melo]
Length=184

 Score =   140 bits (352),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 63/95 (66%), Positives = 83/95 (87%), Gaps = 0/95 (0%)
 Frame = +3

Query  285  EVLSMLPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKF  464
            +V+S+LP YEGK+V+ELGAG+GRFT ELAQ+A QVIA+DF+E VI+KNE+INGH  N+KF
Sbjct  12   KVISLLPPYEGKTVVELGAGVGRFTAELAQRAAQVIAVDFVEDVIRKNESINGHHKNVKF  71

Query  465  MCADVTSKDLNFSDESIDLIFSNWLLMYLSDQEVE  569
            + ADVTS +L+  ++S+D IFSN LLMYLSD+EV+
Sbjct  72   LWADVTSPELDIHEDSVDFIFSNLLLMYLSDEEVK  106



>gb|ETM43048.1| hypothetical protein L914_11412, partial [Phytophthora parasitica]
Length=244

 Score =   142 bits (357),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 88/130 (68%), Gaps = 2/130 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
              +A KA  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATKAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  540  LMYLSDQEVE  569
            LMY+ D+EV+
Sbjct  123  LMYMEDEEVK  132



>ref|XP_005723169.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X3 [Pundamilia nyererei]
Length=485

 Score =   146 bits (369),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 88/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  558  QEVES  572
            +E+ S
Sbjct  122  EELNS  126



>ref|XP_008278560.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
 ref|XP_008278561.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Stegastes partitus]
Length=492

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  5    RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  64

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWL
Sbjct  65   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWL  122

Query  540  LMYLSDQEVES  572
            LMYLSD EV++
Sbjct  123  LMYLSDDEVKT  133



>ref|XP_008278559.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Stegastes partitus]
Length=510

 Score =   146 bits (368),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 73/131 (56%), Positives = 91/131 (69%), Gaps = 2/131 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R     +W EHSSE TVE MMLDS+A +L  +E PE+LSMLP+ +G  VLELGAGIGR+T
Sbjct  23   RSNMTEFWKEHSSEATVEKMMLDSQARELTTQELPEILSMLPSLDGCRVLELGAGIGRYT  82

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
              L  KAG V A+DF+ES +++N   NGH  N+  + ADVT  D      S D+IFSNWL
Sbjct  83   SHLLTKAGHVTAVDFMESFVERNRKENGHHSNVSIIQADVTKMDN--PQNSFDIIFSNWL  140

Query  540  LMYLSDQEVES  572
            LMYLSD EV++
Sbjct  141  LMYLSDDEVKT  151



>ref|XP_006781399.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Neolamprologus 
brichardi]
Length=492

 Score =   145 bits (367),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP  EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPRLEGCKVLELGAGIGRYTKHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+ES I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMESFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E+ S
Sbjct  129  EELNS  133



>ref|XP_010864863.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like [Esox 
lucius]
Length=495

 Score =   145 bits (366),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/133 (53%), Positives = 92/133 (69%), Gaps = 2/133 (2%)
 Frame = +3

Query  174  EEREVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGR  353
            +ER     +W EHS + TVE MMLDS A +L + E PE+LS+LP+   + +LELGAGIGR
Sbjct  4    KERSSMTEFWKEHSRQATVEEMMLDSHAKELTQHELPEILSLLPSLHDQRILELGAGIGR  63

Query  354  FTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSN  533
            FT  L  +A  V A+DF+ES +KKN+  NGH  N  F+ ADVT   L+F   S D+IFSN
Sbjct  64   FTSHLLAQASHVTAVDFMESFVKKNQQENGHHSNAAFIQADVTK--LDFPKNSYDIIFSN  121

Query  534  WLLMYLSDQEVES  572
            WL+MYLSD+E+ S
Sbjct  122  WLMMYLSDEELRS  134



>gb|ETK83171.1| hypothetical protein L915_11577 [Phytophthora parasitica]
Length=185

 Score =   139 bits (349),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 71/130 (55%), Positives = 87/130 (67%), Gaps = 2/130 (2%)
 Frame = +3

Query  180  REVQKSYWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFT  359
            R++ K+YW  HSS  TVE MMLDS A  L + E PE+L   P+ E K VLEL AGIGR+T
Sbjct  5    RDLMKAYWEGHSSSATVETMMLDSHAKTLTELEVPEILDKAPSMEHKDVLELAAGIGRYT  64

