BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A21

Length=601
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_006339420.1|  PREDICTED: uncharacterized protein LOC102603324    261   2e-80   Solanum tuberosum [potatoes]
ref|XP_009614536.1|  PREDICTED: uncharacterized protein LOC104107438    255   3e-80   Nicotiana tomentosiformis
ref|XP_009775161.1|  PREDICTED: uncharacterized protein LOC104225093    258   5e-79   Nicotiana sylvestris
gb|KHN03032.1|  Hypothetical protein glysoja_009898                     258   8e-79   Glycine soja [wild soybean]
ref|XP_006600321.1|  PREDICTED: uncharacterized protein LOC100807...    258   9e-79   Glycine max [soybeans]
ref|XP_006600322.1|  PREDICTED: uncharacterized protein LOC100807...    258   1e-78   Glycine max [soybeans]
gb|KHN03427.1|  Hypothetical protein glysoja_004453                     258   1e-78   Glycine soja [wild soybean]
ref|XP_006584055.1|  PREDICTED: uncharacterized protein LOC100798...    258   1e-78   
ref|XP_006584056.1|  PREDICTED: uncharacterized protein LOC100798...    258   1e-78   Glycine max [soybeans]
ref|XP_004229458.1|  PREDICTED: uncharacterized protein LOC101262...    257   1e-78   Solanum lycopersicum
ref|XP_003529600.1|  PREDICTED: uncharacterized protein LOC100798...    258   1e-78   
ref|XP_007222369.1|  hypothetical protein PRUPE_ppa003420mg             257   2e-78   
ref|XP_008223032.1|  PREDICTED: uncharacterized protein LOC103322864    257   2e-78   Prunus mume [ume]
ref|XP_010322788.1|  PREDICTED: uncharacterized protein LOC101262...    256   2e-78   Solanum lycopersicum
ref|XP_004508352.1|  PREDICTED: uncharacterized protein LOC101492...    256   3e-78   Cicer arietinum [garbanzo]
ref|XP_004508353.1|  PREDICTED: uncharacterized protein LOC101492...    256   6e-78   Cicer arietinum [garbanzo]
gb|KJB72266.1|  hypothetical protein B456_011G168000                    255   7e-78   Gossypium raimondii
gb|KJB72268.1|  hypothetical protein B456_011G168000                    253   8e-78   Gossypium raimondii
ref|XP_007154170.1|  hypothetical protein PHAVU_003G096200g             255   1e-77   Phaseolus vulgaris [French bean]
ref|XP_007154171.1|  hypothetical protein PHAVU_003G096200g             255   1e-77   Phaseolus vulgaris [French bean]
ref|XP_009365782.1|  PREDICTED: uncharacterized protein LOC103955607    254   1e-77   Pyrus x bretschneideri [bai li]
gb|KDP40084.1|  hypothetical protein JCGZ_02082                         254   1e-77   Jatropha curcas
ref|XP_007034567.1|  Alpha/beta-Hydrolases superfamily protein          254   2e-77   
emb|CBI26166.3|  unnamed protein product                                254   2e-77   Vitis vinifera
ref|XP_010649852.1|  PREDICTED: uncharacterized protein LOC100257995    254   2e-77   Vitis vinifera
ref|XP_008340898.1|  PREDICTED: uncharacterized protein LOC103403829    254   3e-77   
ref|XP_004296971.1|  PREDICTED: uncharacterized protein LOC101299950    254   3e-77   Fragaria vesca subsp. vesca
ref|XP_011090819.1|  PREDICTED: uncharacterized protein LOC105171...    253   4e-77   Sesamum indicum [beniseed]
ref|XP_011090820.1|  PREDICTED: uncharacterized protein LOC105171...    253   4e-77   Sesamum indicum [beniseed]
ref|XP_011090816.1|  PREDICTED: uncharacterized protein LOC105171...    254   5e-77   Sesamum indicum [beniseed]
ref|XP_011090818.1|  PREDICTED: uncharacterized protein LOC105171...    254   5e-77   Sesamum indicum [beniseed]
ref|XP_011090817.1|  PREDICTED: uncharacterized protein LOC105171...    254   5e-77   Sesamum indicum [beniseed]
ref|XP_011071522.1|  PREDICTED: uncharacterized protein LOC105156947    253   6e-77   
ref|XP_002516800.1|  catalytic, putative                                256   7e-77   
gb|KDO74880.1|  hypothetical protein CISIN_1g007812mg                   253   8e-77   Citrus sinensis [apfelsine]
gb|KDO74878.1|  hypothetical protein CISIN_1g007812mg                   253   9e-77   Citrus sinensis [apfelsine]
ref|XP_006489238.1|  PREDICTED: uncharacterized protein LOC102610023    252   1e-76   Citrus sinensis [apfelsine]
ref|XP_008390806.1|  PREDICTED: uncharacterized protein LOC103453051    252   1e-76   
gb|KDO74879.1|  hypothetical protein CISIN_1g007812mg                   252   1e-76   Citrus sinensis [apfelsine]
ref|XP_010105703.1|  hypothetical protein L484_011315                   251   1e-76   
ref|XP_010512570.1|  PREDICTED: uncharacterized protein LOC104788495    251   2e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010466700.1|  PREDICTED: uncharacterized protein LOC104746856    251   3e-76   Camelina sativa [gold-of-pleasure]
ref|XP_010532691.1|  PREDICTED: uncharacterized protein LOC104808...    249   5e-76   Tarenaya hassleriana [spider flower]
ref|XP_010532690.1|  PREDICTED: uncharacterized protein LOC104808...    249   6e-76   Tarenaya hassleriana [spider flower]
ref|XP_009339931.1|  PREDICTED: uncharacterized protein LOC103932104    250   7e-76   Pyrus x bretschneideri [bai li]
ref|XP_010488424.1|  PREDICTED: uncharacterized protein LOC104766...    249   8e-76   Camelina sativa [gold-of-pleasure]
ref|XP_006299834.1|  hypothetical protein CARUB_v10016036mg             249   8e-76   Capsella rubella
ref|XP_004145038.1|  PREDICTED: uncharacterized protein LOC101215845    250   8e-76   
ref|XP_004154381.1|  PREDICTED: uncharacterized protein LOC101218432    250   8e-76   
ref|XP_008458538.1|  PREDICTED: uncharacterized protein LOC103497...    250   9e-76   
ref|XP_006419777.1|  hypothetical protein CICLE_v10004606mg             249   1e-75   Citrus clementina [clementine]
ref|XP_008458537.1|  PREDICTED: uncharacterized protein LOC103497...    249   1e-75   Cucumis melo [Oriental melon]
emb|CDX77500.1|  BnaA07g06380D                                          248   2e-75   
ref|XP_006283451.1|  hypothetical protein CARUB_v10004497mg             248   2e-75   Capsella rubella
ref|XP_006283452.1|  hypothetical protein CARUB_v10004497mg             248   2e-75   Capsella rubella
ref|XP_009102606.1|  PREDICTED: uncharacterized protein LOC103828728    248   2e-75   Brassica rapa
emb|CDX85110.1|  BnaC07g07960D                                          248   2e-75   
ref|XP_006597567.1|  PREDICTED: uncharacterized protein LOC100781...    248   2e-75   Glycine max [soybeans]
ref|XP_006597568.1|  PREDICTED: uncharacterized protein LOC100781...    248   3e-75   Glycine max [soybeans]
gb|KEH32227.1|  alpha/beta-hydrolase superfamily protein                249   3e-75   Medicago truncatula
ref|XP_007147794.1|  hypothetical protein PHAVU_006G155700g             248   3e-75   Phaseolus vulgaris [French bean]
ref|XP_007147795.1|  hypothetical protein PHAVU_006G155700g             248   3e-75   Phaseolus vulgaris [French bean]
ref|XP_010450069.1|  PREDICTED: uncharacterized protein LOC104732228    247   5e-75   Camelina sativa [gold-of-pleasure]
ref|NP_188996.2|  alpha/beta-Hydrolases superfamily protein             247   6e-75   Arabidopsis thaliana [mouse-ear cress]
gb|KHN37552.1|  Hypothetical protein glysoja_007255                     248   6e-75   Glycine soja [wild soybean]
ref|XP_006406019.1|  hypothetical protein EUTSA_v10020399mg             246   9e-75   Eutrema salsugineum [saltwater cress]
gb|ACJ85572.1|  unknown                                                 244   1e-74   Medicago truncatula
ref|XP_006414745.1|  hypothetical protein EUTSA_v10024836mg             246   1e-74   Eutrema salsugineum [saltwater cress]
ref|XP_010669834.1|  PREDICTED: uncharacterized protein LOC104886965    246   1e-74   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002315536.2|  hypothetical protein POPTR_0010s03020g             245   3e-74   
ref|XP_002883434.1|  hypothetical protein ARALYDRAFT_898866             245   4e-74   Arabidopsis lyrata subsp. lyrata
ref|XP_010440497.1|  PREDICTED: uncharacterized protein LOC104723788    244   5e-74   Camelina sativa [gold-of-pleasure]
ref|XP_011014506.1|  PREDICTED: uncharacterized protein LOC105118291    244   1e-73   Populus euphratica
ref|XP_009107962.1|  PREDICTED: uncharacterized protein LOC103833638    243   1e-73   Brassica rapa
emb|CDY09027.1|  BnaC01g30640D                                          243   1e-73   Brassica napus [oilseed rape]
