BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A22

Length=558
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001053457.2|  Os04g0543900                                       183   1e-54   
emb|CDX87065.1|  BnaC09g03800D                                          182   7e-54   
gb|EYU35165.1|  hypothetical protein MIMGU_mgv1a021743mg                185   4e-53   Erythranthe guttata [common monkey flower]
ref|XP_004235200.1|  PREDICTED: glutamate dehydrogenase A               186   5e-53   
gb|AAK62421.1|AF386976_1  glutamate dehydrogenase 2                     180   5e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011076454.1|  PREDICTED: glutamate dehydrogenase A               184   1e-52   Sesamum indicum [beniseed]
gb|EYU20157.1|  hypothetical protein MIMGU_mgv1a007303mg                184   1e-52   Erythranthe guttata [common monkey flower]
dbj|BAJ96415.1|  predicted protein                                      184   2e-52   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS58358.1|  Glutamate dehydrogenase 2                               184   2e-52   Triticum urartu
ref|XP_006358191.1|  PREDICTED: glutamate dehydrogenase A-like          184   2e-52   Solanum tuberosum [potatoes]
ref|XP_003580259.1|  PREDICTED: glutamate dehydrogenase 2               184   2e-52   Brachypodium distachyon [annual false brome]
ref|NP_001119184.1|  glutamate dehydrogenase 2                          181   3e-52   Arabidopsis thaliana [mouse-ear cress]
emb|CAE04341.1|  OSJNBb0038F03.5                                        183   3e-52   Oryza sativa Japonica Group [Japonica rice]
dbj|BAE48298.1|  glutamate dehydrogenase 2                              183   4e-52   Oryza sativa Japonica Group [Japonica rice]
emb|CDP19847.1|  unnamed protein product                                183   4e-52   Coffea canephora [robusta coffee]
ref|XP_011003546.1|  PREDICTED: glutamate dehydrogenase 2-like          182   5e-52   Populus euphratica
ref|XP_010523287.1|  PREDICTED: glutamate dehydrogenase 2               182   6e-52   Tarenaya hassleriana [spider flower]
gb|EPS67189.1|  hypothetical protein M569_07586                         182   7e-52   Genlisea aurea
emb|CDY55181.1|  BnaAnng13720D                                          182   8e-52   Brassica napus [oilseed rape]
gb|AAK83585.1|  AT5g18170/MRG7_13                                       180   8e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010109148.1|  Glutamate dehydrogenase 2                          182   8e-52   Morus notabilis
ref|XP_009602761.1|  PREDICTED: glutamate dehydrogenase A-like is...    183   8e-52   Nicotiana tomentosiformis
emb|CDY14044.1|  BnaC02g01610D                                          182   8e-52   Brassica napus [oilseed rape]
ref|XP_004143666.1|  PREDICTED: glutamate dehydrogenase 2-like          182   1e-51   Cucumis sativus [cucumbers]
gb|KJB51358.1|  hypothetical protein B456_008G213200                    177   1e-51   Gossypium raimondii
dbj|BAB62170.1|  glutamate dehydrogenase                                182   1e-51   Brassica napus [oilseed rape]
ref|XP_009125690.1|  PREDICTED: glutamate dehydrogenase 2-like          182   1e-51   Brassica rapa
ref|XP_008238497.1|  PREDICTED: glutamate dehydrogenase 2-like          182   1e-51   Prunus mume [ume]
ref|XP_007209199.1|  hypothetical protein PRUPE_ppa006458mg             182   1e-51   Prunus persica
ref|XP_008467318.1|  PREDICTED: glutamate dehydrogenase 2-like          182   1e-51   Cucumis melo [Oriental melon]
ref|XP_004307767.1|  PREDICTED: glutamate dehydrogenase 2               182   1e-51   Fragaria vesca subsp. vesca
ref|XP_008234031.1|  PREDICTED: glutamate dehydrogenase 2               182   1e-51   Prunus mume [ume]
ref|XP_010550250.1|  PREDICTED: probable glutamate dehydrogenase 3      175   1e-51   
ref|XP_006376952.1|  hypothetical protein POPTR_0012s11500g             182   1e-51   Populus trichocarpa [western balsam poplar]
ref|XP_007218087.1|  hypothetical protein PRUPE_ppa006442mg             182   1e-51   Prunus persica
emb|CDX70039.1|  BnaA10g23880D                                          181   1e-51   
emb|CDY65233.1|  BnaC09g47860D                                          181   1e-51   Brassica napus [oilseed rape]
ref|XP_010423206.1|  PREDICTED: glutamate dehydrogenase 2               181   2e-51   Camelina sativa [gold-of-pleasure]
ref|XP_010269816.1|  PREDICTED: glutamate dehydrogenase 2-like          181   2e-51   
ref|XP_010274497.1|  PREDICTED: glutamate dehydrogenase 2               181   2e-51   Nelumbo nucifera [Indian lotus]
gb|ABR45724.1|  GDH2                                                    181   2e-51   Actinidia chinensis
ref|XP_006287548.1|  hypothetical protein CARUB_v10000757mg             183   2e-51   
gb|KJB51357.1|  hypothetical protein B456_008G213200                    178   2e-51   Gossypium raimondii
ref|XP_009602769.1|  PREDICTED: glutamate dehydrogenase A-like is...    181   2e-51   Nicotiana tomentosiformis
ref|XP_009122339.1|  PREDICTED: glutamate dehydrogenase 2               181   2e-51   Brassica rapa
ref|XP_011084766.1|  PREDICTED: glutamate dehydrogenase A-like          181   2e-51   Sesamum indicum [beniseed]
gb|ACH97123.2|  GDH2                                                    181   2e-51   Camellia sinensis [black tea]
gb|KDO57712.1|  hypothetical protein CISIN_1g012750mg                   181   2e-51   Citrus sinensis [apfelsine]
ref|XP_009771898.1|  PREDICTED: glutamate dehydrogenase A-like          181   2e-51   Nicotiana sylvestris
dbj|BAH56738.1|  AT5G07440                                              180   2e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002321781.1|  hypothetical protein POPTR_0015s12250g             181   2e-51   Populus trichocarpa [western balsam poplar]
ref|XP_010546127.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate de...    181   2e-51   Tarenaya hassleriana [spider flower]
gb|KDP22494.1|  hypothetical protein JCGZ_26325                         181   2e-51   Jatropha curcas
ref|XP_011040330.1|  PREDICTED: glutamate dehydrogenase 2               181   3e-51   Populus euphratica
emb|CDX81051.1|  BnaC03g03050D                                          181   3e-51   
emb|CDX78292.1|  BnaA03g02040D                                          181   3e-51   
ref|XP_008375213.1|  PREDICTED: glutamate dehydrogenase 2               181   3e-51   
ref|XP_009758042.1|  PREDICTED: glutamate dehydrogenase A               181   3e-51   Nicotiana sylvestris
sp|O04937.1|DHEA_NICPL  RecName: Full=Glutamate dehydrogenase A; ...    181   3e-51   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004300329.1|  PREDICTED: glutamate dehydrogenase 2-like          181   3e-51   Fragaria vesca subsp. vesca
ref|XP_006437037.1|  hypothetical protein CICLE_v10031681mg             181   4e-51   Citrus clementina [clementine]
ref|XP_009362726.1|  PREDICTED: glutamate dehydrogenase 2               181   4e-51   Pyrus x bretschneideri [bai li]
gb|KDP39958.1|  hypothetical protein JCGZ_03489                         181   4e-51   Jatropha curcas
ref|XP_009628256.1|  PREDICTED: glutamate dehydrogenase A               181   4e-51   Nicotiana tomentosiformis
ref|XP_009130990.1|  PREDICTED: glutamate dehydrogenase 2-like          181   4e-51   Brassica rapa
ref|XP_008786199.1|  PREDICTED: glutamate dehydrogenase 2               180   4e-51   Phoenix dactylifera
gb|KDP39703.1|  hypothetical protein JCGZ_02723                         180   5e-51   Jatropha curcas
gb|KJB51356.1|  hypothetical protein B456_008G213200                    178   5e-51   Gossypium raimondii
gb|KFK25129.1|  hypothetical protein AALP_AA8G069800                    180   5e-51   Arabis alpina [alpine rockcress]
ref|NP_196361.1|  glutamate dehydrogenase 2                             180   5e-51   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009389265.1|  PREDICTED: glutamate dehydrogenase 2               180   5e-51   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006399227.1|  hypothetical protein EUTSA_v10013680mg             180   5e-51   Eutrema salsugineum [saltwater cress]
gb|KHN01626.1|  Glutamate dehydrogenase 2                               180   6e-51   Glycine soja [wild soybean]
ref|XP_006647612.1|  PREDICTED: glutamate dehydrogenase 2-like          180   6e-51   Oryza brachyantha
ref|XP_007155713.1|  hypothetical protein PHAVU_003G225100g             180   6e-51   Phaseolus vulgaris [French bean]
ref|XP_006365338.1|  PREDICTED: glutamate dehydrogenase A-like          180   6e-51   Solanum tuberosum [potatoes]
gb|KDO57711.1|  hypothetical protein CISIN_1g012750mg                   181   6e-51   Citrus sinensis [apfelsine]
gb|KDO55040.1|  hypothetical protein CISIN_1g036924mg                   177   7e-51   Citrus sinensis [apfelsine]
ref|XP_010062756.1|  PREDICTED: glutamate dehydrogenase 2               180   7e-51   Eucalyptus grandis [rose gum]
gb|AFW59042.1|  hypothetical protein ZEAMMB73_138901                    174   9e-51   
ref|XP_006652598.1|  PREDICTED: glutamate dehydrogenase 2-like          179   9e-51   Oryza brachyantha
ref|NP_001236417.1|  glutamate dehydrogenase 2                          179   9e-51   
ref|XP_008364857.1|  PREDICTED: glutamate dehydrogenase 2               179   1e-50   
ref|XP_008453843.1|  PREDICTED: glutamate dehydrogenase 2               179   1e-50   Cucumis melo [Oriental melon]
ref|XP_004146893.1|  PREDICTED: glutamate dehydrogenase 2-like          179   1e-50   Cucumis sativus [cucumbers]
ref|XP_009363739.1|  PREDICTED: glutamate dehydrogenase 2-like          179   1e-50   Pyrus x bretschneideri [bai li]
ref|XP_003524183.1|  PREDICTED: glutamate dehydrogenase 2-like          179   1e-50   Glycine max [soybeans]
gb|KEH31619.1|  NADP-specific glutamate dehydrogenase                   179   1e-50   Medicago truncatula
ref|XP_002871806.1|  hypothetical protein ARALYDRAFT_488683             179   1e-50   
ref|XP_010276380.1|  PREDICTED: glutamate dehydrogenase 1               179   2e-50   Nelumbo nucifera [Indian lotus]
ref|XP_008441982.1|  PREDICTED: glutamate dehydrogenase 1               179   2e-50   Cucumis melo [Oriental melon]
ref|NP_001047589.1|  Os02g0650900                                       179   2e-50   
ref|XP_002511037.1|  glutamate dehydrogenase, putative                  179   2e-50   Ricinus communis
ref|XP_004147535.1|  PREDICTED: glutamate dehydrogenase 1-like          179   2e-50   Cucumis sativus [cucumbers]
ref|XP_009353148.1|  PREDICTED: glutamate dehydrogenase 1 isoform X2    176   2e-50   Pyrus x bretschneideri [bai li]
gb|KJB26487.1|  hypothetical protein B456_004G244400                    176   2e-50   Gossypium raimondii
ref|XP_008376356.1|  PREDICTED: glutamate dehydrogenase 2-like          179   2e-50   
ref|XP_002446878.1|  hypothetical protein SORBIDRAFT_06g024150          179   2e-50   Sorghum bicolor [broomcorn]
gb|EAY86911.1|  hypothetical protein OsI_08294                          178   2e-50   Oryza sativa Indica Group [Indian rice]
ref|NP_197318.1|  glutamate dehydrogenase 1                             178   2e-50   Arabidopsis thaliana [mouse-ear cress]
gb|ABR45723.1|  GDH1                                                    178   2e-50   Actinidia chinensis
gb|KHG11683.1|  Glutamate dehydrogenase 2 -like protein                 178   3e-50   Gossypium arboreum [tree cotton]
gb|KJB51355.1|  hypothetical protein B456_008G213200                    178   3e-50   Gossypium raimondii
ref|XP_006357314.1|  PREDICTED: glutamate dehydrogenase A-like          178   3e-50   Solanum tuberosum [potatoes]
ref|XP_010110567.1|  Glutamate dehydrogenase 2                          178   3e-50   Morus notabilis
ref|XP_006838512.1|  hypothetical protein AMTR_s00002p00181950          178   4e-50   Amborella trichopoda
ref|NP_001268039.1|  glutamate dehydrogenase                            178   4e-50   Vitis vinifera
ref|XP_011075044.1|  PREDICTED: glutamate dehydrogenase B               178   4e-50   Sesamum indicum [beniseed]
ref|XP_010662019.1|  PREDICTED: glutamate dehydrogenase isoform X1      178   4e-50   
ref|XP_004976416.1|  PREDICTED: glutamate dehydrogenase 2-like          178   4e-50   Setaria italica
ref|XP_006826287.1|  hypothetical protein AMTR_s00004p00059320          178   4e-50   Amborella trichopoda
ref|XP_010908645.1|  PREDICTED: glutamate dehydrogenase isoform X2      177   4e-50   Elaeis guineensis
ref|XP_011034367.1|  PREDICTED: glutamate dehydrogenase 1               177   4e-50   Populus euphratica
ref|XP_009599776.1|  PREDICTED: glutamate dehydrogenase B-like          177   5e-50   Nicotiana tomentosiformis
ref|XP_004240769.1|  PREDICTED: glutamate dehydrogenase A-like is...    177   5e-50   Solanum lycopersicum
ref|XP_007038224.1|  Glutamate dehydrogenase 2                          177   5e-50   
gb|EMS63997.1|  Glutamate dehydrogenase                                 177   5e-50   Triticum urartu
ref|XP_010492817.1|  PREDICTED: glutamate dehydrogenase 1-like          177   5e-50   Camelina sativa [gold-of-pleasure]
ref|XP_006287858.1|  hypothetical protein CARUB_v10001084mg             177   5e-50   Capsella rubella
ref|XP_010940072.1|  PREDICTED: glutamate dehydrogenase isoform X3      177   5e-50   
ref|XP_009800300.1|  PREDICTED: glutamate dehydrogenase B-like          177   6e-50   Nicotiana sylvestris
ref|XP_006362255.1|  PREDICTED: glutamate dehydrogenase-like            177   6e-50   Solanum tuberosum [potatoes]
ref|XP_010420561.1|  PREDICTED: glutamate dehydrogenase 1               177   6e-50   Camelina sativa [gold-of-pleasure]
emb|CAD12373.1|  glutamate dehydrogenase                                177   6e-50   Nicotiana tabacum [American tobacco]
ref|NP_001105301.1|  glutamate dehydrogenase                            177   6e-50   
ref|XP_010908644.1|  PREDICTED: glutamate dehydrogenase isoform X1      178   6e-50   Elaeis guineensis
ref|XP_010454041.1|  PREDICTED: glutamate dehydrogenase 1-like          177   6e-50   Camelina sativa [gold-of-pleasure]
ref|XP_008812048.1|  PREDICTED: glutamate dehydrogenase isoform X1      177   6e-50   
ref|XP_010933559.1|  PREDICTED: glutamate dehydrogenase 2               177   7e-50   Elaeis guineensis
gb|ACL53188.1|  unknown                                                 177   7e-50   Zea mays [maize]
ref|XP_004981456.1|  PREDICTED: glutamate dehydrogenase-like isof...    177   7e-50   Setaria italica
ref|NP_001241710.1|  glutamate dehydrogenase                            177   7e-50   Zea mays [maize]
ref|XP_004508961.1|  PREDICTED: glutamate dehydrogenase A-like          177   7e-50   Cicer arietinum [garbanzo]
gb|KJB26489.1|  hypothetical protein B456_004G244400                    176   7e-50   Gossypium raimondii
ref|NP_001051540.1|  Os03g0794500                                       177   7e-50   
ref|XP_009375072.1|  PREDICTED: glutamate dehydrogenase 1-like          170   7e-50   
ref|XP_006650717.1|  PREDICTED: glutamate dehydrogenase-like            177   7e-50   Oryza brachyantha
emb|CDP14320.1|  unnamed protein product                                177   8e-50   Coffea canephora [robusta coffee]
gb|ADW95819.1|  glutamate dehydrogenase                                 177   8e-50   Triticum aestivum [Canadian hard winter wheat]
dbj|BAK00921.1|  predicted protein                                      177   8e-50   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002319162.1|  Glutamate dehydrogenase 1 family protein           177   8e-50   Populus trichocarpa [western balsam poplar]
ref|XP_007030721.1|  Glutamate dehydrogenase 1 isoform 1                177   8e-50   Theobroma cacao [chocolate]
gb|ADT91914.1|  glutamate dehydrogenase                                 177   8e-50   Secale cereale x Triticum turgidum subsp. durum [hexaploid triticale]
ref|XP_002525427.1|  glutamate dehydrogenase, putative                  177   9e-50   Ricinus communis
gb|ADK13053.1|  glutamate dehydrogenase                                 177   9e-50   Pinus pinaster [cluster pine]
ref|XP_003557556.1|  PREDICTED: glutamate dehydrogenase                 177   1e-49   Brachypodium distachyon [annual false brome]
ref|XP_011021483.1|  PREDICTED: glutamate dehydrogenase 1-like is...    177   1e-49   Populus euphratica
ref|XP_010054553.1|  PREDICTED: glutamate dehydrogenase 1               177   1e-49   Eucalyptus grandis [rose gum]
ref|XP_010257677.1|  PREDICTED: glutamate dehydrogenase 1-like          177   1e-49   Nelumbo nucifera [Indian lotus]