Query  360  GELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWL  539
              +A  A  V A++FIE  IK NE  NGHLGNIKF+C DV    L     S D+IFSNW+
Sbjct  65   SVIATMAKSVTAVEFIEDFIKVNEDKNGHLGNIKFLCKDVVH--LEAEPNSFDVIFSNWI  122

Query  540  LMYLSDQEVE  569
            LMY+ D+EV+
Sbjct  123  LMYMEDEEVK  132



>ref|XP_004545581.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Maylandia zebra]
Length=492

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E+ S
Sbjct  129  EELNS  133



>ref|XP_005913450.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X1 [Haplochromis burtoni]
Length=492

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  11   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  70

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  71   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  128

Query  558  QEVES  572
            +E+ S
Sbjct  129  EELNS  133



>gb|EWM27854.1| phosphoethanolamine n-methyltransferase [Nannochloropsis gaditana]
Length=597

 Score =   145 bits (367),  Expect = 3e-37, Method: Composition-based stats.
 Identities = 72/149 (48%), Positives = 96/149 (64%), Gaps = 6/149 (4%)
 Frame = +3

Query  132  FTAIVQSAMAAFQ--GEEREVQKSYWIEHSSE--LTVEAMMLDSKAADLDKEERPEVLSM  299
            F ++    M +F    EER VQ+ YW EHS +   ++E MMLD  A+ LD  +RPE+LSM
Sbjct  58   FLSLFDINMTSFSLTEEERTVQREYWQEHSKKHGSSMENMMLDDSASKLDLMDRPEILSM  117

Query  300  LPAYEGKSVLELGAGIGRFTGELAQKAGQVIAMDFIESVIKKNETINGHLGNIKFMCADV  479
            LP Y    +LEL +GIGRFTG LA KAG V+ ++F+E  + KN+ ++ H GN  F+CADV
Sbjct  118  LPTYSDIRILELASGIGRFTGSLASKAGSVVTVEFMEEFVAKNKELHNHFGNCDFLCADV  177

Query  480  TSKDLNFSDESIDLIFSNWLLMYLSDQEV  566
                L     S DL+FS W+ MYL+DQEV
Sbjct  178  LK--LTLPPASFDLVFSCWIQMYLNDQEV  204



>ref|XP_004545582.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Maylandia zebra]
Length=491

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  10   FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  69

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  70   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  127

Query  558  QEVES  572
            +E+ S
Sbjct  128  EELNS  132



>ref|NP_001070105.1| phosphoethanolamine methyltransferase [Danio rerio]
 gb|AAI24222.1| Zgc:153034 [Danio rerio]
Length=489

 Score =   145 bits (365),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 2/124 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS + TVE MMLDS A +L + E PE+L +LPA     VLELGAGIGR+T  L  +
Sbjct  4    FWKEHSKQATVEEMMLDSHAQELTQHELPEILDLLPALSESCVLELGAGIGRYTKHLIGR  63

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  ++KN   NGHLG+++F+ ADVT   L+F + S DL+FSNWLLMYLSD
Sbjct  64   ARHVTAVDFMEKFVEKNRQDNGHLGSVEFIQADVTK--LDFPEHSFDLVFSNWLLMYLSD  121

Query  558  QEVE  569
            QE++
Sbjct  122  QELQ  125



>ref|XP_005913451.1| PREDICTED: phosphoethanolamine N-methyltransferase 3-like isoform 
X2 [Haplochromis burtoni]
Length=485

 Score =   144 bits (364),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 87/125 (70%), Gaps = 2/125 (2%)
 Frame = +3

Query  198  YWIEHSSELTVEAMMLDSKAADLDKEERPEVLSMLPAYEGKSVLELGAGIGRFTGELAQK  377
            +W EHS   TVE MMLDS+A +L + E PE+LSMLP+ EG  VLELGAGIGR+T  L  K
Sbjct  4    FWKEHSKAATVEEMMLDSRAKELTQHELPEILSMLPSLEGCKVLELGAGIGRYTKHLLTK  63

Query  378  AGQVIAMDFIESVIKKNETINGHLGNIKFMCADVTSKDLNFSDESIDLIFSNWLLMYLSD  557
            A  V A+DF+E  I+KN   NGH  N  F+ ADVT   L+    SID IFSNWLLMYLSD
Sbjct  64   AAHVTAVDFMERFIEKNRQKNGHHSNGTFLQADVTK--LDVPQNSIDFIFSNWLLMYLSD  121

Query  558  QEVES  572
            +E+ S
Sbjct  122  EELNS  126



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 682974011750