ref|NP_193165.7|  alpha/beta-hydrolase family protein                   243   2e-73   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010435157.1|  PREDICTED: uncharacterized protein LOC104719...    243   2e-73   Camelina sativa [gold-of-pleasure]
ref|XP_010435158.1|  PREDICTED: uncharacterized protein LOC104719...    243   2e-73   Camelina sativa [gold-of-pleasure]
gb|AES64344.2|  alpha/beta hydrolase family protein                     242   2e-73   Medicago truncatula
ref|XP_002868296.1|  predicted protein                                  241   1e-72   Arabidopsis lyrata subsp. lyrata
emb|CDY12752.1|  BnaC04g28890D                                          239   1e-72   Brassica napus [oilseed rape]
emb|CDY49406.1|  BnaCnng17160D                                          239   2e-72   Brassica napus [oilseed rape]
ref|XP_009139528.1|  PREDICTED: uncharacterized protein LOC103863...    240   2e-72   Brassica rapa
ref|XP_009139529.1|  PREDICTED: uncharacterized protein LOC103863...    240   2e-72   Brassica rapa
ref|XP_010035879.1|  PREDICTED: uncharacterized protein LOC104425...    241   3e-72   Eucalyptus grandis [rose gum]
ref|XP_010035885.1|  PREDICTED: uncharacterized protein LOC104425...    241   3e-72   Eucalyptus grandis [rose gum]
ref|XP_004486108.1|  PREDICTED: HBS1-like protein-like                  246   3e-72   
gb|EPS65169.1|  hypothetical protein M569_09610                         236   3e-72   Genlisea aurea
ref|XP_009139530.1|  PREDICTED: uncharacterized protein LOC103863...    239   4e-72   Brassica rapa
ref|XP_009109570.1|  PREDICTED: uncharacterized protein LOC103835198    237   2e-71   Brassica rapa
ref|XP_011009029.1|  PREDICTED: uncharacterized protein LOC105114...    237   5e-71   Populus euphratica
ref|XP_011009032.1|  PREDICTED: uncharacterized protein LOC105114...    237   5e-71   Populus euphratica
emb|CDY12069.1|  BnaC03g59850D                                          236   7e-71   Brassica napus [oilseed rape]
ref|XP_010942429.1|  PREDICTED: uncharacterized protein LOC105060...    234   3e-70   
gb|EMS48134.1|  hypothetical protein TRIUR3_10822                       228   9e-70   Triticum urartu
gb|EMT30875.1|  hypothetical protein F775_08510                         229   1e-69   
ref|XP_010942428.1|  PREDICTED: uncharacterized protein LOC105060...    234   1e-69   Elaeis guineensis
ref|XP_004984312.1|  PREDICTED: uncharacterized protein LOC101769...    233   2e-69   Setaria italica
ref|XP_009393893.1|  PREDICTED: uncharacterized protein LOC103979459    233   2e-69   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAJ88870.1|  predicted protein                                      229   3e-69   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_003557834.1|  PREDICTED: uncharacterized protein LOC100838212    232   6e-69   Brachypodium distachyon [annual false brome]
emb|CDX90263.1|  BnaA08g17210D                                          231   7e-69   
gb|ABF96061.1|  expressed protein                                       231   8e-69   Oryza sativa Japonica Group [Japonica rice]
gb|EAY90076.1|  hypothetical protein OsI_11646                          231   9e-69   Oryza sativa Indica Group [Indian rice]
ref|NP_001141958.1|  hypothetical protein                               231   1e-68   Zea mays [maize]
ref|XP_008668219.1|  PREDICTED: hypothetical protein isoform X1         231   1e-68   Zea mays [maize]
ref|XP_006850814.1|  hypothetical protein AMTR_s00025p00118390          229   3e-68   Amborella trichopoda
ref|XP_008797057.1|  PREDICTED: uncharacterized protein LOC103712341    230   4e-68   Phoenix dactylifera
emb|CDO98976.1|  unnamed protein product                                229   4e-68   Coffea canephora [robusta coffee]
ref|XP_006650100.1|  PREDICTED: uncharacterized protein LOC102716943    229   5e-68   Oryza brachyantha
ref|XP_010255853.1|  PREDICTED: uncharacterized protein LOC104596404    229   8e-68   Nelumbo nucifera [Indian lotus]
gb|ACF83402.1|  unknown                                                 228   2e-67   Zea mays [maize]
dbj|BAB02772.1|  unnamed protein product                                226   7e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010278880.1|  PREDICTED: uncharacterized protein LOC104612...    226   8e-67   Nelumbo nucifera [Indian lotus]
ref|XP_006595393.1|  PREDICTED: uncharacterized protein LOC100815597    224   6e-66   
emb|CAB10208.1|  hypothetical protein                                   214   9e-63   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002311822.2|  hypothetical protein POPTR_0008s20480g             212   2e-61   
ref|XP_003535011.1|  PREDICTED: uncharacterized protein LOC100787...    204   3e-59   Glycine max [soybeans]
gb|KDO78612.1|  hypothetical protein CISIN_1g011425mg                   198   5e-59   Citrus sinensis [apfelsine]
ref|XP_006597639.1|  PREDICTED: uncharacterized protein LOC100778...    199   8e-59   
ref|XP_007147555.1|  hypothetical protein PHAVU_006G134600g             203   1e-58   Phaseolus vulgaris [French bean]
ref|XP_006584122.1|  PREDICTED: alpha/beta hydrolase domain-conta...    200   1e-58   
ref|XP_003594373.1|  Abhydrolase domain-containing protein              202   3e-58   
gb|KDO78613.1|  hypothetical protein CISIN_1g011425mg                   199   4e-58   Citrus sinensis [apfelsine]
ref|XP_006449959.1|  hypothetical protein CICLE_v10015057mg             199   4e-58   
ref|XP_003550951.1|  PREDICTED: uncharacterized protein LOC100784...    201   6e-58   
gb|AES64624.2|  alpha/beta superfamily hydrolase                        201   7e-58   Medicago truncatula
ref|XP_004486396.1|  PREDICTED: uncharacterized protein LOC101505...    200   7e-58   Cicer arietinum [garbanzo]
ref|XP_001769780.1|  predicted protein                                  197   7e-58   
gb|KDO78610.1|  hypothetical protein CISIN_1g011425mg                   198   7e-58   Citrus sinensis [apfelsine]
gb|KEH32722.1|  esterase/lipase domain protein                          198   8e-58   Medicago truncatula
ref|XP_006597638.1|  PREDICTED: uncharacterized protein LOC100778...    199   1e-57   Glycine max [soybeans]
ref|XP_002968666.1|  hypothetical protein SELMODRAFT_170125             195   2e-57   
gb|KEH32721.1|  esterase/lipase domain protein                          198   2e-57   Medicago truncatula
ref|XP_010252925.1|  PREDICTED: uncharacterized protein LOC104594...    199   3e-57   Nelumbo nucifera [Indian lotus]
gb|KDO78611.1|  hypothetical protein CISIN_1g011425mg                   198   3e-57   Citrus sinensis [apfelsine]
ref|XP_006449960.1|  hypothetical protein CICLE_v10015057mg             199   4e-57   Citrus clementina [clementine]
ref|XP_006467246.1|  PREDICTED: uncharacterized protein LOC102629...    198   4e-57   Citrus sinensis [apfelsine]
ref|XP_003547304.1|  PREDICTED: uncharacterized protein LOC100778...    198   5e-57   
ref|XP_008440941.1|  PREDICTED: uncharacterized protein LOC103485...    198   5e-57   Cucumis melo [Oriental melon]
ref|XP_004134817.1|  PREDICTED: uncharacterized protein LOC101211724    198   6e-57   Cucumis sativus [cucumbers]
ref|XP_008440940.1|  PREDICTED: uncharacterized protein LOC103485...    198   6e-57   Cucumis melo [Oriental melon]
ref|XP_007154081.1|  hypothetical protein PHAVU_003G089300g             197   8e-57   Phaseolus vulgaris [French bean]
ref|XP_011090821.1|  PREDICTED: uncharacterized protein LOC105171...    199   8e-57   
gb|KEH32720.1|  esterase/lipase domain protein                          198   9e-57   Medicago truncatula
gb|KJB57898.1|  hypothetical protein B456_009G185500                    195   9e-57   Gossypium raimondii
gb|KJB57899.1|  hypothetical protein B456_009G185500                    195   1e-56   Gossypium raimondii
ref|XP_007154082.1|  hypothetical protein PHAVU_003G089300g             197   1e-56   Phaseolus vulgaris [French bean]
ref|XP_004499346.1|  PREDICTED: uncharacterized protein LOC101489...    197   1e-56   Cicer arietinum [garbanzo]
ref|XP_009411958.1|  PREDICTED: uncharacterized protein LOC103993...    197   2e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004499344.1|  PREDICTED: uncharacterized protein LOC101489...    197   2e-56   Cicer arietinum [garbanzo]