ref|XP_010653726.1|  PREDICTED: GDHB glutamate dehydrogenase isof...    177   1e-49   Vitis vinifera
gb|EMT03028.1|  Glutamate dehydrogenase                                 177   1e-49   
ref|XP_003517396.1|  PREDICTED: glutamate dehydrogenase 2-like          177   1e-49   Glycine max [soybeans]
ref|XP_006300064.1|  hypothetical protein CARUB_v10016292mg             177   1e-49   Capsella rubella
emb|CAA09478.1|  glutamate dehydrogenase                                177   1e-49   Asparagus officinalis
ref|XP_009619953.1|  PREDICTED: glutamate dehydrogenase A-like          177   1e-49   Nicotiana tomentosiformis
ref|XP_002325838.1|  Glutamate dehydrogenase 1 family protein           177   1e-49   Populus trichocarpa [western balsam poplar]
ref|XP_006440169.1|  hypothetical protein CICLE_v10020390mg             176   1e-49   Citrus clementina [clementine]
ref|XP_009389003.1|  PREDICTED: glutamate dehydrogenase                 176   1e-49   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006400363.1|  hypothetical protein EUTSA_v10013679mg             175   1e-49   
ref|XP_010088046.1|  Glutamate dehydrogenase 1                          176   1e-49   Morus notabilis
gb|KJB19599.1|  hypothetical protein B456_003G110800                    174   1e-49   Gossypium raimondii
ref|XP_006443421.1|  hypothetical protein CICLE_v10020428mg             176   1e-49   Citrus clementina [clementine]
gb|KJB26488.1|  hypothetical protein B456_004G244400                    175   1e-49   Gossypium raimondii
gb|EAY92161.1|  hypothetical protein OsI_13874                          177   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_010524979.1|  PREDICTED: glutamate dehydrogenase 1               176   1e-49   Tarenaya hassleriana [spider flower]
gb|KHG30124.1|  putative glutamate dehydrogenase 3 -like protein        175   1e-49   Gossypium arboreum [tree cotton]
ref|XP_010485756.1|  PREDICTED: probable glutamate dehydrogenase 3      176   2e-49   Camelina sativa [gold-of-pleasure]
ref|XP_009399337.1|  PREDICTED: glutamate dehydrogenase                 176   2e-49   
gb|KDO57040.1|  hypothetical protein CISIN_1g014463mg                   175   2e-49   Citrus sinensis [apfelsine]
ref|XP_009121005.1|  PREDICTED: glutamate dehydrogenase 1               176   2e-49   Brassica rapa
ref|XP_011021482.1|  PREDICTED: glutamate dehydrogenase 1-like is...    177   2e-49   Populus euphratica
emb|CDY38492.1|  BnaA10g16660D                                          176   2e-49   Brassica napus [oilseed rape]
gb|EEE61431.1|  hypothetical protein OsJ_15647                          176   2e-49   Oryza sativa Japonica Group [Japonica rice]
gb|AAB51595.1|  glutamate dehydrogenase mutant                          176   2e-49   Zea mays [maize]
ref|XP_006477083.1|  PREDICTED: glutamate dehydrogenase 2-like is...    175   2e-49   
ref|XP_011021480.1|  PREDICTED: glutamate dehydrogenase 1-like is...    177   2e-49   Populus euphratica
gb|ABK25386.1|  unknown                                                 176   2e-49   Picea sitchensis
gb|KJB19600.1|  hypothetical protein B456_003G110800                    175   2e-49   Gossypium raimondii
ref|XP_002882318.1|  hypothetical protein ARALYDRAFT_896411             176   2e-49   Arabidopsis lyrata subsp. lyrata
ref|XP_010463859.1|  PREDICTED: probable glutamate dehydrogenase 3      176   2e-49   Camelina sativa [gold-of-pleasure]
emb|CDY25453.1|  BnaC09g39680D                                          176   2e-49   Brassica napus [oilseed rape]
ref|XP_009766751.1|  PREDICTED: glutamate dehydrogenase A-like          176   2e-49   Nicotiana sylvestris
gb|AAB51596.1|  glutamate dehydrogenase                                 176   2e-49   Zea mays [maize]
ref|XP_010515838.1|  PREDICTED: probable glutamate dehydrogenase 3      176   2e-49   Camelina sativa [gold-of-pleasure]
ref|NP_001233850.1|  glutamate dehydrogenase                            176   2e-49   
ref|NP_187041.1|  glutamate dehydrogenase 3                             176   2e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008391682.1|  PREDICTED: glutamate dehydrogenase 1-like is...    176   2e-49   
gb|KCW89863.1|  hypothetical protein EUGRSUZ_A02097                     177   2e-49   Eucalyptus grandis [rose gum]
ref|NP_001236404.1|  glutamate dehydrogenase 1                          176   2e-49   Glycine max [soybeans]
ref|XP_010327684.1|  PREDICTED: glutamate dehydrogenase isoform X1      176   2e-49   
ref|XP_004493157.1|  PREDICTED: glutamate dehydrogenase 1-like is...    176   2e-49   
ref|XP_006408244.1|  hypothetical protein EUTSA_v10020857mg             176   2e-49   
ref|XP_008391681.1|  PREDICTED: glutamate dehydrogenase 1-like is...    176   3e-49   
ref|XP_008386820.1|  PREDICTED: glutamate dehydrogenase 1               176   3e-49   
ref|XP_009353137.1|  PREDICTED: glutamate dehydrogenase 1 isoform X1    176   3e-49   
gb|KJB26490.1|  hypothetical protein B456_004G244400                    176   3e-49   Gossypium raimondii
ref|XP_004288417.1|  PREDICTED: glutamate dehydrogenase 1               176   3e-49   Fragaria vesca subsp. vesca
ref|XP_009366446.1|  PREDICTED: glutamate dehydrogenase 1               176   3e-49   Pyrus x bretschneideri [bai li]
gb|KHN34707.1|  Glutamate dehydrogenase 1                               176   3e-49   Glycine soja [wild soybean]
ref|XP_009102088.1|  PREDICTED: probable glutamate dehydrogenase 3      175   3e-49   Brassica rapa
ref|NP_001239645.1|  uncharacterized protein LOC100789509               175   3e-49   Glycine max [soybeans]
gb|KEH23528.1|  NADP-specific glutamate dehydrogenase                   175   3e-49   Medicago truncatula
gb|KEH25602.1|  NADP-specific glutamate dehydrogenase                   172   3e-49   Medicago truncatula
emb|CDY29969.1|  BnaC01g40390D                                          175   3e-49   Brassica napus [oilseed rape]
ref|XP_003611390.1|  Glutamate dehydrogenase                            175   3e-49   Medicago truncatula
ref|XP_007161939.1|  hypothetical protein PHAVU_001G110500g             175   4e-49   Phaseolus vulgaris [French bean]
ref|XP_007151845.1|  hypothetical protein PHAVU_004G080200g             175   4e-49   Phaseolus vulgaris [French bean]
ref|XP_006477082.1|  PREDICTED: glutamate dehydrogenase 2-like is...    175   4e-49   Citrus sinensis [apfelsine]
ref|XP_010940064.1|  PREDICTED: glutamate dehydrogenase isoform X2      177   4e-49   
ref|XP_009353387.1|  PREDICTED: glutamate dehydrogenase 1-like is...    168   4e-49   Pyrus x bretschneideri [bai li]
ref|XP_003518237.1|  PREDICTED: glutamate dehydrogenase 1-like          175   4e-49   Glycine max [soybeans]
ref|XP_010940056.1|  PREDICTED: glutamate dehydrogenase isoform X1      177   5e-49   
emb|CDY64896.1|  BnaC05g47630D                                          176   5e-49   Brassica napus [oilseed rape]
ref|XP_006477081.1|  PREDICTED: glutamate dehydrogenase 2-like is...    175   5e-49   Citrus sinensis [apfelsine]
gb|KFK37827.1|  hypothetical protein AALP_AA3G034400                    175   6e-49   Arabis alpina [alpine rockcress]
ref|XP_002278888.1|  PREDICTED: glutamate dehydrogenase                 175   6e-49   Vitis vinifera
ref|XP_006477080.1|  PREDICTED: glutamate dehydrogenase 2-like is...    175   6e-49   Citrus sinensis [apfelsine]
gb|KFK26056.1|  hypothetical protein AALP_AA8G197400                    174   7e-49   Arabis alpina [alpine rockcress]
ref|XP_006400364.1|  hypothetical protein EUTSA_v10013679mg             174   7e-49   Eutrema salsugineum [saltwater cress]
ref|XP_008794889.1|  PREDICTED: glutamate dehydrogenase 2-like          174   7e-49   Phoenix dactylifera
gb|KJB19598.1|  hypothetical protein B456_003G110800                    174   8e-49   Gossypium raimondii
ref|XP_010672048.1|  PREDICTED: glutamate dehydrogenase B               174   9e-49   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_003548062.1|  PREDICTED: glutamate dehydrogenase 1-like          174   9e-49   Glycine max [soybeans]
gb|EYU39994.1|  hypothetical protein MIMGU_mgv1a007324mg                174   9e-49   Erythranthe guttata [common monkey flower]
ref|XP_007202170.1|  hypothetical protein PRUPE_ppa006457mg             174   9e-49   Prunus persica
ref|XP_008240473.1|  PREDICTED: glutamate dehydrogenase 1               174   1e-48   Prunus mume [ume]
ref|XP_008805384.1|  PREDICTED: glutamate dehydrogenase-like            174   1e-48   
gb|EPS68533.1|  hypothetical protein M569_06232                         174   1e-48   Genlisea aurea
gb|KEH23527.1|  NADP-specific glutamate dehydrogenase                   175   2e-48   Medicago truncatula
gb|KJB51764.1|  hypothetical protein B456_008G231000                    172   2e-48   Gossypium raimondii
ref|NP_001132187.1|  hypothetical protein                               174   2e-48   Zea mays [maize]
gb|KGN50342.1|  hypothetical protein Csa_5G168800                       174   2e-48   Cucumis sativus [cucumbers]
ref|XP_004511739.1|  PREDICTED: glutamate dehydrogenase 2-like          174   2e-48   Cicer arietinum [garbanzo]
ref|XP_008389767.1|  PREDICTED: glutamate dehydrogenase 1-like is...    165   2e-48   
ref|XP_008355842.1|  PREDICTED: glutamate dehydrogenase 1-like          166   3e-48   
ref|XP_008384444.1|  PREDICTED: glutamate dehydrogenase 1-like          164   3e-48   
gb|KHG16642.1|  Glutamate dehydrogenase 2 -like protein                 173   3e-48   Gossypium arboreum [tree cotton]
gb|KJB51762.1|  hypothetical protein B456_008G231000                    172   4e-48   Gossypium raimondii
ref|XP_003618972.1|  Glutamate dehydrogenase                            172   5e-48   Medicago truncatula
gb|AAL36888.3|AF403178_1  NADH-glutamate dehydrogenase                  172   5e-48   Solanum lycopersicum
gb|KJB45110.1|  hypothetical protein B456_007G289700                    172   8e-48   Gossypium raimondii
gb|KHG11816.1|  Glutamate dehydrogenase 1 -like protein                 172   9e-48   Gossypium arboreum [tree cotton]
ref|XP_009765753.1|  PREDICTED: glutamate dehydrogenase B               172   9e-48   Nicotiana sylvestris
ref|XP_009621291.1|  PREDICTED: glutamate dehydrogenase B               171   1e-47   
sp|Q9LEC8.1|DHEB_NICPL  RecName: Full=Glutamate dehydrogenase B; ...    171   1e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_004489708.1|  PREDICTED: probable glutamate dehydrogenase ...    171   1e-47   Cicer arietinum [garbanzo]
emb|CAA69601.2|  NADH glutamate dehydrogenase                           171   1e-47   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
emb|CDY50862.1|  BnaA05g37230D                                          174   1e-47   Brassica napus [oilseed rape]
gb|ABF57084.1|  GDHB glutamate dehydrogenase                            171   2e-47   Vitis vinifera
ref|NP_001267906.1|  GDHB glutamate dehydrogenase                       171   2e-47   Vitis vinifera
emb|CAN63801.1|  hypothetical protein VITISV_030415                     170   3e-47   Vitis vinifera
ref|XP_002992795.1|  hypothetical protein SELMODRAFT_272294             167   4e-46   Selaginella moellendorffii
ref|XP_002962967.1|  hypothetical protein SELMODRAFT_270327             167   5e-46   Selaginella moellendorffii
ref|XP_008352416.1|  PREDICTED: probable glutamate dehydrogenase 3      159   1e-45   
ref|XP_002962966.1|  hypothetical protein SELMODRAFT_78170              166   1e-45   Selaginella moellendorffii
ref|XP_008346543.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate de...    162   2e-45   
gb|AAV74197.1|  glutamate dehydrogenase 1                               165   3e-45   Lupinus luteus
gb|ADP03160.1|  glutamate dehydrogenase                                 164   5e-45   Pinus sylvestris [Scotch pine]
gb|ADP03154.1|  glutamate dehydrogenase                                 164   5e-45   Pinus sylvestris [Scotch pine]
ref|XP_008345738.1|  PREDICTED: LOW QUALITY PROTEIN: glutamate de...    157   2e-44   
gb|ABO31540.1|  GdhA protein                                            154   2e-44   Triticum dicoccon [cultivated emmer wheat]
ref|XP_006368946.1|  hypothetical protein POPTR_0001s15130g             152   9e-44   
gb|KHN32762.1|  Glutamate dehydrogenase B                               161   1e-43   Glycine soja [wild soybean]
gb|AAU04391.1|  putative glutamate dehydrogenase 1 protein              150   3e-42   Brassica napus [oilseed rape]
gb|ABO31543.1|  GdhA protein                                            148   8e-42   Triticum dicoccon [cultivated emmer wheat]
ref|XP_001763642.1|  predicted protein                                  155   1e-41   
emb|CBI26588.3|  unnamed protein product                                139   6e-39   Vitis vinifera
ref|XP_010452711.1|  PREDICTED: glutamate dehydrogenase 2-like          145   7e-38   Camelina sativa [gold-of-pleasure]
emb|CBI40927.3|  unnamed protein product                                134   1e-34   Vitis vinifera
gb|ABO31626.1|  GdhA protein                                            125   4e-33   Triticum dicoccoides [wild emmer wheat]
gb|ABO31629.1|  GdhA protein                                            124   5e-33   Triticum dicoccoides [wild emmer wheat]
gb|ABO31565.1|  GdhA protein                                            122   1e-32   Triticum turgidum subsp. durum
gb|ABO31643.1|  GdhA protein                                            117   3e-30   Triticum timopheevii subsp. armeniacum
dbj|BAI99409.1|  putative glutamate dehydrogenase                       115   4e-29   Shorea bullata
dbj|BAI99435.1|  putative glutamate dehydrogenase                       115   4e-29   Shorea fallax
dbj|BAI99408.1|  putative glutamate dehydrogenase                       115   4e-29   Shorea bullata
dbj|BAI99430.1|  putative glutamate dehydrogenase                       115   4e-29   Shorea fallax
dbj|BAI99462.1|  putative glutamate dehydrogenase                       115   4e-29   Dipterocarpus palembanicus
gb|KJB51360.1|  hypothetical protein B456_008G213200                    120   9e-29   Gossypium raimondii
gb|EMT15031.1|  Glutamate dehydrogenase 2                               120   4e-28   
ref|XP_006443420.1|  hypothetical protein CICLE_v10020428mg             117   9e-28   
emb|CDY64900.1|  BnaC05g47670D                                          113   2e-27   
gb|KHN00676.1|  Glutamate dehydrogenase 1                               115   6e-27   
ref|WP_044239514.1|  glutamate dehydrogenase                            115   7e-27   
ref|WP_008693814.1|  NAD-specific glutamate dehydrogenase               113   3e-26   
dbj|BAI99459.1|  putative glutamate dehydrogenase                       107   5e-26   
ref|WP_008686709.1|  Glu/Leu/Phe/Val dehydrogenase                      111   1e-25   
ref|WP_013938436.1|  glutamate dehydrogenase                            110   5e-25   
ref|WP_014399186.1|  glutamate dehydrogenase                            109   5e-25   
ref|WP_015352014.1|  glutamate dehydrogenase                            109   5e-25   
ref|WP_009102178.1|  Glu/Leu/Phe/Val dehydrogenase                      109   6e-25   
ref|WP_007324149.1|  glutamate dehydrogenase                            109   7e-25   
ref|WP_008664513.1|  Glu/Leu/Phe/Val dehydrogenase                      109   8e-25   
ref|WP_011555824.1|  glutamate dehydrogenase                            108   9e-25   
ref|WP_002638797.1|  glutamate dehydrogenase                            108   1e-24   
ref|WP_013377359.1|  glutamate dehydrogenase                            108   1e-24   
ref|WP_008660682.1|  Glu/Leu/Phe/Val dehydrogenase                      108   2e-24   
ref|WP_013629084.1|  glutamate dehydrogenase                            107   2e-24   
ref|WP_043392404.1|  glutamate dehydrogenase                            107   5e-24   
ref|WP_002649508.1|  glutamate dehydrogenase                            107   5e-24   
ref|WP_013564157.1|  glutamate dehydrogenase                            106   9e-24   
ref|WP_020466792.1|  glutamate dehydrogenase                            105   1e-23   
gb|AGA29415.1|  glutamate dehydrogenase/leucine dehydrogenase           105   2e-23   
ref|WP_044196583.1|  glutamate dehydrogenase                            102   2e-22   
ref|WP_012912938.1|  glutamate dehydrogenase                            102   2e-22   
ref|WP_002629950.1|  NAD-specific glutamate dehydrogenase               101   4e-22   
ref|WP_026158016.1|  glutamate dehydrogenase                          96.3    4e-20   