ref|XP_010233983.1|  PREDICTED: uncharacterized protein LOC100830...    196   3e-56   Brachypodium distachyon [annual false brome]
ref|XP_003571271.1|  PREDICTED: uncharacterized protein LOC100830...    196   3e-56   Brachypodium distachyon [annual false brome]
gb|KJB57903.1|  hypothetical protein B456_009G185500                    194   6e-56   Gossypium raimondii
ref|XP_007026441.1|  Alpha/beta-Hydrolases superfamily protein is...    192   7e-56   
gb|ACN85333.1|  unknown                                                 196   7e-56   Oryza meyeriana var. granulata
gb|KHN40755.1|  Hypothetical protein glysoja_015122                     195   7e-56   Glycine soja [wild soybean]
gb|KJB57901.1|  hypothetical protein B456_009G185500                    194   9e-56   Gossypium raimondii
ref|XP_010647089.1|  PREDICTED: uncharacterized protein LOC100242843    194   1e-55   
gb|KJB57895.1|  hypothetical protein B456_009G185500                    194   1e-55   Gossypium raimondii
ref|XP_010530100.1|  PREDICTED: uncharacterized protein LOC104806...    192   1e-55   
ref|XP_006380855.1|  hypothetical protein POPTR_0006s00280g             191   1e-55   
gb|KJB57896.1|  hypothetical protein B456_009G185500                    194   1e-55   Gossypium raimondii
ref|XP_010252924.1|  PREDICTED: uncharacterized protein LOC104594...    194   2e-55   Nelumbo nucifera [Indian lotus]
ref|XP_001780178.1|  predicted protein                                  190   2e-55   
ref|XP_003563634.1|  PREDICTED: uncharacterized protein LOC100831715    194   2e-55   Brachypodium distachyon [annual false brome]
gb|KJB57897.1|  hypothetical protein B456_009G185500                    194   2e-55   Gossypium raimondii
gb|AFW70735.1|  hypothetical protein ZEAMMB73_068292                    193   2e-55   
ref|XP_006656239.1|  PREDICTED: uncharacterized protein LOC102719683    194   2e-55   Oryza brachyantha
ref|XP_008644127.1|  PREDICTED: hypothetical protein isoform X2         193   3e-55   Zea mays [maize]
ref|XP_004965908.1|  PREDICTED: uncharacterized protein LOC101783766    194   4e-55   Setaria italica
ref|XP_004514787.1|  PREDICTED: uncharacterized protein LOC101501...    193   4e-55   Cicer arietinum [garbanzo]
ref|XP_004951562.1|  PREDICTED: uncharacterized protein LOC101776234    194   4e-55   Setaria italica
ref|XP_008794704.1|  PREDICTED: uncharacterized protein LOC103710654    193   4e-55   Phoenix dactylifera
ref|XP_004514786.1|  PREDICTED: uncharacterized protein LOC101501...    193   4e-55   Cicer arietinum [garbanzo]
ref|XP_010530099.1|  PREDICTED: uncharacterized protein LOC104806...    191   5e-55   Tarenaya hassleriana [spider flower]
ref|XP_006857594.1|  hypothetical protein AMTR_s00061p00094480          193   5e-55   Amborella trichopoda
ref|NP_001170041.1|  hypothetical protein                               193   7e-55   Zea mays [maize]
ref|XP_008644126.1|  PREDICTED: hypothetical protein isoform X1         193   8e-55   Zea mays [maize]
ref|XP_006380856.1|  hypothetical protein POPTR_0006s00280g             191   8e-55   
ref|XP_008782969.1|  PREDICTED: uncharacterized protein LOC103702...    192   1e-54   Phoenix dactylifera
ref|XP_010530097.1|  PREDICTED: uncharacterized protein LOC104806...    192   1e-54   Tarenaya hassleriana [spider flower]
gb|ACN85219.1|  unknown                                                 192   1e-54   Oryza punctata
gb|ACN85247.1|  unknown                                                 192   1e-54   Oryza officinalis
gb|ACN85260.1|  unknown                                                 192   1e-54   Oryza alta
ref|NP_001118998.1|  alpha/beta-Hydrolases superfamily protein          189   1e-54   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007026439.1|  Alpha/beta-Hydrolases superfamily protein is...    192   1e-54   
gb|KDP29023.1|  hypothetical protein JCGZ_16412                         192   1e-54   Jatropha curcas
ref|XP_010530091.1|  PREDICTED: uncharacterized protein LOC104806...    192   1e-54   Tarenaya hassleriana [spider flower]
ref|XP_006373549.1|  hypothetical protein POPTR_0016s00300g             191   2e-54   
gb|ACN85273.1|  unknown                                                 192   2e-54   Oryza alta
ref|XP_008782966.1|  PREDICTED: uncharacterized protein LOC103702...    192   2e-54   
ref|XP_010686591.1|  PREDICTED: uncharacterized protein LOC104900...    189   2e-54   
ref|XP_006350228.1|  PREDICTED: uncharacterized protein LOC102589...    191   2e-54   Solanum tuberosum [potatoes]
ref|XP_006350227.1|  PREDICTED: uncharacterized protein LOC102589...    191   3e-54   
ref|XP_002525239.1|  catalytic, putative                                191   3e-54   Ricinus communis
ref|XP_010942494.1|  PREDICTED: uncharacterized protein LOC105060476    191   3e-54   
ref|XP_010434713.1|  PREDICTED: uncharacterized protein LOC104718...    191   4e-54   Camelina sativa [gold-of-pleasure]
ref|NP_001058047.1|  Os06g0609700                                       191   4e-54   
ref|XP_010434714.1|  PREDICTED: uncharacterized protein LOC104718...    191   5e-54   Camelina sativa [gold-of-pleasure]
ref|XP_009802385.1|  PREDICTED: uncharacterized protein LOC104247...    190   6e-54   Nicotiana sylvestris
ref|XP_008384339.1|  PREDICTED: uncharacterized protein LOC103446...    189   6e-54   
ref|XP_010440051.1|  PREDICTED: uncharacterized protein LOC104723...    190   7e-54   
ref|XP_009620526.1|  PREDICTED: uncharacterized protein LOC104112345    190   7e-54   Nicotiana tomentosiformis
ref|NP_001172844.1|  Os02g0197900                                       181   8e-54   
ref|XP_008384338.1|  PREDICTED: uncharacterized protein LOC103446...    190   8e-54   
ref|XP_008384332.1|  PREDICTED: uncharacterized protein LOC103446...    190   8e-54   
ref|XP_010686590.1|  PREDICTED: uncharacterized protein LOC104900...    189   9e-54   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010440049.1|  PREDICTED: uncharacterized protein LOC104723...    190   9e-54   
ref|XP_007213932.1|  hypothetical protein PRUPE_ppa004766mg             190   1e-53   Prunus persica
ref|XP_010440050.1|  PREDICTED: uncharacterized protein LOC104723...    190   1e-53   
ref|XP_010440048.1|  PREDICTED: uncharacterized protein LOC104723...    190   1e-53   Camelina sativa [gold-of-pleasure]
ref|XP_007213931.1|  hypothetical protein PRUPE_ppa004766mg             189   1e-53   Prunus persica
ref|NP_193448.2|  alpha/beta-Hydrolases superfamily protein             189   1e-53   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010686588.1|  PREDICTED: uncharacterized protein LOC104900...    189   1e-53   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_011040087.1|  PREDICTED: uncharacterized protein LOC105136...    189   1e-53   Populus euphratica
ref|XP_011040086.1|  PREDICTED: uncharacterized protein LOC105136...    189   1e-53   Populus euphratica
ref|XP_011040085.1|  PREDICTED: uncharacterized protein LOC105136...    189   1e-53   Populus euphratica
ref|XP_010058007.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    189   2e-53   Eucalyptus grandis [rose gum]
ref|XP_002870121.1|  hypothetical protein ARALYDRAFT_915007             189   2e-53   Arabidopsis lyrata subsp. lyrata
ref|XP_008649080.1|  PREDICTED: uncharacterized protein LOC103629745    189   2e-53   Zea mays [maize]
ref|XP_004293431.1|  PREDICTED: uncharacterized protein LOC101309...    189   2e-53   Fragaria vesca subsp. vesca
ref|XP_011095854.1|  PREDICTED: uncharacterized protein LOC105175196    188   3e-53   Sesamum indicum [beniseed]
ref|XP_011460088.1|  PREDICTED: uncharacterized protein LOC101309...    188   3e-53   Fragaria vesca subsp. vesca
ref|XP_010319209.1|  PREDICTED: uncharacterized protein LOC101251464    188   3e-53   Solanum lycopersicum
ref|XP_010449663.1|  PREDICTED: uncharacterized protein LOC104731...    189   3e-53   Camelina sativa [gold-of-pleasure]
ref|XP_008224685.1|  PREDICTED: uncharacterized protein LOC103324410    188   3e-53   
gb|KFK32200.1|  hypothetical protein AALP_AA6G210300                    187   8e-53   Arabis alpina [alpine rockcress]
ref|XP_006414266.1|  hypothetical protein EUTSA_v10027147mg             187   1e-52   Eutrema salsugineum [saltwater cress]
ref|XP_004984313.1|  PREDICTED: uncharacterized protein LOC101769...    187   2e-52   Setaria italica
ref|XP_002885117.1|  hypothetical protein ARALYDRAFT_897893             176   3e-52   
ref|XP_009108297.1|  PREDICTED: uncharacterized protein LOC103833...    186   4e-52   Brassica rapa
gb|KHN14394.1|  Hypothetical protein glysoja_012432                     185   5e-52   Glycine soja [wild soybean]
gb|EYU27617.1|  hypothetical protein MIMGU_mgv1a005188mg                181   1e-50   Erythranthe guttata [common monkey flower]
ref|XP_009374809.1|  PREDICTED: uncharacterized protein LOC103963697    181   2e-50   Pyrus x bretschneideri [bai li]
ref|XP_010911200.1|  PREDICTED: uncharacterized protein LOC105037208    172   3e-50   
gb|EEC72683.1|  hypothetical protein OsI_06247                          175   4e-48   Oryza sativa Indica Group [Indian rice]
gb|EYU45603.1|  hypothetical protein MIMGU_mgv1a0037051mg               174   2e-47   Erythranthe guttata [common monkey flower]
ref|XP_010530096.1|  PREDICTED: uncharacterized protein LOC104806...    172   2e-47   Tarenaya hassleriana [spider flower]
ref|XP_009802386.1|  PREDICTED: uncharacterized protein LOC104247...    168   1e-45   Nicotiana sylvestris
ref|XP_002438665.1|  hypothetical protein SORBIDRAFT_10g023905          165   2e-44   
emb|CDP04561.1|  unnamed protein product                                161   4e-43   Coffea canephora [robusta coffee]
dbj|BAK06433.1|  predicted protein                                      157   9e-42   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006586806.1|  PREDICTED: uncharacterized protein LOC100787...    152   7e-40   
emb|CAN66506.1|  hypothetical protein VITISV_035499                     150   6e-39   Vitis vinifera
ref|XP_010096514.1|  hypothetical protein L484_017966                   150   2e-38   
ref|XP_011090822.1|  PREDICTED: uncharacterized protein LOC105171...    148   4e-38   Sesamum indicum [beniseed]
ref|XP_006597635.1|  PREDICTED: uncharacterized protein LOC100778...    147   7e-38   Glycine max [soybeans]
gb|KHN40219.1|  Hypothetical protein glysoja_038414                     146   9e-38   Glycine soja [wild soybean]
ref|XP_002451724.1|  hypothetical protein SORBIDRAFT_04g006660          146   1e-37   
gb|KHG17313.1|  putative yqkD                                           146   1e-37   Gossypium arboreum [tree cotton]
ref|XP_006283654.1|  hypothetical protein CARUB_v10004712mg             145   2e-37   Capsella rubella
gb|EAZ22104.1|  hypothetical protein OsJ_05763                          145   3e-37   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010434715.1|  PREDICTED: uncharacterized protein LOC104718...    145   4e-37   Camelina sativa [gold-of-pleasure]
ref|XP_006648424.1|  PREDICTED: uncharacterized protein LOC102719462    144   4e-37   
ref|XP_009802387.1|  PREDICTED: uncharacterized protein LOC104247...    143   5e-37   Nicotiana sylvestris
ref|XP_009802384.1|  PREDICTED: uncharacterized protein LOC104247...    143   1e-36   Nicotiana sylvestris
ref|XP_010449665.1|  PREDICTED: uncharacterized protein LOC104731...    142   2e-36   Camelina sativa [gold-of-pleasure]
ref|XP_009108298.1|  PREDICTED: uncharacterized protein LOC103833...    142   2e-36   Brassica rapa
ref|XP_005834328.1|  hypothetical protein GUITHDRAFT_106795             139   1e-35   Guillardia theta CCMP2712
ref|XP_010686589.1|  PREDICTED: uncharacterized protein LOC104900...    138   7e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_002683321.1|  predicted protein                                  134   2e-34   Naegleria gruberi strain NEG-M
ref|XP_002465239.1|  hypothetical protein SORBIDRAFT_01g034850          135   2e-33   
ref|XP_011009031.1|  PREDICTED: uncharacterized protein LOC105114...    134   2e-33   Populus euphratica
dbj|GAM26335.1|  hypothetical protein SAMD00019534_095100               132   5e-33   Acytostelium subglobosum LB1
ref|XP_002500526.1|  predicted protein                                  130   1e-32   Micromonas commoda
emb|CDJ70048.1|  hypothetical protein, conserved                        127   1e-32   Eimeria necatrix
ref|XP_005822973.1|  hypothetical protein GUITHDRAFT_146136             131   3e-32   Guillardia theta CCMP2712
gb|KHN19820.1|  Serine hydroxymethyltransferase 1                       128   3e-32   Glycine soja [wild soybean]
ref|XP_010278885.1|  PREDICTED: uncharacterized protein LOC104612...    131   4e-32   Nelumbo nucifera [Indian lotus]
gb|KHN03563.1|  hypothetical protein glysoja_004589                     129   1e-31   Glycine soja [wild soybean]
emb|CDJ56015.1|  hypothetical protein, conserved                        129   1e-31   Eimeria maxima
gb|EFA83276.1|  alpha/beta hydrolase fold-1 domain-containing pro...    129   1e-31   Heterostelium album PN500
emb|CDY50125.1|  BnaCnng18740D                                          126   2e-30   Brassica napus [oilseed rape]
ref|XP_006467249.1|  PREDICTED: uncharacterized protein LOC102629...    125   2e-30   Citrus sinensis [apfelsine]
ref|XP_006449958.1|  hypothetical protein CICLE_v10015057mg             125   2e-30   
ref|XP_010530098.1|  PREDICTED: uncharacterized protein LOC104806...    125   4e-30   Tarenaya hassleriana [spider flower]
emb|CDY58164.1|  BnaA08g30210D                                          125   5e-30   Brassica napus [oilseed rape]
emb|CDJ41283.1|  hypothetical protein, conserved                        128   7e-30   Eimeria tenella
ref|XP_004039103.1|  hypothetical protein IMG5_033680                   122   8e-30   
ref|XP_002365812.1|  hypothetical protein TGME49_071460                 124   3e-29   
emb|CDI77547.1|  hypothetical protein EAH_00025150                      124   4e-29   
gb|KFG99519.1|  putative protein c14orf29                               124   6e-29   
gb|EPR64695.1|  putative protein c14orf29                               124   6e-29   
gb|KFG51948.1|  putative protein c14orf29                               124   6e-29   
gb|KFG61733.1|  putative protein c14orf29                               124   7e-29   
gb|EPT28520.1|  protein c14orf29, putative                              124   7e-29   
ref|XP_008882514.1|  protein c14orf29, putative                         124   8e-29   
gb|ESS36204.1|  putative protein c14orf29                               124   8e-29   
gb|KFH16547.1|  putative protein c14orf29                               124   8e-29   
ref|XP_645007.1|  alpha/beta hydrolase fold-1 domain-containing p...    121   2e-28   
ref|XP_003883797.1|  Alpha/beta hydrolase, related                      121   6e-28   
ref|XP_003285027.1|  hypothetical protein DICPUDRAFT_148856             120   7e-28   
emb|CDJ45709.1|  hypothetical protein EBH_0061260                       114   7e-28   
ref|XP_005849267.1|  hypothetical protein CHLNCDRAFT_143536             120   7e-28   
gb|EJY87631.1|  hypothetical protein OXYTRI_01425                       118   2e-27   
ref|XP_001019221.1|  hypothetical protein TTHERM_00849190               117   2e-27   
emb|CBJ29857.1|  conserved unknown protein                              118   5e-27   
ref|XP_003056359.1|  predicted protein                                  114   9e-27   
ref|XP_011395460.1|  Uncharacterized protein YqkD                       115   9e-27   
ref|XP_004336643.1|  hypothetical protein ACA1_066610                   117   1e-26   
ref|XP_005840487.1|  hypothetical protein GUITHDRAFT_161065             110   4e-26   
dbj|BAF02033.1|  hypothetical protein                                   105   1e-25   
ref|XP_009040667.1|  hypothetical protein AURANDRAFT_32346              111   1e-25   
ref|XP_009035971.1|  hypothetical protein AURANDRAFT_2040               110   1e-25   
gb|EPS70866.1|  hypothetical protein M569_03894                         105   2e-25   
ref|XP_002780525.1|  Protein C14orf29, putative                         111   2e-25   
gb|EJY74722.1|  hypothetical protein OXYTRI_04018                       112   2e-25   
gb|EPY23000.1|  hypothetical protein STCU_07959                         109   3e-25   
emb|CDW72273.1|  UNKNOWN                                                114   4e-25   
ref|XP_005829247.1|  hypothetical protein GUITHDRAFT_111828             109   4e-25   