ref|WP_034124852.1|  glutamate dehydrogenase                          95.5    7e-20   
ref|WP_010586665.1|  glutamate dehydrogenase                          95.5    7e-20   
ref|WP_012257936.1|  MULTISPECIES: glutamate dehydrogenase            94.4    2e-19   
ref|WP_022948882.1|  glutamate dehydrogenase                          94.0    2e-19   
ref|XP_005647692.1|  glutamate dehydrogenase                          93.6    4e-19   
ref|WP_041399962.1|  glutamate dehydrogenase                          93.2    5e-19   
ref|WP_018052988.1|  hypothetical protein                             92.8    7e-19   
ref|WP_015941414.1|  glutamate dehydrogenase                          92.4    9e-19   
ref|WP_028457741.1|  glutamate dehydrogenase                          92.4    1e-18   
ref|XP_002953152.1|  hypothetical protein VOLCADRAFT_63307            91.7    1e-18   
ref|WP_012192034.1|  glutamate dehydrogenase                          91.3    2e-18   
ref|WP_031459585.1|  glutamate dehydrogenase                          90.9    3e-18   
ref|WP_028458421.1|  glutamate dehydrogenase                          90.9    4e-18   
ref|WP_030150090.1|  glutamate dehydrogenase                          90.9    4e-18   
ref|WP_012308744.1|  glutamate dehydrogenase                          90.9    4e-18   
ref|WP_031458039.1|  glutamate dehydrogenase                          90.9    4e-18   
ref|WP_036967504.1|  glutamate dehydrogenase                          90.5    5e-18   
ref|WP_041731435.1|  glutamate dehydrogenase                          90.1    5e-18   
ref|WP_020016996.1|  glutamate dehydrogenase                          90.5    5e-18   
ref|XP_008812051.1|  PREDICTED: glutamate dehydrogenase isoform X2    89.7    5e-18   
ref|WP_026444936.1|  amino acid dehydrogenase                         90.1    6e-18   
ref|WP_012209376.1|  glutamate dehydrogenase                          90.1    7e-18   
ref|WP_012120518.1|  glutamate dehydrogenase                          90.1    7e-18   
gb|KDD76068.1|  glutamate/leucine/phenylalanine/valine dehydrogenase  90.1    9e-18   
ref|WP_042668889.1|  hypothetical protein                             85.1    1e-17   
ref|XP_011397125.1|  Glutamate dehydrogenase B                        89.7    1e-17   
ref|XP_001702270.1|  glutamate dehydrogenase                          89.7    1e-17   
gb|ADB49136.1|  Glu/Leu/Phe/Val dehydrogenase                         89.4    1e-17   
ref|WP_015052877.1|  glutamate dehydrogenase                          89.0    2e-17   
ref|WP_039727111.1|  hypothetical protein                             86.7    2e-17   
ref|WP_012257569.1|  MULTISPECIES: glutamate dehydrogenase            89.4    2e-17   
ref|WP_013117628.1|  glutamate dehydrogenase                          89.0    2e-17   
ref|WP_011956459.1|  glutamate dehydrogenase                          89.0    2e-17   
ref|WP_042438567.1|  glutamate dehydrogenase                          89.0    2e-17   
ref|WP_015324172.1|  glutamate dehydrogenase/leucine dehydrogenase    88.6    2e-17   
ref|WP_026369216.1|  glutamate dehydrogenase                          88.6    2e-17   
ref|WP_006560701.1|  glutamate dehydrogenase                          88.6    2e-17   
ref|WP_031504421.1|  glutamate dehydrogenase                          88.6    2e-17   
ref|WP_038678476.1|  glutamate dehydrogenase                          88.6    2e-17   
gb|EKD88497.1|  hypothetical protein ACD_34C00500G0001                85.9    3e-17   
ref|WP_013581369.1|  glutamate dehydrogenase                          88.6    3e-17   
ref|WP_014803005.1|  glutamate dehydrogenase                          88.2    3e-17   
gb|KIZ01160.1|  glutamate dehydrogenase (NAD(P)+)                     86.7    3e-17   
ref|WP_041076275.1|  glutamate dehydrogenase                          88.2    3e-17   
ref|WP_044177738.1|  amino acid dehydrogenase                         88.2    3e-17   
ref|WP_012879377.1|  glutamate dehydrogenase                          88.2    3e-17   
gb|KIP51743.1|  hypothetical protein SD72_13630                       88.2    3e-17   
gb|ACZ20787.1|  glutamate dehydrogenase/leucine dehydrogenase         88.6    3e-17   
ref|WP_042545013.1|  hypothetical protein                             88.2    3e-17   
ref|XP_005847310.1|  hypothetical protein CHLNCDRAFT_31314            88.6    4e-17   
ref|WP_007518896.1|  glutamate dehydrogenase                          88.2    4e-17   
gb|AEU35152.1|  Glutamate dehydrogenase (NAD(P)(+))                   88.2    4e-17   
ref|WP_013567832.1|  glutamate dehydrogenase                          87.8    4e-17   
gb|ACZ39082.1|  Glu/Leu/Phe/Val dehydrogenase                         87.8    4e-17   
ref|WP_042659996.1|  hypothetical protein                             87.0    4e-17   
emb|CAJ65316.1|  Glutamate dehydrogenase (GDH)                        87.8    4e-17   
ref|WP_041939956.1|  glutamate dehydrogenase                          87.8    4e-17   
gb|KJE24541.1|  glutamate dehydrogenase/leucine dehydrogenase         87.8    4e-17   
ref|WP_041857221.1|  glutamate dehydrogenase                          87.8    5e-17   
gb|ACR79022.1|  Glu/Leu/Phe/Val dehydrogenase                         87.4    5e-17   
ref|WP_041288610.1|  glutamate dehydrogenase                          87.4    5e-17   
gb|ABJ81055.1|  glutamate dehydrogenase (NADP)                        87.8    5e-17   
ref|WP_013421356.1|  glutamate dehydrogenase                          87.4    5e-17   
ref|WP_009741628.1|  glutamate dehydrogenase                          87.4    6e-17   
ref|WP_036948252.1|  glutamate dehydrogenase                          87.4    6e-17   
ref|WP_041186330.1|  glutamate dehydrogenase                          87.4    6e-17   
emb|CBK40217.1|  Glutamate dehydrogenase                              87.4    6e-17   
ref|WP_015868742.1|  glutamate dehydrogenase                          87.4    6e-17   
ref|WP_018194773.1|  MULTISPECIES: hypothetical protein               87.4    7e-17   
ref|WP_026876308.1|  hypothetical protein                             87.0    8e-17   
gb|ACZ39374.1|  Glu/Leu/Phe/Val dehydrogenase                         87.4    8e-17   
dbj|BAB62312.1|  glutamate dehydrogenase                              87.0    8e-17   
ref|WP_043109795.1|  glutamate dehydrogenase                          87.0    8e-17   
ref|WP_043605324.1|  glutamate dehydrogenase                          87.0    9e-17   
dbj|GAF49084.1|  putative glutamate dehydrogenase                     87.0    9e-17   
ref|WP_026446816.1|  glutamate dehydrogenase                          87.0    9e-17   
ref|WP_037240343.1|  glutamate dehydrogenase                          86.7    1e-16   
ref|WP_026392370.1|  amino acid dehydrogenase                         86.7    1e-16   
gb|AGF93573.1|  glutamate dehydrogenase (NAD(P)+) oxidoreductase ...  86.7    1e-16   
dbj|BAB62311.1|  glutamate dhydrogenase                               87.0    1e-16   
ref|WP_014786287.1|  glutamate dehydrogenase                          86.7    1e-16   
ref|WP_006981501.1|  glutamate dehydrogenase                          86.7    1e-16   
gb|AIY89993.1|  glutamate dehydrogenase                               86.3    1e-16   
ref|WP_015897940.1|  glutamate dehydrogenase                          86.7    1e-16   
ref|WP_013839551.1|  glutamate dehydrogenase                          86.7    1e-16   
gb|KGM11238.1|  glutamate dehydrogenase                               86.7    1e-16   
ref|WP_013932624.1|  glutamate dehydrogenase                          86.3    1e-16   
ref|WP_035134794.1|  glutamate dehydrogenase                          86.3    2e-16   
ref|WP_011438744.1|  MULTISPECIES: glutamate dehydrogenase            86.3    2e-16   
gb|ACJ75038.1|  glutamate dehydrogenase                               86.3    2e-16   
ref|WP_026068644.1|  glutamate dehydrogenase                          86.3    2e-16   
ref|WP_036573451.1|  hypothetical protein                             85.9    2e-16   
ref|WP_035908609.1|  glutamate dehydrogenase                          86.3    2e-16   
ref|WP_026853495.1|  glutamate dehydrogenase                          85.9    2e-16   
ref|WP_035729126.1|  glutamate dehydrogenase                          85.9    2e-16   
gb|EKD78652.1|  hypothetical protein ACD_41C00304G0005                84.0    2e-16   
ref|WP_041426152.1|  glutamate dehydrogenase                          85.9    2e-16   
ref|WP_011959055.1|  glutamate dehydrogenase                          85.9    2e-16   
gb|ABR30177.1|  Glu/Leu/Phe/Val dehydrogenase, C terminal             85.9    2e-16   
ref|WP_006542355.1|  glutamate dehydrogenase                          85.9    2e-16   
ref|WP_012119275.1|  glutamate dehydrogenase                          85.9    2e-16   
ref|WP_041399836.1|  glutamate dehydrogenase                          85.5    3e-16   
gb|AIA12416.1|  Glutamate/Leucine/Phenylalanine/Valine dehydrogenase  85.9    3e-16   
ref|WP_031444358.1|  glutamate dehydrogenase                          85.5    3e-16   
ref|XP_005648944.1|  glutamate dehydrogenase                          85.9    3e-16   
ref|WP_029663773.1|  glutamate dehydrogenase                          85.5    3e-16   
ref|WP_043653381.1|  glutamate dehydrogenase                          85.1    3e-16   
ref|WP_012157627.1|  glutamate dehydrogenase                          85.1    4e-16   
ref|WP_018506160.1|  glutamate dehydrogenase                          85.1    4e-16   
ref|WP_031495346.1|  amino acid dehydrogenase                         85.1    4e-16   
ref|WP_021483445.1|  glutamate dehydrogenase                          85.1    4e-16   
ref|WP_033410315.1|  glutamate dehydrogenase                          85.1    4e-16   
ref|WP_002809315.1|  amino acid dehydrogenase                         85.1    4e-16   
ref|WP_013897664.1|  glutamate dehydrogenase                          85.1    4e-16   
ref|WP_015744731.1|  glutamate dehydrogenase                          85.1    4e-16   
gb|ESU19063.1|  glutamate dehydrogenase/leucine dehydrogenase         85.1    4e-16   
gb|ACM05209.1|  glutamate dehydrogenase                               85.1    5e-16   
ref|WP_041436835.1|  glutamate dehydrogenase                          84.7    5e-16   
ref|WP_014101516.1|  glutamate dehydrogenase                          85.1    5e-16   
ref|WP_035118355.1|  glutamate dehydrogenase                          85.1    5e-16   
ref|WP_023576575.1|  glutamate dehydrogenase/leucine dehydrogenase    85.1    5e-16   
ref|WP_026388531.1|  amino acid dehydrogenase                         84.7    5e-16   
ref|WP_027986972.1|  glutamate dehydrogenase                          84.7    5e-16   
ref|WP_015018577.1|  glutamate dehydrogenase                          84.7    5e-16   
ref|WP_006929159.1|  glutamate dehydrogenase                          84.7    5e-16   
gb|EKD76267.1|  glutamate dehydrogenase                               83.2    5e-16   
ref|WP_023572249.1|  glutamate dehydrogenase                          84.7    5e-16   
ref|WP_018636286.1|  glutamate dehydrogenase                          84.7    6e-16   
ref|WP_039192679.1|  MULTISPECIES: glutamate dehydrogenase            84.7    6e-16   
ref|WP_026815052.1|  glutamate dehydrogenase                          84.7    6e-16   
ref|WP_042661133.1|  glutamate dehydrogenase                          84.7    6e-16   
ref|WP_029288281.1|  glutamate dehydrogenase                          84.7    6e-16   
ref|WP_026336485.1|  amino acid dehydrogenase                         84.7    6e-16   
gb|EKD50056.1|  hypothetical protein ACD_62C00670G0006                81.6    6e-16   
ref|WP_020708978.1|  glutamate dehydrogenase                          84.7    6e-16   
ref|WP_042213080.1|  glutamate dehydrogenase                          84.7    6e-16   
gb|ACY24465.1|  glutamate dehydrogenase/leucine dehydrogenase         84.7    7e-16   
gb|ESU28481.1|  glutamate dehydrogenase/leucine dehydrogenase         84.3    7e-16   
ref|WP_035677958.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_029447835.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_025613819.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_034668323.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_029445006.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_026808892.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_025225789.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_012311345.1|  MULTISPECIES: glutamate dehydrogenase            84.3    8e-16   
ref|WP_035354191.1|  amino acid dehydrogenase                         84.3    8e-16   
pdb|1B26|A  Chain A, Glutamate Dehydrogenase                          84.3    8e-16   
ref|WP_024479068.1|  glutamate dehydrogenase                          84.3    8e-16   
ref|WP_004080520.1|  MULTISPECIES: glutamate dehydrogenase            84.3    8e-16   
ref|WP_005268796.1|  glutamate dehydrogenase (NAD(P)+)                84.3    8e-16   
ref|WP_027885670.1|  glutamate dehydrogenase                          84.3    9e-16   
ref|WP_041466363.1|  glutamate dehydrogenase                          84.0    9e-16   
ref|WP_038234045.1|  glutamate dehydrogenase                          84.3    9e-16   
ref|WP_010933678.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|WP_038042221.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|WP_013549806.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|WP_035957703.1|  glutamate dehydrogenase                          84.0    1e-15   
gb|ACF12293.1|  Glu/Leu/Phe/Val dehydrogenase                         84.0    1e-15   
gb|ABL64234.1|  glutamate dehydrogenase (NAD/NADP)                    84.0    1e-15   
ref|WP_041975774.1|  amino acid dehydrogenase                         84.0    1e-15   
ref|WP_037321210.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|NP_001059256.1|  Os07g0238700                                     81.3    1e-15   
ref|WP_015754133.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|WP_036153229.1|  glutamate dehydrogenase                          84.0    1e-15   
ref|WP_020211428.1|  glutamate dehydrogenase                          84.0    1e-15   
gb|AIF84674.1|  glutamate dehydrogenase/leucine dehydrogenase         83.6    1e-15   
ref|WP_026981790.1|  glutamate dehydrogenase                          83.6    1e-15   
ref|WP_041536399.1|  hypothetical protein                             83.6    1e-15   
ref|WP_008476250.1|  glutamate dehydrogenase                          83.6    1e-15   
ref|WP_022202131.1|  glutamate dehydrogenase                          83.6    1e-15   
ref|WP_015232030.1|  glutamate dehydrogenase/leucine dehydrogenase    83.6    2e-15   
emb|CEP78770.1|  Glutamate dehydrogenase                              83.6    2e-15   
gb|ABS62742.1|  Glu/Leu/Phe/Val dehydrogenase                         83.6    2e-15   
ref|WP_041083842.1|  glutamate dehydrogenase                          83.6    2e-15   
ref|WP_002585059.1|  glutamate dehydrogenase (NAD(P)+) [              83.6    2e-15   
ref|WP_014203734.1|  glutamate dehydrogenase                          83.6    2e-15   
ref|WP_023424970.1|  Glutamate dehydrogenase/leucine dehydrogenase    83.6    2e-15   
ref|WP_002569257.1|  glutamate dehydrogenase [                        83.6    2e-15   
ref|WP_009367797.1|  glutamate dehydrogenase                          83.6    2e-15   
ref|WP_002576986.1|  glutamate dehydrogenase (NAD(P)+) [              83.6    2e-15   
ref|WP_002573058.1|  MULTISPECIES: glutamate dehydrogenase (NAD(P)+)  83.6    2e-15   
ref|WP_008102289.1|  glutamate dehydrogenase                          83.2    2e-15   
pdb|1B3B|A  Chain A, Thermotoga Maritima Glutamate Dehydrogenase ...  83.2    2e-15   
ref|WP_034133220.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_010923750.1|  glutamate dehydrogenase                          83.2    2e-15   
pdb|2TMG|A  Chain A, Thermotoga Maritima Glutamate Dehydrogenase ...  83.2    2e-15   
ref|WP_012713349.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_012717609.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_012716014.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_040827158.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_009248840.1|  glutamate dehydrogenase                          83.2    2e-15   
ref|WP_004605902.1|  glutamate dehydrogenase [                        83.2    2e-15   