ref|XP_002787187.1|  Protein C14orf29, putative                         109   6e-25   
ref|XP_001690455.1|  hypothetical protein CHLREDRAFT_188508             111   8e-25   
ref|XP_011131447.1|  alpha/beta hydrolase family protein                109   1e-24   
ref|XP_008914557.1|  hypothetical protein PPTG_18194                    109   2e-24   
gb|KDO23939.1|  hypothetical protein SPRG_10085                         108   2e-24   
emb|CDW72798.1|  UNKNOWN                                                108   3e-24   
gb|ETO60903.1|  hypothetical protein F444_20964                         109   3e-24   
gb|ETK72540.1|  hypothetical protein L915_20365                         109   3e-24   
gb|ETP30186.1|  hypothetical protein F442_20753                         109   3e-24   
gb|ETI32165.1|  hypothetical protein F443_20953                         109   3e-24   
emb|CCW67946.1|  unnamed protein product                                107   4e-24   
ref|WP_028832089.1|  hypothetical protein                               107   4e-24   
ref|XP_005835898.1|  hypothetical protein GUITHDRAFT_136548             108   4e-24   
ref|XP_002998858.1|  serine protease family S09X, putative              109   5e-24   
gb|KHG30285.1|  putative yqkD                                           108   6e-24   
ref|XP_002781185.1|  Protein C14orf29, putative                         105   8e-24   
gb|KIY96673.1|  hypothetical protein MNEG_11288                         106   1e-23   
gb|EFA84193.1|  hypothetical protein PPL_03268                          106   1e-23   
ref|XP_001459749.1|  hypothetical protein                               105   2e-23   
ref|XP_668367.1|  random slug cDNA-11 (Fragment)                        107   3e-23   
ref|XP_009314015.1|  hypothetical protein DQ04_08901020                 105   3e-23   
emb|CDW85425.1|  UNKNOWN                                                105   4e-23   
ref|XP_628229.1|  protein with a conserved N-terminal region            107   4e-23   
gb|EJY71252.1|  Protein C14orf29, putative                              104   5e-23   
ref|XP_010701076.1|  hypothetical protein LPMP_300410                   104   6e-23   
ref|XP_004359060.1|  alpha/beta hydrolase fold-1 domain-containin...    103   9e-23   
ref|XP_002142078.1|  hypothetical protein                               105   9e-23   
ref|XP_001566680.1|  conserved hypothetical protein                     103   1e-22   
ref|XP_008614637.1|  hypothetical protein SDRG_10426                    104   1e-22   
ref|XP_005714234.1|  unnamed protein product                            105   2e-22   
ref|XP_001428850.1|  hypothetical protein                               106   2e-22   
ref|XP_008871632.1|  hypothetical protein, variant                      102   3e-22   
emb|CCC90908.1|  unnamed protein product                                102   3e-22   
emb|CCI43474.1|  unnamed protein product                                103   3e-22   
emb|CCA19146.1|  serine protease family S09X putative                   103   3e-22   
ref|XP_001447435.1|  hypothetical protein                               102   3e-22   
gb|EKF37985.1|  hypothetical protein MOQ_001810                         102   3e-22   
gb|EWM25459.1|  serine protease family                                  103   3e-22   
gb|EKG05821.1|  hypothetical protein TCSYLVIO_003099                    102   3e-22   
emb|CAB10496.1|  hypothetical protein                                   102   4e-22   
emb|CCA24963.1|  serine protease family S09X putative                   102   4e-22   
ref|XP_009835314.1|  hypothetical protein H257_10454                    102   5e-22   
ref|XP_008871631.1|  hypothetical protein H310_07893                    102   6e-22   
ref|XP_001447920.1|  hypothetical protein                               100   8e-22   
ref|XP_845302.1|  hypothetical protein                                  100   1e-21   
emb|CBH11673.1|  hypothetical protein, conserved                        100   1e-21   
emb|CCI46060.1|  unnamed protein product                                100   2e-21   
ref|XP_008901240.1|  hypothetical protein PPTG_08082                    101   2e-21   
gb|ETP50752.1|  hypothetical protein F442_04020                         100   2e-21   
ref|XP_001445385.1|  hypothetical protein                             99.4    2e-21   
ref|XP_009041890.1|  hypothetical protein AURANDRAFT_72733              102   2e-21   
ref|XP_003877186.1|  conserved hypothetical protein                     100   3e-21   
ref|XP_005783561.1|  hypothetical protein EMIHUDRAFT_434409             101   3e-21   
gb|ETL46239.1|  hypothetical protein L916_03863                         100   3e-21   
ref|XP_001684629.1|  conserved hypothetical protein                   99.4    4e-21   
gb|EAS02968.2|  alpha/beta fold hydrolase                               100   4e-21   
ref|XP_813897.1|  hypothetical protein                                99.0    5e-21   
gb|EAR89045.2|  X-pro dipeptidyl-peptidase, S15 family protein          101   5e-21   
dbj|BAP69022.1|  RxLR effector candidate protein                        100   6e-21   
gb|EAR98281.2|  alpha/beta hydrolase family protein                     100   7e-21   
ref|XP_001009290.1|  hypothetical protein TTHERM_00846990               100   8e-21   
ref|XP_001443817.1|  hypothetical protein                             97.8    8e-21   
ref|XP_004035837.1|  hypothetical protein IMG5_086710                 97.8    9e-21   
ref|XP_001431900.1|  hypothetical protein                             97.8    1e-20   
ref|XP_002773985.1|  Abhydrolase domain-containing protein, putative  97.4    1e-20   
gb|EPY28011.1|  hypothetical protein AGDE_10595                       97.4    1e-20   
ref|XP_002291190.1|  hypothetical protein THAPSDRAFT_269163           99.8    1e-20   
ref|XP_009538086.1|  hypothetical protein PHYSODRAFT_307213           99.8    1e-20   
ref|XP_004035138.1|  hypothetical protein IMG5_105010                 97.1    2e-20   
ref|XP_005832880.1|  hypothetical protein GUITHDRAFT_138727           97.1    2e-20   
gb|EJK64219.1|  hypothetical protein THAOC_15066                      98.6    2e-20   
ref|XP_001430009.1|  hypothetical protein                             96.7    2e-20   
ref|XP_009529301.1|  hypothetical protein PHYSODRAFT_546309           97.8    4e-20   
ref|XP_002909261.1|  serine protease family S09X, putative            97.1    6e-20   
ref|XP_001466886.1|  conserved hypothetical protein                   96.7    8e-20   
ref|XP_003862754.1|  hypothetical protein, conserved                  96.7    8e-20   
ref|XP_004031116.1|  hypothetical protein IMG5_146530                 95.5    9e-20   
ref|XP_005648115.1|  alpha/beta-hydrolase                             97.4    9e-20   
gb|EJY73890.1|  hypothetical protein OXYTRI_04857                     93.2    3e-19   
ref|XP_009041300.1|  hypothetical protein AURANDRAFT_72626            96.7    3e-19   
ref|XP_002765178.1|  conserved hypothetical protein                   93.6    3e-19   
gb|EAR83757.2|  alpha/beta fold hydrolase                             93.6    2e-18   
ref|XP_001012870.1|  hypothetical protein TTHERM_00094160             93.2    5e-18   
emb|CBN74744.1|  conserved unknown protein                            92.8    5e-18   
gb|ETW18969.1|  hypothetical protein PFFVO_02176                      90.1    5e-18   
gb|EUT87307.1|  hypothetical protein PFAG_02129                       90.1    5e-18   
emb|CDW81374.1|  abhydrolase domain-containing                        89.4    6e-18   
gb|ETW49834.1|  hypothetical protein PFMALIP_02192                    90.1    6e-18   
emb|CDO64002.1|  alpha/beta-hydrolase, putative                       91.3    6e-18   
ref|XP_004026841.1|  serine protease family, putative                 90.5    7e-18   
gb|EYU45602.1|  hypothetical protein MIMGU_mgv1a0037052mg             84.0    7e-18   
ref|XP_001018256.1|  hypothetical protein TTHERM_00284010             92.4    8e-18   
gb|KDO35722.1|  hypothetical protein SPRG_18871                       90.1    1e-17   
gb|EMS51371.1|  hypothetical protein TRIUR3_15935                     90.5    1e-17   
emb|CCW67952.1|  unnamed protein product                              87.8    2e-17   
ref|XP_009040576.1|  hypothetical protein AURANDRAFT_72453            90.1    2e-17   
ref|XP_002808873.1|  conserved Plasmodium protein, unknown function   89.7    2e-17   
ref|XP_001314988.1|  hypothetical protein                             87.8    2e-17   
ref|XP_008607180.1|  hypothetical protein SDRG_03327                  88.6    4e-17   
emb|CCA24173.1|  serine protease family S09X putative                 87.4    8e-17   
ref|XP_004039812.1|  hypothetical protein IMG5_009170                 88.2    1e-16   
ref|XP_005781400.1|  hypothetical protein EMIHUDRAFT_456875           85.5    1e-16   
ref|XP_678874.1|  hypothetical protein                                86.3    1e-16   
emb|CCI48112.1|  unnamed protein product                              86.3    1e-16   
ref|XP_001016054.2|  hypothetical protein TTHERM_00877040             89.0    1e-16   
ref|XP_001436216.1|  hypothetical protein                             86.3    2e-16   
ref|XP_004221107.1|  hypothetical protein PCYB_051780                 85.9    2e-16   
ref|XP_744629.1|  hypothetical protein                                85.9    2e-16   
ref|XP_001449217.1|  hypothetical protein                             86.3    2e-16   
gb|ETB58663.1|  hypothetical protein YYC_03816                        86.7    2e-16   
ref|XP_008816465.1|  hypothetical protein C922_02644                  87.0    2e-16   
ref|XP_008875870.1|  hypothetical protein H310_11095                  85.1    4e-16   
emb|CDS45687.1|  alpha/beta hydrolase, putative                       85.9    5e-16   
ref|XP_002258089.1|  hypothetical protein in Apicomplexan species     85.5    8e-16   
emb|CDR12095.1|  alpha/beta hydrolase, putative                       85.1    9e-16   
ref|XP_008618710.1|  hypothetical protein SDRG_14364                  84.0    1e-15   
ref|XP_730594.1|  hypothetical protein                                84.3    1e-15   
ref|XP_008626199.1|  hypothetical protein YYE_04336                   84.3    1e-15   
ref|XP_004035282.1|  hypothetical protein IMG5_102050                 84.7    2e-15   
ref|XP_008914946.1|  hypothetical protein PPTG_18473                  81.3    3e-15   
ref|XP_004367489.1|  abnormal long morphology protein                 82.0    3e-15   
emb|CCC48334.1|  conserved hypothetical protein                       82.0    3e-15   
ref|XP_001315649.1|  Clan SC, family S9, unassigned serine peptidase  81.6    3e-15   
gb|EWM27930.1|  serine protease family                                83.6    4e-15   
emb|CCI45202.1|  unnamed protein product                              84.3    5e-15   
ref|XP_001614928.1|  hypothetical protein                             83.2    5e-15   
ref|XP_001315076.1|  hypothetical protein                             81.3    5e-15   
ref|XP_004024168.1|  hypothetical protein IMG5_198760                 80.1    5e-15   
ref|XP_001432920.1|  hypothetical protein                             81.3    7e-15   
gb|EUD70658.1|  hypothetical protein YYG_04216                        82.4    7e-15   
ref|XP_004035399.1|  hypothetical protein IMG5_099930                 82.4    9e-15   
ref|XP_001018526.1|  hypothetical protein TTHERM_00346800             82.0    1e-14   
ref|XP_009521324.1|  hypothetical protein PHYSODRAFT_482632           81.6    1e-14   
ref|XP_009036766.1|  hypothetical protein AURANDRAFT_71549            82.8    1e-14   
gb|EAS05128.2|  alpha/beta hydrolase family protein                   82.8    1e-14   
gb|ETK72174.1|  hypothetical protein L915_20690                       80.5    1e-14   
gb|KDO31408.1|  hypothetical protein SPRG_04024                       80.9    1e-14   
ref|XP_002998182.1|  serine protease family S09X, putative            80.5    2e-14   
ref|WP_028830769.1|  hypothetical protein                             81.3    2e-14   
ref|XP_002905156.1|  conserved hypothetical protein                   80.9    2e-14   
ref|XP_009829036.1|  hypothetical protein H257_05765                  80.9    2e-14   
ref|XP_002181623.1|  predicted protein                                76.6    1e-13   
gb|EAS06230.2|  alpha/beta fold hydrolase                             78.6    3e-13   
ref|XP_001440468.1|  hypothetical protein                             77.4    3e-13   
ref|XP_001303939.1|  Clan SC, family S9, unassigned serine peptidase  75.9    3e-13   
ref|XP_009532602.1|  hypothetical protein PHYSODRAFT_336708           76.3    5e-13   
ref|XP_009835152.1|  hypothetical protein, variant 2                  77.0    5e-13   
ref|XP_009835151.1|  hypothetical protein, variant 1                  76.6    5e-13   
ref|XP_009835153.1|  hypothetical protein, variant 3                  76.6    6e-13   
ref|XP_009835150.1|  hypothetical protein H257_10339                  76.6    6e-13   
ref|XP_001453596.1|  hypothetical protein                             76.6    6e-13   
ref|XP_001026475.1|  hypothetical protein TTHERM_00327120             77.0    8e-13   
ref|XP_001025373.1|  hypothetical protein TTHERM_00765130             77.4    8e-13   
ref|XP_008864598.1|  hypothetical protein H310_02754                  75.9    9e-13   
ref|XP_001471058.1|  Abnormal long morphology protein, putative       77.0    1e-12   
ref|XP_004030596.1|  hypothetical protein IMG5_157330                 72.4    1e-12   
emb|CCI48668.1|  unnamed protein product                              75.1    2e-12   
emb|CCI48669.1|  unnamed protein product                              75.1    2e-12   
emb|CCI48667.1|  unnamed protein product                              75.1    2e-12   
emb|CCA23748.1|  serine protease family S09X putative                 73.9    3e-12   
emb|CCA24651.1|  conserved hypothetical protein                       74.3    4e-12   
ref|XP_009108299.1|  PREDICTED: uncharacterized protein LOC103833...  73.6    5e-12   
ref|XP_004031365.1|  hypothetical protein IMG5_141100                 71.2    5e-12   
gb|ESS65374.1|  hypothetical protein TCDM_06305                       72.8    9e-12   
ref|XP_009032989.1|  hypothetical protein AURANDRAFT_70671            73.6    1e-11   
ref|XP_009032986.1|  hypothetical protein AURANDRAFT_61105            72.8    2e-11   
ref|XP_001031420.1|  hypothetical protein TTHERM_00825520             73.2    2e-11   
gb|KDD74697.1|  hypothetical protein H632_c1127p1                     68.2    3e-11   
ref|XP_001330359.1|  hypothetical protein                             70.5    3e-11   
ref|XP_001455919.1|  hypothetical protein                             70.5    5e-11   
ref|XP_008611713.1|  hypothetical protein SDRG_07645                  71.2    8e-11   
ref|XP_001312212.1|  hypothetical protein                             68.2    2e-10   
ref|XP_001423101.1|  hypothetical protein                             68.9    2e-10   
ref|XP_001347180.1|  hypothetical protein                             68.9    2e-10   
ref|XP_001457598.1|  hypothetical protein                             68.2    3e-10   
ref|XP_001322254.1|  hypothetical protein                             68.9    4e-10   
ref|XP_001328215.1|  Clan SC, family S9, unassigned serine peptidase  67.8    5e-10   
ref|XP_001458019.1|  hypothetical protein                             67.4    6e-10   
ref|XP_008351157.1|  PREDICTED: uncharacterized protein LOC103414...  67.0    9e-10   
ref|XP_001316821.1|  hypothetical protein                             67.0    9e-10   
gb|EAR95469.2|  alpha/beta fold hydrolase                             67.8    9e-10   
ref|XP_001015714.1|  hypothetical protein TTHERM_00077730             67.8    1e-09   
emb|CDJ33666.1|  hypothetical protein, conserved                      62.8    1e-09   
ref|XP_008896345.1|  hypothetical protein PPTG_04229                  64.3    7e-09   
gb|ETI35851.1|  hypothetical protein F443_17838                       64.3    7e-09   
gb|ETK76157.1|  hypothetical protein L915_17362                       64.3    7e-09   
ref|XP_001448158.1|  hypothetical protein                             63.5    9e-09   
ref|XP_001441722.1|  hypothetical protein                             63.5    1e-08   
ref|XP_001304280.1|  Clan SC, family S33, methylesterase-like ser...  62.4    2e-08   