>ref|NP_001053457.2| Os04g0543900 [Oryza sativa Japonica Group]
 dbj|BAF15371.2| Os04g0543900 [Oryza sativa Japonica Group]
Length=178

 Score =   183 bits (464),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDX87065.1| BnaC09g03800D [Brassica napus]
Length=227

 Score =   182 bits (462),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EYU35165.1| hypothetical protein MIMGU_mgv1a021743mg [Erythranthe guttata]
Length=381

 Score =   185 bits (469),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004235200.1| PREDICTED: glutamate dehydrogenase A [Solanum lycopersicum]
Length=411

 Score =   186 bits (471),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 87/89 (98%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|AAK62421.1|AF386976_1 glutamate dehydrogenase 2 [Arabidopsis thaliana]
 gb|AAL66950.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
Length=228

 Score =   180 bits (457),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011076454.1| PREDICTED: glutamate dehydrogenase A [Sesamum indicum]
Length=411

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EYU20157.1| hypothetical protein MIMGU_mgv1a007303mg [Erythranthe guttata]
Length=411

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIE+SLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIERSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>dbj|BAJ96415.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ97349.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EMS58358.1| Glutamate dehydrogenase 2 [Triticum urartu]
Length=411

 Score =   184 bits (467),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006358191.1| PREDICTED: glutamate dehydrogenase A-like [Solanum tuberosum]
Length=411

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIP+DDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPEDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_003580259.1| PREDICTED: glutamate dehydrogenase 2 [Brachypodium distachyon]
Length=411

 Score =   184 bits (466),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001119184.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 gb|AED91159.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
Length=309

 Score =   181 bits (458),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CAE04341.1| OSJNBb0038F03.5 [Oryza sativa Japonica Group]
Length=412

 Score =   183 bits (465),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>dbj|BAE48298.1| glutamate dehydrogenase 2 [Oryza sativa Japonica Group]
 gb|EAY95032.1| hypothetical protein OsI_16842 [Oryza sativa Indica Group]
Length=411

 Score =   183 bits (465),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDP19847.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   183 bits (464),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/89 (97%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDG LVSFVGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGGLVSFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011003546.1| PREDICTED: glutamate dehydrogenase 2-like [Populus euphratica]
Length=411

 Score =   182 bits (463),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRHAARLLGLDSKVEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010523287.1| PREDICTED: glutamate dehydrogenase 2 [Tarenaya hassleriana]
Length=411

 Score =   182 bits (463),  Expect = 6e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLDSKIEKSLLIPFREIKVECTIPKDDGTL+S++GFRVQHDN
Sbjct  1    MNALAATSRNFRHAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLMSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EPS67189.1| hypothetical protein M569_07586 [Genlisea aurea]
Length=412

 Score =   182 bits (463),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLD+KIEKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDAKIEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDY55181.1| BnaAnng13720D [Brassica napus]
Length=403

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|AAK83585.1| AT5g18170/MRG7_13 [Arabidopsis thaliana]
Length=338

 Score =   180 bits (457),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 87/90 (97%), Gaps = 0/90 (0%)
 Frame = +1

Query  289  AMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHD  468
            AMNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHD
Sbjct  16   AMNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHD  75

Query  469  NARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            NARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  76   NARGPMKGGIRYHPEVDPDEVNALAQLMTW  105



>ref|XP_010109148.1| Glutamate dehydrogenase 2 [Morus notabilis]
 gb|EXC21077.1| Glutamate dehydrogenase 2 [Morus notabilis]
Length=411

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 89/89 (100%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR+AAR+LGLDSKIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRKAARLLGLDSKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009602761.1| PREDICTED: glutamate dehydrogenase A-like isoform X1 [Nicotiana 
tomentosiformis]
Length=442

 Score =   183 bits (464),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +1

Query  289  AMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHD  468
            AMNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHD
Sbjct  31   AMNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHD  90

Query  469  NARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            NARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  91   NARGPMKGGIRYHPEVDLDEVNALAQLMTW  120



>emb|CDY14044.1| BnaC02g01610D [Brassica napus]
Length=403

 Score =   182 bits (462),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004143666.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus]
 ref|XP_004158111.1| PREDICTED: LOW QUALITY PROTEIN: glutamate dehydrogenase 2-like 
[Cucumis sativus]
Length=411

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSKIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB51358.1| hypothetical protein B456_008G213200 [Gossypium raimondii]
Length=253

 Score =   177 bits (450),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALA T+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAGTSRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>dbj|BAB62170.1| glutamate dehydrogenase [Brassica napus]
 dbj|BAE45943.1| glutamate dehydrogenase 2 [Brassica napus]
Length=411

 Score =   182 bits (462),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009125690.1| PREDICTED: glutamate dehydrogenase 2-like [Brassica rapa]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008238497.1| PREDICTED: glutamate dehydrogenase 2-like [Prunus mume]
 ref|XP_008238499.1| PREDICTED: glutamate dehydrogenase 2-like [Prunus mume]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_007209199.1| hypothetical protein PRUPE_ppa006458mg [Prunus persica]
 gb|EMJ10398.1| hypothetical protein PRUPE_ppa006458mg [Prunus persica]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008467318.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis melo]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSKIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRNAARILGLDSKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004307767.1| PREDICTED: glutamate dehydrogenase 2 [Fragaria vesca subsp. vesca]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AAR+LGLD+KIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRNAARLLGLDAKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008234031.1| PREDICTED: glutamate dehydrogenase 2 [Prunus mume]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLD+KIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRNAARILGLDAKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010550250.1| PREDICTED: probable glutamate dehydrogenase 3 [Tarenaya hassleriana]
Length=186

 Score =   175 bits (444),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+SL+IPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLERSLIIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006376952.1| hypothetical protein POPTR_0012s11500g [Populus trichocarpa]
 gb|ERP54749.1| hypothetical protein POPTR_0012s11500g [Populus trichocarpa]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRHASRLLGLDSKVEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_007218087.1| hypothetical protein PRUPE_ppa006442mg [Prunus persica]
 gb|EMJ19286.1| hypothetical protein PRUPE_ppa006442mg [Prunus persica]
Length=411

 Score =   182 bits (461),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLD+KIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRNAARILGLDAKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDX70039.1| BnaA10g23880D [Brassica napus]
Length=403

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVSF+GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDY65233.1| BnaC09g47860D [Brassica napus]
Length=403

 Score =   181 bits (460),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVSF+GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010423206.1| PREDICTED: glutamate dehydrogenase 2 [Camelina sativa]
 ref|XP_010491363.1| PREDICTED: glutamate dehydrogenase 2 [Camelina sativa]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010269816.1| PREDICTED: glutamate dehydrogenase 2-like [Nelumbo nucifera]
 ref|XP_010269817.1| PREDICTED: glutamate dehydrogenase 2-like [Nelumbo nucifera]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLV++VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVTYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010274497.1| PREDICTED: glutamate dehydrogenase 2 [Nelumbo nucifera]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ABR45724.1| GDH2 [Actinidia chinensis]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006287548.1| hypothetical protein CARUB_v10000757mg, partial [Capsella rubella]
 gb|EOA20446.1| hypothetical protein CARUB_v10000757mg, partial [Capsella rubella]
Length=509