>ref|XP_006339420.1| PREDICTED: uncharacterized protein LOC102603324 [Solanum tuberosum]
Length=568

 Score =   261 bits (668),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 121/127 (95%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDVLKCSHYMPLIRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVVEY
Sbjct  121  LRAVVEY  127



>ref|XP_009614536.1| PREDICTED: uncharacterized protein LOC104107438 [Nicotiana tomentosiformis]
Length=358

 Score =   255 bits (651),  Expect = 3e-80, Method: Compositional matrix adjust.
 Identities = 119/127 (94%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR DALKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDALKCTHYMPLIRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVVEY
Sbjct  121  LRAVVEY  127



>ref|XP_009775161.1| PREDICTED: uncharacterized protein LOC104225093 [Nicotiana sylvestris]
Length=569

 Score =   258 bits (659),  Expect = 5e-79, Method: Compositional matrix adjust.
 Identities = 118/127 (93%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQR+DLEVKNSR D LKC+HY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRRDLEVKNSRDDVLKCTHYMPLIRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVVEY
Sbjct  121  LRAVVEY  127



>gb|KHN03032.1| Hypothetical protein glysoja_009898 [Glycine soja]
Length=584

 Score =   258 bits (658),  Expect = 8e-79, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006600321.1| PREDICTED: uncharacterized protein LOC100807823 isoform X1 [Glycine 
max]
Length=608

 Score =   258 bits (659),  Expect = 9e-79, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006600322.1| PREDICTED: uncharacterized protein LOC100807823 isoform X2 [Glycine 
max]
Length=606

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>gb|KHN03427.1| Hypothetical protein glysoja_004453 [Glycine soja]
Length=612

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006584055.1| PREDICTED: uncharacterized protein LOC100798920 isoform X2 [Glycine 
max]
Length=609

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006584056.1| PREDICTED: uncharacterized protein LOC100798920 isoform X3 [Glycine 
max]
Length=608

 Score =   258 bits (659),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_004229458.1| PREDICTED: uncharacterized protein LOC101262250 isoform X1 [Solanum 
lycopersicum]
Length=568

 Score =   257 bits (656),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVVEY
Sbjct  121  LRAVVEY  127



>ref|XP_003529600.1| PREDICTED: uncharacterized protein LOC100798920 isoform X1 [Glycine 
max]
Length=607

 Score =   258 bits (658),  Expect = 1e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_007222369.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
 gb|EMJ23568.1| hypothetical protein PRUPE_ppa003420mg [Prunus persica]
Length=576

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+ VV+Y
Sbjct  121  LRTVVDY  127



>ref|XP_008223032.1| PREDICTED: uncharacterized protein LOC103322864 [Prunus mume]
Length=582

 Score =   257 bits (656),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 117/127 (92%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKNSRGD LKCSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNSRGDVLKCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+ VV+Y
Sbjct  121  LRTVVDY  127



>ref|XP_010322788.1| PREDICTED: uncharacterized protein LOC101262250 isoform X2 [Solanum 
lycopersicum]
Length=566

 Score =   256 bits (655),  Expect = 2e-78, Method: Compositional matrix adjust.
 Identities = 120/127 (94%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSR D LKCSHY+P+I P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRDDFLKCSHYMPLIRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKLLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVVEY
Sbjct  121  LRAVVEY  127



>ref|XP_004508352.1| PREDICTED: uncharacterized protein LOC101492469 isoform X1 [Cicer 
arietinum]
Length=603

 Score =   256 bits (655),  Expect = 3e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV Y
Sbjct  121  LTAVVNY  127



>ref|XP_004508353.1| PREDICTED: uncharacterized protein LOC101492469 isoform X2 [Cicer 
arietinum]
Length=601

 Score =   256 bits (653),  Expect = 6e-78, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD+EFML+GKWYQRKD+E+KNSRGDAL+CSHYIPI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDQEFMLRGKWYQRKDVEIKNSRGDALQCSHYIPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV Y
Sbjct  121  LTAVVNY  127



>gb|KJB72266.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72267.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
 gb|KJB72269.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=584