 Score =   183 bits (465),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/105 (84%), Positives = 94/105 (90%), Gaps = 4/105 (4%)
 Frame = +1

Query  244  VFVFPFSLIFLGDLPAMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKD  423
            V  F FSL+      +MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKD
Sbjct  87   VISFLFSLV----KESMNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKD  142

Query  424  DGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            DGTLVS++GFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  143  DGTLVSYIGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  187



>gb|KJB51357.1| hypothetical protein B456_008G213200 [Gossypium raimondii]
 gb|KJB51359.1| hypothetical protein B456_008G213200 [Gossypium raimondii]
Length=298

 Score =   178 bits (452),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALA T+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAGTSRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009602769.1| PREDICTED: glutamate dehydrogenase A-like isoform X2 [Nicotiana 
tomentosiformis]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>ref|XP_009122339.1| PREDICTED: glutamate dehydrogenase 2 [Brassica rapa]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVSF+GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011084766.1| PREDICTED: glutamate dehydrogenase A-like [Sesamum indicum]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF +AARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFMKAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ACH97123.2| GDH2 [Camellia sinensis]
Length=411

 Score =   181 bits (460),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR+AARILGLDS+IEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRRAARILGLDSRIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KDO57712.1| hypothetical protein CISIN_1g012750mg [Citrus sinensis]
Length=408

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLDSK+E+SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  47   MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  106

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  107  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  135



>ref|XP_009771898.1| PREDICTED: glutamate dehydrogenase A-like [Nicotiana sylvestris]
 ref|XP_009771899.1| PREDICTED: glutamate dehydrogenase A-like [Nicotiana sylvestris]
Length=411

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>dbj|BAH56738.1| AT5G07440 [Arabidopsis thaliana]
Length=370

 Score =   180 bits (457),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_002321781.1| hypothetical protein POPTR_0015s12250g [Populus trichocarpa]
 gb|EEF05908.1| hypothetical protein POPTR_0015s12250g [Populus trichocarpa]
Length=411

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTL S++GFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKVEKSLLIPFREIKVECTIPKDDGTLASYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010546127.1| PREDICTED: LOW QUALITY PROTEIN: glutamate dehydrogenase 2-like 
[Tarenaya hassleriana]
Length=406

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLDSKIE+SLLIPFREIKVECTIPKDDGT VS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRHAARILGLDSKIERSLLIPFREIKVECTIPKDDGTXVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KDP22494.1| hypothetical protein JCGZ_26325 [Jatropha curcas]
Length=411

 Score =   181 bits (459),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+E+SLLIPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRNAARILGLDSKVERSLLIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011040330.1| PREDICTED: glutamate dehydrogenase 2 [Populus euphratica]
Length=411

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTL S++GFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKVEKSLLIPFREIKVECTIPKDDGTLASYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDX81051.1| BnaC03g03050D [Brassica napus]
Length=403

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDX78292.1| BnaA03g02040D [Brassica napus]
Length=403

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008375213.1| PREDICTED: glutamate dehydrogenase 2 [Malus domestica]
Length=411

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+ AARILGLD+KIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFKNAARILGLDAKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009758042.1| PREDICTED: glutamate dehydrogenase A [Nicotiana sylvestris]
Length=411

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>sp|O04937.1|DHEA_NICPL RecName: Full=Glutamate dehydrogenase A; Short=GDH A [Nicotiana 
plumbaginifolia]
 emb|CAA69600.1| NADH glutamate dehydrogenase [Nicotiana plumbaginifolia]
 emb|CAB94836.1| NADH glutamate dehydrogenase [Nicotiana plumbaginifolia]
Length=411

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>ref|XP_004300329.1| PREDICTED: glutamate dehydrogenase 2-like [Fragaria vesca subsp. 
vesca]
Length=411

 Score =   181 bits (458),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLD K+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDEKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006437037.1| hypothetical protein CICLE_v10031681mg [Citrus clementina]
 ref|XP_006485031.1| PREDICTED: glutamate dehydrogenase 2-like [Citrus sinensis]
 gb|ESR50277.1| hypothetical protein CICLE_v10031681mg [Citrus clementina]
Length=411

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR AARILGLDSK+E+SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFRNAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009362726.1| PREDICTED: glutamate dehydrogenase 2 [Pyrus x bretschneideri]
Length=411

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+ AARILGLD+KIEKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFKNAARILGLDAKIEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KDP39958.1| hypothetical protein JCGZ_03489 [Jatropha curcas]
Length=411

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDG+LVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFRNAARILGLDSKLEKSLLIPFREIKVECTIPKDDGSLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009628256.1| PREDICTED: glutamate dehydrogenase A [Nicotiana tomentosiformis]
Length=411

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/89 (96%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>ref|XP_009130990.1| PREDICTED: glutamate dehydrogenase 2-like [Brassica rapa]
Length=411

 Score =   181 bits (458),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIEKSL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIEKSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008786199.1| PREDICTED: glutamate dehydrogenase 2 [Phoenix dactylifera]
 ref|XP_008786200.1| PREDICTED: glutamate dehydrogenase 2 [Phoenix dactylifera]
Length=411

 Score =   180 bits (457),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQA+R+LGLDSK+EKSLLIPFREIKVECTIP+DDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFRQASRLLGLDSKLEKSLLIPFREIKVECTIPRDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KDP39703.1| hypothetical protein JCGZ_02723 [Jatropha curcas]
Length=411

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB51356.1| hypothetical protein B456_008G213200 [Gossypium raimondii]
Length=330

 Score =   178 bits (451),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALA T+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAGTSRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KFK25129.1| hypothetical protein AALP_AA8G069800 [Arabis alpina]
Length=411

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_196361.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 ref|NP_001119183.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 ref|XP_002871272.1| hypothetical protein ARALYDRAFT_487575 [Arabidopsis lyrata subsp. 
lyrata]
 sp|Q38946.1|DHE2_ARATH RecName: Full=Glutamate dehydrogenase 2; Short=GDH 2 [Arabidopsis 
thaliana]
 gb|AAB01222.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 emb|CAB87933.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 gb|EFH47531.1| hypothetical protein ARALYDRAFT_487575 [Arabidopsis lyrata subsp. 
lyrata]
 gb|AED91157.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
 gb|AED91158.1| glutamate dehydrogenase 2 [Arabidopsis thaliana]
Length=411

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009389265.1| PREDICTED: glutamate dehydrogenase 2 [Musa acuminata subsp. malaccensis]
Length=411

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAARILGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_006399227.1| hypothetical protein EUTSA_v10013680mg [Eutrema salsugineum]
 gb|ESQ40680.1| hypothetical protein EUTSA_v10013680mg [Eutrema salsugineum]
Length=411

 Score =   180 bits (457),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSKIE+SL+IPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKIERSLMIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KHN01626.1| Glutamate dehydrogenase 2 [Glycine soja]
Length=412

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006647612.1| PREDICTED: glutamate dehydrogenase 2-like [Oryza brachyantha]
Length=411

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSKIEKSLLIP REIKVECTIPKDDGTL +FVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKIEKSLLIPLREIKVECTIPKDDGTLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDP+EVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPNEVNALAQLMTW  89



>ref|XP_007155713.1| hypothetical protein PHAVU_003G225100g [Phaseolus vulgaris]
 gb|ESW27707.1| hypothetical protein PHAVU_003G225100g [Phaseolus vulgaris]
Length=412

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006365338.1| PREDICTED: glutamate dehydrogenase A-like [Solanum tuberosum]
Length=411

 Score =   180 bits (456),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSK+E+SLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKLERSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>gb|KDO57711.1| hypothetical protein CISIN_1g012750mg [Citrus sinensis]
Length=457

 Score =   181 bits (459),  Expect = 6e-51, Method: Compositional matrix adjust.
 Identities = 91/120 (76%), Positives = 100/120 (83%), Gaps = 7/120 (6%)
 Frame = +1

Query  202  IVLFPWRLGLF*SAVFVF-PFSLIFLGDLPAMNALAATTRNFRQAARILGLDSKIEKSLL  378
            I+LF   +  F S +  F  F +I       MNALAAT+RNFR AARILGLDSK+E+SLL
Sbjct  22   ILLFKSPISGFSSLLTCFESFRII------VMNALAATSRNFRNAARILGLDSKLERSLL  75

Query  379  IPFREIKVECTIPKDDGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            IPFREIKVECTIPKDDG+LVS+VGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  76   IPFREIKVECTIPKDDGSLVSYVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  135



>gb|KDO55040.1| hypothetical protein CISIN_1g036924mg, partial [Citrus sinensis]
Length=295

 Score =   177 bits (448),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010062756.1| PREDICTED: glutamate dehydrogenase 2 [Eucalyptus grandis]
 gb|KCW90899.1| hypothetical protein EUGRSUZ_A02935 [Eucalyptus grandis]
Length=411

 Score =   180 bits (456),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+E+SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKLERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|AFW59042.1| hypothetical protein ZEAMMB73_138901, partial [Zea mays]
Length=198

 Score =   174 bits (440),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAATTRNFR+A+++LGLDSK+E+SLLIPFREIKVECTIPKDDG+L +FVGFRVQHDN
Sbjct  1    MNALAATTRNFRRASKLLGLDSKLEQSLLIPFREIKVECTIPKDDGSLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHNEVDPDEVNALAQLMTW  89



>ref|XP_006652598.1| PREDICTED: glutamate dehydrogenase 2-like [Oryza brachyantha]
Length=411

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDLDEVNALAQLMTW  89



>ref|NP_001236417.1| glutamate dehydrogenase 2 [Glycine max]
 emb|CAI53674.1| glutamate dehydrogenase 2 [Glycine max]
Length=412

 Score =   179 bits (455),  Expect = 9e-51, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++AARILGLDSK+EKSLLIPFRE+KVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFQRAARILGLDSKLEKSLLIPFREVKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008364857.1| PREDICTED: glutamate dehydrogenase 2 [Malus domestica]
Length=411

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+ AARILGLD+KIE+SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFKNAARILGLDAKIERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008453843.1| PREDICTED: glutamate dehydrogenase 2 [Cucumis melo]
Length=411

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALQATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004146893.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus]
 ref|XP_004171221.1| PREDICTED: glutamate dehydrogenase 2-like [Cucumis sativus]
 gb|KGN53184.1| hypothetical protein Csa_4G025140 [Cucumis sativus]
Length=411

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+EKSLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALQATNRNFRHAARILGLDSKLEKSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009363739.1| PREDICTED: glutamate dehydrogenase 2-like [Pyrus x bretschneideri]
Length=411

 Score =   179 bits (455),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+ AARILGLD+KIE+SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFKNAARILGLDAKIERSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_003524183.1| PREDICTED: glutamate dehydrogenase 2-like [Glycine max]
 gb|KHN28476.1| Glutamate dehydrogenase 2 [Glycine soja]
Length=412

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++AARILGLDSK+EKSLLIPFRE+KVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFQRAARILGLDSKLEKSLLIPFREVKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KEH31619.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=411

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++A+RILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFQRASRILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_002871806.1| hypothetical protein ARALYDRAFT_488683 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48065.1| hypothetical protein ARALYDRAFT_488683 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   179 bits (454),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010276380.1| PREDICTED: glutamate dehydrogenase 1 [Nelumbo nucifera]
 ref|XP_010276381.1| PREDICTED: glutamate dehydrogenase 1 [Nelumbo nucifera]
 ref|XP_010276382.1| PREDICTED: glutamate dehydrogenase 1 [Nelumbo nucifera]
 ref|XP_010276383.1| PREDICTED: glutamate dehydrogenase 1 [Nelumbo nucifera]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008441982.1| PREDICTED: glutamate dehydrogenase 1 [Cucumis melo]
 ref|XP_008441983.1| PREDICTED: glutamate dehydrogenase 1 [Cucumis melo]
 ref|XP_008441984.1| PREDICTED: glutamate dehydrogenase 1 [Cucumis melo]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001047589.1| Os02g0650900 [Oryza sativa Japonica Group]
 dbj|BAD26562.1| putative ADH glutamate dehydrogenase [Oryza sativa Japonica Group]
 dbj|BAE48297.1| glutamate dehydrogenase 3 [Oryza sativa Japonica Group]
 dbj|BAF09503.1| Os02g0650900 [Oryza sativa Japonica Group]
 gb|EAZ24022.1| hypothetical protein OsJ_07745 [Oryza sativa Japonica Group]
 dbj|BAG95846.1| unnamed protein product [Oryza sativa Japonica Group]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK++KSLLIP REIKVECTIPKDDGTL +FVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLQKSLLIPLREIKVECTIPKDDGTLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_002511037.1| glutamate dehydrogenase, putative [Ricinus communis]
 gb|EEF51639.1| glutamate dehydrogenase, putative [Ricinus communis]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+E+SL+IPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKVERSLMIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIR+HPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRFHPEVDPDEVNALAQLMTW  89



>ref|XP_004147535.1| PREDICTED: glutamate dehydrogenase 1-like [Cucumis sativus]
 ref|XP_004157012.1| PREDICTED: glutamate dehydrogenase 1-like [Cucumis sativus]
 gb|KGN53939.1| hypothetical protein Csa_4G192110 [Cucumis sativus]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009353148.1| PREDICTED: glutamate dehydrogenase 1 isoform X2 [Pyrus x bretschneideri]
Length=304

 Score =   176 bits (446),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB26487.1| hypothetical protein B456_004G244400 [Gossypium raimondii]
Length=296

 Score =   176 bits (445),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008376356.1| PREDICTED: glutamate dehydrogenase 2-like [Malus domestica]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+ AARILGLD+KIE SLLIPFREIKVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATSRNFKNAARILGLDAKIETSLLIPFREIKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_002446878.1| hypothetical protein SORBIDRAFT_06g024150 [Sorghum bicolor]
 gb|EES11206.1| hypothetical protein SORBIDRAFT_06g024150 [Sorghum bicolor]
Length=411

 Score =   179 bits (453),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 88/89 (99%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR+A+++LGLDSK+E+SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRRASKLLGLDSKLEQSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EAY86911.1| hypothetical protein OsI_08294 [Oryza sativa Indica Group]
Length=410

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAAR+LGLDSK++KSLLIP REIKVECTIPKDDGTL +FVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAARLLGLDSKLQKSLLIPLREIKVECTIPKDDGTLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_197318.1| glutamate dehydrogenase 1 [Arabidopsis thaliana]
 sp|Q43314.1|DHE1_ARATH RecName: Full=Glutamate dehydrogenase 1; Short=GDH 1 [Arabidopsis 
thaliana]
 gb|AAA82615.1| glutamate dehydrogenase 1 [Arabidopsis thaliana]
 gb|AAB08057.1| glutamate dehydrogenase 1 [Arabidopsis thaliana]
 dbj|BAB09475.1| glutamate dehydrogenase (EC 1.4.1.-) 1 [Arabidopsis thaliana]
 gb|ABF58979.1| At5g18170 [Arabidopsis thaliana]
 gb|AED92515.1| glutamate dehydrogenase 1 [Arabidopsis thaliana]
Length=411

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ABR45723.1| GDH1 [Actinidia chinensis]
Length=411

 Score =   178 bits (452),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KHG11683.1| Glutamate dehydrogenase 2 -like protein [Gossypium arboreum]
Length=411

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALA T+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAGTSRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB51355.1| hypothetical protein B456_008G213200 [Gossypium raimondii]
Length=411

 Score =   178 bits (452),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALA T+RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAGTSRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006357314.1| PREDICTED: glutamate dehydrogenase A-like [Solanum tuberosum]
Length=411

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR+A+RILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRKASRILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDHDEVNALAQLMTW  89



>ref|XP_010110567.1| Glutamate dehydrogenase 2 [Morus notabilis]
 gb|EXC26785.1| Glutamate dehydrogenase 2 [Morus notabilis]
Length=411

 Score =   178 bits (451),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF  A+RILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFLHASRILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006838512.1| hypothetical protein AMTR_s00002p00181950 [Amborella trichopoda]
 gb|ERN01081.1| hypothetical protein AMTR_s00002p00181950 [Amborella trichopoda]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT+RNFR AARILGLDSK+E+SLLIPFRE+KVECTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALVATSRNFRYAARILGLDSKLERSLLIPFREVKVECTIPKDDGSLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001268039.1| glutamate dehydrogenase [Vitis vinifera]
 sp|P52596.1|DHE3_VITVI RecName: Full=Glutamate dehydrogenase; Short=GDH [Vitis vinifera]
 emb|CAA60507.1| glutamate dehydrogenase [Vitis vinifera]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSK+EKSLLIPFREIKVECTIPKDDG+L ++VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKLEKSLLIPFREIKVECTIPKDDGSLATYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011075044.1| PREDICTED: glutamate dehydrogenase B [Sesamum indicum]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010662019.1| PREDICTED: glutamate dehydrogenase isoform X1 [Vitis vinifera]
 emb|CAC18730.1| NADH glutamate dehydrogenase [Vitis vinifera]
 emb|CAN69242.1| hypothetical protein VITISV_042232 [Vitis vinifera]
 emb|CBI26589.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSK+EKSLLIPFREIKVECTIPKDDG+L ++VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKLEKSLLIPFREIKVECTIPKDDGSLATYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004976416.1| PREDICTED: glutamate dehydrogenase 2-like [Setaria italica]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFR+AAR+LGLDSK+EKSLLIPFREIKVECTIP DDG+L SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRRAARLLGLDSKLEKSLLIPFREIKVECTIPMDDGSLSSFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006826287.1| hypothetical protein AMTR_s00004p00059320 [Amborella trichopoda]
 gb|ERM93524.1| hypothetical protein AMTR_s00004p00059320 [Amborella trichopoda]
Length=411

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010908645.1| PREDICTED: glutamate dehydrogenase isoform X2 [Elaeis guineensis]
Length=411

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_011034367.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034368.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034369.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034370.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034371.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034372.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034373.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034374.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034375.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
 ref|XP_011034376.1| PREDICTED: glutamate dehydrogenase 1 [Populus euphratica]
Length=411

 Score =   177 bits (450),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSL+IPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLIIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009599776.1| PREDICTED: glutamate dehydrogenase B-like [Nicotiana tomentosiformis]
 ref|XP_009599777.1| PREDICTED: glutamate dehydrogenase B-like [Nicotiana tomentosiformis]
Length=411

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004240769.1| PREDICTED: glutamate dehydrogenase A-like isoform X1 [Solanum 
lycopersicum]
Length=411

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR+A+RILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRKASRILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPE+D DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEIDHDEVNALAQLMTW  89



>ref|XP_007038224.1| Glutamate dehydrogenase 2 [Theobroma cacao]
 gb|EOY22725.1| Glutamate dehydrogenase 2 [Theobroma cacao]
Length=411

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EMS63997.1| Glutamate dehydrogenase [Triticum urartu]
Length=395

 Score =   177 bits (449),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010492817.1| PREDICTED: glutamate dehydrogenase 1-like [Camelina sativa]
 ref|XP_010492818.1| PREDICTED: glutamate dehydrogenase 1-like [Camelina sativa]
Length=411

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006287858.1| hypothetical protein CARUB_v10001084mg [Capsella rubella]
 gb|EOA20756.1| hypothetical protein CARUB_v10001084mg [Capsella rubella]
Length=411

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010940072.1| PREDICTED: glutamate dehydrogenase isoform X3 [Elaeis guineensis]
Length=417

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQAA++LGLDSK+EKSLLIPFREIKVECTIP+DDGT+ SFVGFRVQHDN
Sbjct  1    MNALAATSRNFRQAAKLLGLDSKLEKSLLIPFREIKVECTIPRDDGTMASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_009800300.1| PREDICTED: glutamate dehydrogenase B-like [Nicotiana sylvestris]
 ref|XP_009800301.1| PREDICTED: glutamate dehydrogenase B-like [Nicotiana sylvestris]
Length=411

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006362255.1| PREDICTED: glutamate dehydrogenase-like [Solanum tuberosum]
Length=411

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEQSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010420561.1| PREDICTED: glutamate dehydrogenase 1 [Camelina sativa]
Length=411

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CAD12373.1| glutamate dehydrogenase [Nicotiana tabacum]
Length=411

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001105301.1| glutamate dehydrogenase [Zea mays]
 sp|Q43260.1|DHE3_MAIZE RecName: Full=Glutamate dehydrogenase; Short=GDH [Zea mays]
 dbj|BAA08445.1| glutamate dehydrogenase [Zea mays]
Length=411

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010908644.1| PREDICTED: glutamate dehydrogenase isoform X1 [Elaeis guineensis]
Length=441

 Score =   178 bits (451),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010454041.1| PREDICTED: glutamate dehydrogenase 1-like [Camelina sativa]
Length=411

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008812048.1| PREDICTED: glutamate dehydrogenase isoform X1 [Phoenix dactylifera]
 ref|XP_008812049.1| PREDICTED: glutamate dehydrogenase isoform X1 [Phoenix dactylifera]
 ref|XP_008812050.1| PREDICTED: glutamate dehydrogenase isoform X1 [Phoenix dactylifera]
Length=411

 Score =   177 bits (449),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGT+ SFVGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTMASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010933559.1| PREDICTED: glutamate dehydrogenase 2 [Elaeis guineensis]
 ref|XP_010933560.1| PREDICTED: glutamate dehydrogenase 2 [Elaeis guineensis]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQA+R+L LDSK+EKSLLIPFREIKVECTIP+DDGT+ S+VGFRVQHDN
Sbjct  1    MNALAATSRNFRQASRLLALDSKLEKSLLIPFREIKVECTIPRDDGTMASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ACL53188.1| unknown [Zea mays]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_004981456.1| PREDICTED: glutamate dehydrogenase-like isoform X1 [Setaria italica]
 ref|XP_004981457.1| PREDICTED: glutamate dehydrogenase-like isoform X2 [Setaria italica]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|NP_001241710.1| glutamate dehydrogenase [Zea mays]
 ref|XP_008648531.1| PREDICTED: glutamate dehydrogenase isoform X1 [Zea mays]
 ref|XP_008648535.1| PREDICTED: glutamate dehydrogenase isoform X1 [Zea mays]
 ref|XP_008648541.1| PREDICTED: glutamate dehydrogenase isoform X1 [Zea mays]
 gb|ACF78788.1| unknown [Zea mays]
 gb|ACF80043.1| unknown [Zea mays]
 gb|ACF84331.1| unknown [Zea mays]
 gb|ACF85332.1| unknown [Zea mays]
 gb|ACG34153.1| glutamate dehydrogenase [Zea mays]
 gb|ACN26660.1| unknown [Zea mays]
 gb|ACN28907.1| unknown [Zea mays]
 gb|ACN34584.1| unknown [Zea mays]
 tpg|DAA51868.1| TPA: glutamic dehydrogenase1 isoform 1 [Zea mays]
 tpg|DAA51869.1| TPA: glutamic dehydrogenase1 isoform 2 [Zea mays]
 tpg|DAA51870.1| TPA: glutamic dehydrogenase1 isoform 3 [Zea mays]
 tpg|DAA51871.1| TPA: glutamic dehydrogenase1 isoform 4 [Zea mays]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_004508961.1| PREDICTED: glutamate dehydrogenase A-like [Cicer arietinum]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT  NF++AARILGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNCNFQRAARILGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB26489.1| hypothetical protein B456_004G244400 [Gossypium raimondii]
Length=353

 Score =   176 bits (445),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001051540.1| Os03g0794500 [Oryza sativa Japonica Group]
 gb|AAO37984.1| glutamate dehydrogenase [Oryza sativa Japonica Group]
 gb|AAQ01156.1| glutamate dehydrogenase [Oryza sativa]
 dbj|BAE48296.1| glutamate dehydrogenase 1 [Oryza sativa Japonica Group]
 gb|ABF99322.1| Glutamate dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99323.1| Glutamate dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 gb|ABF99324.1| Glutamate dehydrogenase, putative, expressed [Oryza sativa Japonica 
Group]
 dbj|BAF13454.1| Os03g0794500 [Oryza sativa Japonica Group]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_009375072.1| PREDICTED: glutamate dehydrogenase 1-like [Pyrus x bretschneideri]
Length=152

 Score =   170 bits (430),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AA +LGLDSK+EKSLL PFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKFAAWLLGLDSKLEKSLLTPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006650717.1| PREDICTED: glutamate dehydrogenase-like [Oryza brachyantha]
Length=411

 Score =   177 bits (449),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>emb|CDP14320.1| unnamed protein product [Coffea canephora]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALVATNRNFRLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ADW95819.1| glutamate dehydrogenase [Triticum aestivum]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>dbj|BAK00921.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_002319162.1| Glutamate dehydrogenase 1 family protein [Populus trichocarpa]
 gb|EEE95085.1| Glutamate dehydrogenase 1 family protein [Populus trichocarpa]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_007030721.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030722.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030723.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 ref|XP_007030724.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY11223.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY11224.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY11225.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
 gb|EOY11226.1| Glutamate dehydrogenase 1 isoform 1 [Theobroma cacao]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ADT91914.1| glutamate dehydrogenase [Secale cereale x Triticum turgidum subsp. 
durum]
Length=411

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_002525427.1| glutamate dehydrogenase, putative [Ricinus communis]
 gb|EEF36917.1| glutamate dehydrogenase, putative [Ricinus communis]
Length=411

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|ADK13053.1| glutamate dehydrogenase [Pinus pinaster]
Length=411

 Score =   177 bits (448),  Expect = 9e-50, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++AAR+L LDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKRAARLLALDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_003557556.1| PREDICTED: glutamate dehydrogenase [Brachypodium distachyon]
 ref|XP_010228497.1| PREDICTED: glutamate dehydrogenase [Brachypodium distachyon]
 ref|XP_010228499.1| PREDICTED: glutamate dehydrogenase [Brachypodium distachyon]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_011021483.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
 ref|XP_011021484.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
 ref|XP_011021485.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
 ref|XP_011021486.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
 ref|XP_011021487.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
 ref|XP_011021490.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Populus 
euphratica]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF++AA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKRAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010054553.1| PREDICTED: glutamate dehydrogenase 1 [Eucalyptus grandis]
 ref|XP_010054561.1| PREDICTED: glutamate dehydrogenase 1 [Eucalyptus grandis]
 gb|KCW89864.1| hypothetical protein EUGRSUZ_A02097 [Eucalyptus grandis]
 gb|KCW89865.1| hypothetical protein EUGRSUZ_A02097 [Eucalyptus grandis]
 gb|KCW89866.1| hypothetical protein EUGRSUZ_A02097 [Eucalyptus grandis]
 gb|KCW89867.1| hypothetical protein EUGRSUZ_A02097 [Eucalyptus grandis]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLERSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010257677.1| PREDICTED: glutamate dehydrogenase 1-like [Nelumbo nucifera]
 ref|XP_010257678.1| PREDICTED: glutamate dehydrogenase 1-like [Nelumbo nucifera]
 ref|XP_010257679.1| PREDICTED: glutamate dehydrogenase 1-like [Nelumbo nucifera]
 ref|XP_010257680.1| PREDICTED: glutamate dehydrogenase 1-like [Nelumbo nucifera]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EK LLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKCLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010653726.1| PREDICTED: GDHB glutamate dehydrogenase isoform X1 [Vitis vinifera]
 ref|XP_010653727.1| PREDICTED: GDHB glutamate dehydrogenase isoform X1 [Vitis vinifera]
 ref|XP_010653728.1| PREDICTED: GDHB glutamate dehydrogenase isoform X1 [Vitis vinifera]
 ref|XP_010653729.1| PREDICTED: GDHB glutamate dehydrogenase isoform X1 [Vitis vinifera]
 ref|XP_010653730.1| PREDICTED: GDHB glutamate dehydrogenase isoform X1 [Vitis vinifera]
 emb|CBI29942.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EMT03028.1| Glutamate dehydrogenase [Aegilops tauschii]
Length=430

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  36   MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  95

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  96   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  124



>ref|XP_003517396.1| PREDICTED: glutamate dehydrogenase 2-like [Glycine max]
 gb|KHN42653.1| Glutamate dehydrogenase 2 [Glycine soja]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR+AA ILGLD+K+E SLLIPFREIKVECTIPKDDGTLVS+VGFR+QHDN
Sbjct  1    MNALAATNRNFRRAAHILGLDTKLENSLLIPFREIKVECTIPKDDGTLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006300064.1| hypothetical protein CARUB_v10016292mg [Capsella rubella]
 gb|EOA32962.1| hypothetical protein CARUB_v10016292mg [Capsella rubella]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>emb|CAA09478.1| glutamate dehydrogenase [Asparagus officinalis]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLD K+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDPKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHSEVDPDEVNALAQLMTW  89



>ref|XP_009619953.1| PREDICTED: glutamate dehydrogenase A-like [Nicotiana tomentosiformis]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 84/89 (94%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EV+ DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVELDEVNALAQLMTW  89



>ref|XP_002325838.1| Glutamate dehydrogenase 1 family protein [Populus trichocarpa]
 gb|EEF00220.1| Glutamate dehydrogenase 1 family protein [Populus trichocarpa]
Length=411

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF++AA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKRAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006440169.1| hypothetical protein CICLE_v10020390mg [Citrus clementina]
 gb|ESR53409.1| hypothetical protein CICLE_v10020390mg [Citrus clementina]
Length=410

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALAATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009389003.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009389004.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009389005.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009389006.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009389007.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
Length=411

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_006400363.1| hypothetical protein EUTSA_v10013679mg [Eutrema salsugineum]
 gb|ESQ41816.1| hypothetical protein EUTSA_v10013679mg [Eutrema salsugineum]
Length=350

 Score =   175 bits (443),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_010088046.1| Glutamate dehydrogenase 1 [Morus notabilis]
 gb|EXB31265.1| Glutamate dehydrogenase 1 [Morus notabilis]
Length=411

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECT+PKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTVPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB19599.1| hypothetical protein B456_003G110800 [Gossypium raimondii]
Length=322

 Score =   174 bits (441),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL ++VGFR+QHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_006443421.1| hypothetical protein CICLE_v10020428mg [Citrus clementina]
 ref|XP_006443422.1| hypothetical protein CICLE_v10020428mg [Citrus clementina]
 ref|XP_006479108.1| PREDICTED: glutamate dehydrogenase 1-like [Citrus sinensis]
 gb|ESR56661.1| hypothetical protein CICLE_v10020428mg [Citrus clementina]
 gb|ESR56662.1| hypothetical protein CICLE_v10020428mg [Citrus clementina]
Length=411

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB26488.1| hypothetical protein B456_004G244400 [Gossypium raimondii]
Length=369

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|EAY92161.1| hypothetical protein OsI_13874 [Oryza sativa Indica Group]
 gb|EAZ28893.1| hypothetical protein OsJ_12933 [Oryza sativa Japonica Group]
Length=443

 Score =   177 bits (449),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010524979.1| PREDICTED: glutamate dehydrogenase 1 [Tarenaya hassleriana]
Length=411

 Score =   176 bits (447),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLERSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KHG30124.1| putative glutamate dehydrogenase 3 -like protein [Gossypium arboreum]
Length=372

 Score =   175 bits (444),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010485756.1| PREDICTED: probable glutamate dehydrogenase 3 [Camelina sativa]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_009399337.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009399338.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009399339.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009399340.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
 ref|XP_009399341.1| PREDICTED: glutamate dehydrogenase [Musa acuminata subsp. malaccensis]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>gb|KDO57040.1| hypothetical protein CISIN_1g014463mg [Citrus sinensis]
Length=359

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALTATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009121005.1| PREDICTED: glutamate dehydrogenase 1 [Brassica rapa]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGT+ SFVGFRVQHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTIASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_011021482.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Populus 
euphratica]
Length=450

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF++AA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  40   MNALVATNRNFKRAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  99

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  100  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  128



>emb|CDY38492.1| BnaA10g16660D [Brassica napus]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGT+ SFVGFRVQHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTIASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>gb|EEE61431.1| hypothetical protein OsJ_15647 [Oryza sativa Japonica Group]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNFRQA R+LGL+SK+EKSLLIPF EIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATSRNFRQAPRLLGLESKLEKSLLIPFPEIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|AAB51595.1| glutamate dehydrogenase mutant [Zea mays]
Length=411

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA+++GLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLVGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_006477083.1| PREDICTED: glutamate dehydrogenase 2-like isoform X4 [Citrus 
sinensis]
Length=373

 Score =   175 bits (444),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALTATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_011021480.1| PREDICTED: glutamate dehydrogenase 1-like isoform X1 [Populus 
euphratica]
 ref|XP_011021481.1| PREDICTED: glutamate dehydrogenase 1-like isoform X1 [Populus 
euphratica]
Length=451

 Score =   177 bits (449),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF++AA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  41   MNALVATNRNFKRAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  100

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  101  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  129



>gb|ABK25386.1| unknown [Picea sitchensis]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF++AAR+L LDSK+E+SLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKRAARLLALDSKLERSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB19600.1| hypothetical protein B456_003G110800 [Gossypium raimondii]
Length=353

 Score =   175 bits (443),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL ++VGFR+QHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_002882318.1| hypothetical protein ARALYDRAFT_896411 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH58577.1| hypothetical protein ARALYDRAFT_896411 [Arabidopsis lyrata subsp. 
lyrata]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_010463859.1| PREDICTED: probable glutamate dehydrogenase 3 [Camelina sativa]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>emb|CDY25453.1| BnaC09g39680D [Brassica napus]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_009766751.1| PREDICTED: glutamate dehydrogenase A-like [Nicotiana sylvestris]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVS++GFRVQHDN
Sbjct  1    MNALAATNRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EV+ DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVELDEVNALAQLMTW  89



>gb|AAB51596.1| glutamate dehydrogenase [Zea mays]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA+++GLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLVGLDSKLEKSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDPDEVNALAQLMTW  89



>ref|XP_010515838.1| PREDICTED: probable glutamate dehydrogenase 3 [Camelina sativa]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|NP_001233850.1| glutamate dehydrogenase [Solanum lycopersicum]
 sp|P93541.1|DHE3_SOLLC RecName: Full=Glutamate dehydrogenase; Short=GDH; AltName: Full=Legdh1 
[Solanum lycopersicum]
 gb|AAB39508.1| glutamate dehydrogenase [Solanum lycopersicum]
Length=412

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLELSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_187041.1| glutamate dehydrogenase 3 [Arabidopsis thaliana]
 sp|Q9S7A0.1|DHE3_ARATH RecName: Full=Probable glutamate dehydrogenase 3; Short=GDH 3 
[Arabidopsis thaliana]
 gb|AAF00627.1|AC009540_4 putative glutamate dehydrogenase [Arabidopsis thaliana]
 gb|AAF05851.1|AC011698_2 putative glutamate dehydrogenase [Arabidopsis thaliana]
 gb|AEE74011.1| glutamate dehydrogenase 3 [Arabidopsis thaliana]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_008391682.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Malus domestica]
 ref|XP_008391683.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Malus domestica]
 ref|XP_008391684.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Malus domestica]
 ref|XP_008391685.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Malus domestica]
 ref|XP_008391686.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Malus domestica]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KCW89863.1| hypothetical protein EUGRSUZ_A02097 [Eucalyptus grandis]
Length=443

 Score =   177 bits (448),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  33   MNALAATNRNFKLAARLLGLDSKLERSLLIPFREIKVECTIPKDDGTLASYVGFRVQHDN  92

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  93   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  121



>ref|NP_001236404.1| glutamate dehydrogenase 1 [Glycine max]
 ref|XP_006598765.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Glycine max]
 ref|XP_006598766.1| PREDICTED: glutamate dehydrogenase 1 isoform X2 [Glycine max]
 ref|XP_006598767.1| PREDICTED: glutamate dehydrogenase 1 isoform X3 [Glycine max]
 emb|CAI53673.1| glutamate dehydrogenase 1 [Glycine max]
 gb|KHN46779.1| Glutamate dehydrogenase 1 [Glycine soja]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010327684.1| PREDICTED: glutamate dehydrogenase isoform X1 [Solanum lycopersicum]
 ref|XP_010327685.1| PREDICTED: glutamate dehydrogenase isoform X1 [Solanum lycopersicum]
 ref|XP_010327686.1| PREDICTED: glutamate dehydrogenase isoform X1 [Solanum lycopersicum]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 82/89 (92%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLELSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004493157.1| PREDICTED: glutamate dehydrogenase 1-like isoform X1 [Cicer arietinum]
 ref|XP_004493158.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Cicer arietinum]
 ref|XP_004493159.1| PREDICTED: glutamate dehydrogenase 1-like isoform X3 [Cicer arietinum]
Length=411

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006408244.1| hypothetical protein EUTSA_v10020857mg [Eutrema salsugineum]
 gb|ESQ49697.1| hypothetical protein EUTSA_v10020857mg [Eutrema salsugineum]
Length=403

 Score =   176 bits (445),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_008391681.1| PREDICTED: glutamate dehydrogenase 1-like isoform X1 [Malus domestica]
Length=424

 Score =   176 bits (446),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  14   MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  73

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  74   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  102



>ref|XP_008386820.1| PREDICTED: glutamate dehydrogenase 1 [Malus domestica]
Length=411

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009353137.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353138.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353139.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353140.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353141.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353142.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353143.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353144.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353145.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
 ref|XP_009353147.1| PREDICTED: glutamate dehydrogenase 1 isoform X1 [Pyrus x bretschneideri]
Length=411

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB26490.1| hypothetical protein B456_004G244400 [Gossypium raimondii]
Length=411

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004288417.1| PREDICTED: glutamate dehydrogenase 1 [Fragaria vesca subsp. vesca]
 ref|XP_011467558.1| PREDICTED: glutamate dehydrogenase 1 [Fragaria vesca subsp. vesca]
 ref|XP_011467559.1| PREDICTED: glutamate dehydrogenase 1 [Fragaria vesca subsp. vesca]
Length=412

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AARILGLDSK+EKSLLIPFREIKVECTIPKDDG+L S+VGFR+QHDN
Sbjct  1    MNALAATNRNFKLAARILGLDSKLEKSLLIPFREIKVECTIPKDDGSLASYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_009366446.1| PREDICTED: glutamate dehydrogenase 1 [Pyrus x bretschneideri]
 ref|XP_009366447.1| PREDICTED: glutamate dehydrogenase 1 [Pyrus x bretschneideri]
 ref|XP_009366448.1| PREDICTED: glutamate dehydrogenase 1 [Pyrus x bretschneideri]
Length=411

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KHN34707.1| Glutamate dehydrogenase 1 [Glycine soja]
Length=411

 Score =   176 bits (445),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009102088.1| PREDICTED: probable glutamate dehydrogenase 3 [Brassica rapa]
 emb|CDY21157.1| BnaA01g33880D [Brassica napus]
Length=411

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|NP_001239645.1| uncharacterized protein LOC100789509 [Glycine max]
 ref|XP_006603712.1| PREDICTED: uncharacterized protein LOC100789509 isoform X1 [Glycine 
max]
 ref|XP_006603713.1| PREDICTED: uncharacterized protein LOC100789509 isoform X2 [Glycine 
max]
 gb|ACU20042.1| unknown [Glycine max]
Length=411

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KEH23528.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=411

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S++GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KEH25602.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=303

 Score =   172 bits (437),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSKIEKSLLIPFREIKVEC+IPKDDGTL ++VGFR+QHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKIEKSLLIPFREIKVECSIPKDDGTLATYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>emb|CDY29969.1| BnaC01g40390D [Brassica napus]
Length=411

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_003611390.1| Glutamate dehydrogenase [Medicago truncatula]
 gb|AES94348.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=411

 Score =   175 bits (444),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF++A+RILGLDSK+EKSLLIP+REIKVECTIPKDDG+LVS+VGFR+QHDN
Sbjct  1    MNALVATNRNFQRASRILGLDSKLEKSLLIPYREIKVECTIPKDDGSLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_007161939.1| hypothetical protein PHAVU_001G110500g [Phaseolus vulgaris]
 ref|XP_007161940.1| hypothetical protein PHAVU_001G110500g [Phaseolus vulgaris]
 gb|ESW33933.1| hypothetical protein PHAVU_001G110500g [Phaseolus vulgaris]
 gb|ESW33934.1| hypothetical protein PHAVU_001G110500g [Phaseolus vulgaris]
Length=411

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S+VGFR+QHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_007151845.1| hypothetical protein PHAVU_004G080200g [Phaseolus vulgaris]
 gb|ESW23839.1| hypothetical protein PHAVU_004G080200g [Phaseolus vulgaris]
Length=411

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFR+QHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_006477082.1| PREDICTED: glutamate dehydrogenase 2-like isoform X3 [Citrus 
sinensis]
Length=396

 Score =   175 bits (443),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALTATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_010940064.1| PREDICTED: glutamate dehydrogenase isoform X2 [Elaeis guineensis]
Length=535

 Score =   177 bits (450),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 2/106 (2%)
 Frame = +1

Query  247  FVFPFSLIFLGDLP--AMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPK  420
            + +P  L F G      MNALAAT+RNFRQAA++LGLDSK+EKSLLIPFREIKVECTIP+
Sbjct  108  YRWPCLLWFCGTSSRDTMNALAATSRNFRQAAKLLGLDSKLEKSLLIPFREIKVECTIPR  167

Query  421  DDGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            DDGT+ SFVGFRVQHDNARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  168  DDGTMASFVGFRVQHDNARGPMKGGIRYHHEVDPDEVNALAQLMTW  213



>ref|XP_009353387.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Pyrus x 
bretschneideri]
 ref|XP_009353388.1| PREDICTED: glutamate dehydrogenase 1-like isoform X2 [Pyrus x 
bretschneideri]
Length=152

 Score =   168 bits (425),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKV+CTIPK+DG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKFAARLLGLDSKLEKSLLIPFREIKVKCTIPKNDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHP VDPD+VNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPGVDPDKVNALAQLMTW  89



>ref|XP_003518237.1| PREDICTED: glutamate dehydrogenase 1-like [Glycine max]
Length=411

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L +FVGFRVQHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_010940056.1| PREDICTED: glutamate dehydrogenase isoform X1 [Elaeis guineensis]
Length=541

 Score =   177 bits (450),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 85/106 (80%), Positives = 93/106 (88%), Gaps = 2/106 (2%)
 Frame = +1

Query  247  FVFPFSLIFLGDLP--AMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPK  420
            + +P  L F G      MNALAAT+RNFRQAA++LGLDSK+EKSLLIPFREIKVECTIP+
Sbjct  108  YRWPCLLWFCGTSSRDTMNALAATSRNFRQAAKLLGLDSKLEKSLLIPFREIKVECTIPR  167

Query  421  DDGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            DDGT+ SFVGFRVQHDNARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  168  DDGTMASFVGFRVQHDNARGPMKGGIRYHHEVDPDEVNALAQLMTW  213



>emb|CDY64896.1| BnaC05g47630D [Brassica napus]
Length=457

 Score =   176 bits (446),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/106 (79%), Positives = 92/106 (87%), Gaps = 6/106 (6%)
 Frame = +1

Query  259  FSLIFLG------DLPAMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPK  420
            FS+ FL       +   MNALAAT RNF+ A+R+LGLDSK+E+SLLIPFREIKVECTIPK
Sbjct  30   FSVAFLSKSNKPKNKNTMNALAATNRNFKLASRLLGLDSKLEQSLLIPFREIKVECTIPK  89

Query  421  DDGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            DDGTL SFVGFRVQHDNARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  90   DDGTLASFVGFRVQHDNARGPMKGGIRYHPEVEPDEVNALAQLMTW  135



>ref|XP_006477081.1| PREDICTED: glutamate dehydrogenase 2-like isoform X2 [Citrus 
sinensis]
 gb|KDO57039.1| hypothetical protein CISIN_1g014463mg [Citrus sinensis]
Length=410

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALTATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KFK37827.1| hypothetical protein AALP_AA3G034400 [Arabis alpina]
Length=411

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLERSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_002278888.1| PREDICTED: glutamate dehydrogenase [Vitis vinifera]
 emb|CBI26583.3| unnamed protein product [Vitis vinifera]
Length=411

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+RILGLDSK+EKSLLI FREIKVECTIPKDDG+L ++VGFRVQHDN
Sbjct  1    MNALAATNRNFRHASRILGLDSKLEKSLLISFREIKVECTIPKDDGSLATYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_006477080.1| PREDICTED: glutamate dehydrogenase 2-like isoform X1 [Citrus 
sinensis]
 gb|KDO57038.1| hypothetical protein CISIN_1g014463mg [Citrus sinensis]
Length=424

 Score =   175 bits (443),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNFR AARILGLDSK+E+SLLIPFREIKVEC+IPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALTATNRNFRYAARILGLDSKLERSLLIPFREIKVECSIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KFK26056.1| hypothetical protein AALP_AA8G197400 [Arabis alpina]
Length=411

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL +FVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_006400364.1| hypothetical protein EUTSA_v10013679mg [Eutrema salsugineum]
 gb|ESQ41817.1| hypothetical protein EUTSA_v10013679mg [Eutrema salsugineum]
Length=411

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLASKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_008794889.1| PREDICTED: glutamate dehydrogenase 2-like [Phoenix dactylifera]
Length=411

 Score =   174 bits (442),  Expect = 7e-49, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFRQA+R+LG+DSK+EKSL+IPFRE+KVECTIP+DDG+L SFVGFRVQHDN
Sbjct  1    MNALAATCRNFRQASRLLGIDSKLEKSLVIPFREVKVECTIPRDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDP EVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPSEVNALAQLMTW  89



>gb|KJB19598.1| hypothetical protein B456_003G110800 [Gossypium raimondii]
Length=411

 Score =   174 bits (442),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL ++VGFR+QHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLATYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_010672048.1| PREDICTED: glutamate dehydrogenase B [Beta vulgaris subsp. vulgaris]
 ref|XP_010672049.1| PREDICTED: glutamate dehydrogenase B [Beta vulgaris subsp. vulgaris]
 ref|XP_010672050.1| PREDICTED: glutamate dehydrogenase B [Beta vulgaris subsp. vulgaris]
 ref|XP_010672051.1| PREDICTED: glutamate dehydrogenase B [Beta vulgaris subsp. vulgaris]
Length=411

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 78/89 (88%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF++A+++LGLD+K+E+SLLIPFREIKVECTIPKDDGTL SF+GFRVQHDN
Sbjct  1    MNALAATNRNFKRASQLLGLDAKLERSLLIPFREIKVECTIPKDDGTLASFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_003548062.1| PREDICTED: glutamate dehydrogenase 1-like [Glycine max]
Length=411

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDG+L +FVGFR+QHDN
Sbjct  1    MNALAATNRNFRLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGSLATFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>gb|EYU39994.1| hypothetical protein MIMGU_mgv1a007324mg [Erythranthe guttata]
Length=411

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDG+L SFVGFR+QHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEQSLLIPFREIKVECTIPKDDGSLASFVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>ref|XP_007202170.1| hypothetical protein PRUPE_ppa006457mg [Prunus persica]
 gb|EMJ03369.1| hypothetical protein PRUPE_ppa006457mg [Prunus persica]
 gb|AHM02306.1| glutamate dehydrogenase [Prunus persica]
Length=411

 Score =   174 bits (441),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLERSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008240473.1| PREDICTED: glutamate dehydrogenase 1 [Prunus mume]
 ref|XP_008240474.1| PREDICTED: glutamate dehydrogenase 1 [Prunus mume]
 ref|XP_008240476.1| PREDICTED: glutamate dehydrogenase 1 [Prunus mume]
 ref|XP_008240477.1| PREDICTED: glutamate dehydrogenase 1 [Prunus mume]
Length=411

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+E+SLLIPFREIKVECTIPKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLERSLLIPFREIKVECTIPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008805384.1| PREDICTED: glutamate dehydrogenase-like [Phoenix dactylifera]
 ref|XP_008805385.1| PREDICTED: glutamate dehydrogenase-like [Phoenix dactylifera]
 ref|XP_008805386.1| PREDICTED: glutamate dehydrogenase-like [Phoenix dactylifera]
Length=411

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT+RNF+QAA++LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATSRNFKQAAKLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVD DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHHEVDLDEVNALAQLMTW  89



>gb|EPS68533.1| hypothetical protein M569_06232 [Genlisea aurea]
Length=414

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A R+LGLDSK+E+SLLIPFREIKVECTIP+DDG+L SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLATRLLGLDSKLERSLLIPFREIKVECTIPRDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KEH23527.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=492

 Score =   175 bits (444),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 91/149 (61%), Positives = 105/149 (70%), Gaps = 9/149 (6%)
 Frame = +1

Query  112  LTYFTIFASLFLHIYITLLVCNS*ITVACCIVLFPWRLGLF*SAVFVFPFSLIFLGDLPA  291
            L++   F SL  H ++ L        +A       W   L  +  F+     + L     
Sbjct  31   LSWDRDFHSLVSHCFVKL-------GLAFPSTFLNWTRCL--ATHFIQKLVKVLLVGKGK  81

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL S++GFRVQHDN
Sbjct  82   MNALAATNRNFKLASRLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLQSYIGFRVQHDN  141

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  142  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  170



>gb|KJB51764.1| hypothetical protein B456_008G231000 [Gossypium raimondii]
Length=366

 Score =   172 bits (437),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AARILGLDSK+ KSLLIPFREIKVECT+P+DDG+ VS++GFR+QHDN
Sbjct  1    MNALAATNRNFQLAARILGLDSKLHKSLLIPFREIKVECTVPRDDGSFVSYIGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|NP_001132187.1| hypothetical protein [Zea mays]
 gb|ACF80935.1| unknown [Zea mays]
 gb|AFW59041.1| hypothetical protein ZEAMMB73_138901 [Zea mays]
Length=411

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 87/89 (98%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAATTRNFR+A+++LGLDSK+E+SLLIPFREIKVECTIPKDDG+L +FVGFRVQHDN
Sbjct  1    MNALAATTRNFRRASKLLGLDSKLEQSLLIPFREIKVECTIPKDDGSLATFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHNEVDPDEVNALAQLMTW  89



>gb|KGN50342.1| hypothetical protein Csa_5G168800 [Cucumis sativus]
Length=409

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/89 (93%), Positives = 85/89 (96%), Gaps = 2/89 (2%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNFR AARILGLDSKIEKSLLIPFREIK  CTIPKDDG+LVS+VGFRVQHDN
Sbjct  1    MNALAATNRNFRHAARILGLDSKIEKSLLIPFREIK--CTIPKDDGSLVSYVGFRVQHDN  58

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  59   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  87



>ref|XP_004511739.1| PREDICTED: glutamate dehydrogenase 2-like [Cicer arietinum]
Length=411

 Score =   174 bits (440),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 79/89 (89%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF +A+RILGLDSK+E SLLIPFREIKVECTIPKDDG+LVS+VGFR+QHDN
Sbjct  1    MNALVATNRNFLRASRILGLDSKLENSLLIPFREIKVECTIPKDDGSLVSYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008389767.1| PREDICTED: glutamate dehydrogenase 1-like isoform X1 [Malus domestica]
Length=119

 Score =   165 bits (417),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPK +G+L S VGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKXBGSLASXVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGP+K GIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPVKXGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_008355842.1| PREDICTED: glutamate dehydrogenase 1-like [Malus domestica]
Length=175

 Score =   166 bits (421),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ A R+LGLD K+EKSLLIPFREIKVECT+PKDDG+L SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKFATRLLGLDFKLEKSLLIPFREIKVECTMPKDDGSLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHP VDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPGVDPDEVNALAQLMTW  89



>ref|XP_008384444.1| PREDICTED: glutamate dehydrogenase 1-like [Malus domestica]
Length=119

 Score =   164 bits (416),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 76/89 (85%), Positives = 82/89 (92%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPK +G+L S VGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKXBGSLASXVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGP+K GIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPVKXGIRYHPEVDPDEVNALAQLMTW  89



>gb|KHG16642.1| Glutamate dehydrogenase 2 -like protein [Gossypium arboreum]
Length=411

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AARILGLDSK+ KSLLIPFREIKVECT+P+DDG+ VS++GFR+QHDN
Sbjct  1    MNALAATNRNFQLAARILGLDSKLHKSLLIPFREIKVECTVPRDDGSFVSYIGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>gb|KJB51762.1| hypothetical protein B456_008G231000 [Gossypium raimondii]
Length=411

 Score =   172 bits (437),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AARILGLDSK+ KSLLIPFREIKVECT+P+DDG+ VS++GFR+QHDN
Sbjct  1    MNALAATNRNFQLAARILGLDSKLHKSLLIPFREIKVECTVPRDDGSFVSYIGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_003618972.1| Glutamate dehydrogenase [Medicago truncatula]
 gb|AES75190.1| NADP-specific glutamate dehydrogenase [Medicago truncatula]
Length=411

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSKIEKSLLIPFREIKVEC+IPKDDGTL ++VGFR+QHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKIEKSLLIPFREIKVECSIPKDDGTLATYVGFRIQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPEVEPDEVNALAQLMTW  89



>gb|AAL36888.3|AF403178_1 NADH-glutamate dehydrogenase [Solanum lycopersicum]
Length=411

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+E SLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLELSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYH EVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHREVDPDEVNALAQLMTW  89



>gb|KJB45110.1| hypothetical protein B456_007G289700 [Gossypium raimondii]
Length=411

 Score =   172 bits (435),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+ DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEHDEVNALAQLMTW  89



>gb|KHG11816.1| Glutamate dehydrogenase 1 -like protein [Gossypium arboreum]
Length=411

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 84/89 (94%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNAL AT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHDN
Sbjct  1    MNALVATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEV+ DEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVEHDEVNALAQLMTW  89



>ref|XP_009765753.1| PREDICTED: glutamate dehydrogenase B [Nicotiana sylvestris]
 ref|XP_009765754.1| PREDICTED: glutamate dehydrogenase B [Nicotiana sylvestris]
 ref|XP_009765755.1| PREDICTED: glutamate dehydrogenase B [Nicotiana sylvestris]
 ref|XP_009765756.1| PREDICTED: glutamate dehydrogenase B [Nicotiana sylvestris]
Length=411

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+ LLIPFREIKVECTIPKDDG+L +F+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEQCLLIPFREIKVECTIPKDDGSLATFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_009621291.1| PREDICTED: glutamate dehydrogenase B [Nicotiana tomentosiformis]
 ref|XP_009621293.1| PREDICTED: glutamate dehydrogenase B [Nicotiana tomentosiformis]
 ref|XP_009621294.1| PREDICTED: glutamate dehydrogenase B [Nicotiana tomentosiformis]
Length=411

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+ LLIPFREIKVECTIPKDDG+L +F+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEQCLLIPFREIKVECTIPKDDGSLATFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>sp|Q9LEC8.1|DHEB_NICPL RecName: Full=Glutamate dehydrogenase B; Short=GDH B [Nicotiana 
plumbaginifolia]
 emb|CAB94837.1| NADH-glutamate dehydrogenase [Nicotiana plumbaginifolia]
Length=411

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+ LLIPFREIKVECTIPKDDG+L +F+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEQCLLIPFREIKVECTIPKDDGSLATFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>ref|XP_004489708.1| PREDICTED: probable glutamate dehydrogenase 3-like [Cicer arietinum]
Length=411

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 86/89 (97%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSKIEKSLLIPFREIKVEC+IPKDDGTL ++VGFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKIEKSLLIPFREIKVECSIPKDDGTLATYVGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            +RGPMKGGIRYHP+V+PDEVNALAQLMTW
Sbjct  61   SRGPMKGGIRYHPQVEPDEVNALAQLMTW  89



>emb|CAA69601.2| NADH glutamate dehydrogenase [Nicotiana plumbaginifolia]
Length=411

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 77/89 (87%), Positives = 85/89 (96%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ A+R+LGLDSK+E+ LLIPFREIKVECTIPKDDG+L +F+GFRVQHDN
Sbjct  1    MNALAATNRNFKLASRLLGLDSKLEQCLLIPFREIKVECTIPKDDGSLATFIGFRVQHDN  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            ARGPMKGGIRYHPEVDPDEVNALAQLMTW
Sbjct  61   ARGPMKGGIRYHPEVDPDEVNALAQLMTW  89



>emb|CDY50862.1| BnaA05g37230D [Brassica napus]
Length=652

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/106 (78%), Positives = 92/106 (87%), Gaps = 4/106 (4%)
 Frame = +1

Query  253  FPFSLIFLGDLP----AMNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPK  420
            FP + +   + P     MNALAAT RNF+ A+R+LGLDSK+E+SLLIPFREIKVECTIPK
Sbjct  30   FPVAFLSKSNKPKIKNTMNALAATNRNFKLASRLLGLDSKLEQSLLIPFREIKVECTIPK  89

Query  421  DDGTLVSFVGFRVQHDNARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
            DDGTL SFVGFRVQHDNARGPMKGGIRYHPEV+PDEVNALAQLMTW
Sbjct  90   DDGTLASFVGFRVQHDNARGPMKGGIRYHPEVEPDEVNALAQLMTW  135



>gb|ABF57084.1| GDHB glutamate dehydrogenase [Vitis vinifera]
 gb|ABF57085.1| GDHB glutamate dehydrogenase [Vitis vinifera]
Length=411

 Score =   171 bits (433),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHD 
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDQ  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
             RGPMKGGIRY PEVDPDEVNALAQLMTW
Sbjct  61   WRGPMKGGIRYQPEVDPDEVNALAQLMTW  89



>ref|NP_001267906.1| GDHB glutamate dehydrogenase [Vitis vinifera]
 gb|AEO72335.1| glutamate dehydrogenase 1 [Vitis vinifera]
Length=411

 Score =   171 bits (432),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 80/89 (90%), Positives = 83/89 (93%), Gaps = 0/89 (0%)
 Frame = +1

Query  292  MNALAATTRNFRQAARILGLDSKIEKSLLIPFREIKVECTIPKDDGTLVSFVGFRVQHDN  471
            MNALAAT RNF+ AAR+LGLDSK+EKSLLIPFREIKVECTIPKDDGTL SFVGFRVQHD 
Sbjct  1    MNALAATNRNFKLAARLLGLDSKLEKSLLIPFREIKVECTIPKDDGTLASFVGFRVQHDQ  60

Query  472  ARGPMKGGIRYHPEVDPDEVNALAQLMTW  558
             RGPMKGGIRY PEVDPDEVNALAQLMTW
Sbjct  61   WRGPMKGGIRYQPEVDPDEVNALAQLMTW  89



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 631248065840