 Score =   255 bits (652),  Expect = 7e-78, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>gb|KJB72268.1| hypothetical protein B456_011G168000 [Gossypium raimondii]
Length=499

 Score =   253 bits (646),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLLDEEFMLKGKWYQRKD+EVKN RGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPESDLLDEEFMLKGKWYQRKDIEVKNGRGDVLQCSHYVPLVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_007154170.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26164.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=610

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_007154171.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
 gb|ESW26165.1| hypothetical protein PHAVU_003G096200g [Phaseolus vulgaris]
Length=611

 Score =   255 bits (652),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLL+ EFMLKGKWYQRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLEPEFMLKGKWYQRKDVEIKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_009365782.1| PREDICTED: uncharacterized protein LOC103955607 [Pyrus x bretschneideri]
Length=588

 Score =   254 bits (650),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKD+EVKNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFILKGKWYQRKDVEVKNSRGDVLKCSHYTPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LK VV+Y
Sbjct  121  LKTVVDY  127



>gb|KDP40084.1| hypothetical protein JCGZ_02082 [Jatropha curcas]
Length=575

 Score =   254 bits (649),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDFEIKNSRGDVLQCSHYVPIVTP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV+Y
Sbjct  121  LRAVVDY  127



>ref|XP_007034567.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
 gb|EOY05493.1| Alpha/beta-Hydrolases superfamily protein [Theobroma cacao]
Length=587

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P NDLLD+EFMLKGKWYQRKD+EVKNSRGD L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRAEYNPDNDLLDQEFMLKGKWYQRKDIEVKNSRGDVLRCSHYVPLVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>emb|CBI26166.3| unnamed protein product [Vitis vinifera]
Length=601

 Score =   254 bits (650),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  581  LKAVVEY  601
            LKAVV++
Sbjct  121  LKAVVDH  127



>ref|XP_010649852.1| PREDICTED: uncharacterized protein LOC100257995 [Vitis vinifera]
Length=599

 Score =   254 bits (649),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 124/127 (98%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLD+EFMLKGKW+QRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDQEFMLKGKWFQRKDLEVVNSRGDVLQCSHYVPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW+EKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWHEKDD  120

Query  581  LKAVVEY  601
            LKAVV++
Sbjct  121  LKAVVDH  127



>ref|XP_008340898.1| PREDICTED: uncharacterized protein LOC103403829 [Malus domestica]
Length=589

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYXPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LK VV+Y
Sbjct  121  LKTVVDY  127



>ref|XP_004296971.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462782.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
 ref|XP_011462783.1| PREDICTED: uncharacterized protein LOC101299950 [Fragaria vesca 
subsp. vesca]
Length=591

 Score =   254 bits (648),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ME LVNFIIRPPRAEYDPKNDLLD+EF+LKGKWYQRKDL+VKNSRGD LKCSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKNDLLDDEFILKGKWYQRKDLDVKNSRGDVLKCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSN+TVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNVTVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+ VV+Y
Sbjct  121  LRTVVDY  127



>ref|XP_011090819.1| PREDICTED: uncharacterized protein LOC105171411 isoform X4 [Sesamum 
indicum]
Length=600

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_011090820.1| PREDICTED: uncharacterized protein LOC105171411 isoform X5 [Sesamum 
indicum]
Length=599

 Score =   253 bits (647),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_011090816.1| PREDICTED: uncharacterized protein LOC105171411 isoform X1 [Sesamum 
indicum]
Length=615

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_011090818.1| PREDICTED: uncharacterized protein LOC105171411 isoform X3 [Sesamum 
indicum]
Length=614

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_011090817.1| PREDICTED: uncharacterized protein LOC105171411 isoform X2 [Sesamum 
indicum]
Length=614

 Score =   254 bits (648),  Expect = 5e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK DLLDEEFMLKGKWY RKDLEV NSRGD L+CSHY+PIICP
Sbjct  1    MEQLINFIIRPPRAEYDPKEDLLDEEFMLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_011071522.1| PREDICTED: uncharacterized protein LOC105156947 [Sesamum indicum]
Length=605

 Score =   253 bits (647),  Expect = 6e-77, Method: Compositional matrix adjust.
 Identities = 115/127 (91%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEY+PKNDLLD+EFMLKGKWYQRKDLEV NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFMLKGKWYQRKDLEVVNSRGDVLQCSHYMPIVRP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_002516800.1| catalytic, putative [Ricinus communis]
 gb|EEF45414.1| catalytic, putative [Ricinus communis]
Length=760

 Score =   256 bits (655),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 116/127 (91%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY PK+DLLD+EFMLKGKWYQRKDLE+KN+RGD L+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPKHDLLDQEFMLKGKWYQRKDLEIKNNRGDVLQCSHYAPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>gb|KDO74880.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   253 bits (645),  Expect = 8e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>gb|KDO74878.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=588

 Score =   253 bits (645),  Expect = 9e-77, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_006489238.1| PREDICTED: uncharacterized protein LOC102610023 [Citrus sinensis]
Length=588

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_008390806.1| PREDICTED: uncharacterized protein LOC103453051 [Malus domestica]
Length=588

 Score =   252 bits (644),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP+NDLLD+EF+LKGKWYQRKD+E+KNSRGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPQNDLLDQEFILKGKWYQRKDVELKNSRGDVLKCSHYTPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LK VV+Y
Sbjct  121  LKTVVDY  127



>gb|KDO74879.1| hypothetical protein CISIN_1g007812mg [Citrus sinensis]
Length=585

 Score =   252 bits (643),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_010105703.1| hypothetical protein L484_011315 [Morus notabilis]
 gb|EXC05734.1| hypothetical protein L484_011315 [Morus notabilis]
Length=569

 Score =   251 bits (642),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLL+EEFML+GKWY+R D+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKHDLLEEEFMLRGKWYKRNDVEIKNSRGDVLQCSHYVPIVAP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   EEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGQHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+A+VEY
Sbjct  121  LRAIVEY  127



>ref|XP_010512570.1| PREDICTED: uncharacterized protein LOC104788495 [Camelina sativa]
Length=561

 Score =   251 bits (641),  Expect = 2e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_010466700.1| PREDICTED: uncharacterized protein LOC104746856 [Camelina sativa]
Length=561

 Score =   251 bits (640),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_010532691.1| PREDICTED: uncharacterized protein LOC104808656 isoform X2 [Tarenaya 
hassleriana]
Length=537

 Score =   249 bits (636),  Expect = 5e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_010532690.1| PREDICTED: uncharacterized protein LOC104808656 isoform X1 [Tarenaya 
hassleriana]
Length=539

 Score =   249 bits (636),  Expect = 6e-76, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+PI  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPIERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_009339931.1| PREDICTED: uncharacterized protein LOC103932104 [Pyrus x bretschneideri]
Length=589

 Score =   250 bits (639),  Expect = 7e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPKNDLLDEEF+LKGKWYQRKD+EVKN RGD LKCSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKNDLLDEEFILKGKWYQRKDVEVKNGRGDVLKCSHYTPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
              KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGG+HVTLGWNEKDD
Sbjct  61   GEKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LK VV+Y
Sbjct  121  LKTVVDY  127



>ref|XP_010488424.1| PREDICTED: uncharacterized protein LOC104766269 isoform X1 [Camelina 
sativa]
 ref|XP_010488425.1| PREDICTED: uncharacterized protein LOC104766269 isoform X2 [Camelina 
sativa]
Length=561

 Score =   249 bits (636),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPQHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKP PCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPFPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_006299834.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
 gb|EOA32732.1| hypothetical protein CARUB_v10016036mg [Capsella rubella]
Length=564

 Score =   249 bits (637),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_004145038.1| PREDICTED: uncharacterized protein LOC101215845 [Cucumis sativus]
Length=586

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_004154381.1| PREDICTED: uncharacterized protein LOC101218432 [Cucumis sativus]
 ref|XP_004166999.1| PREDICTED: uncharacterized protein LOC101225095 [Cucumis sativus]
 gb|KGN46163.1| hypothetical protein Csa_6G061740 [Cucumis sativus]
Length=595

 Score =   250 bits (638),  Expect = 8e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_008458538.1| PREDICTED: uncharacterized protein LOC103497914 isoform X2 [Cucumis 
melo]
Length=595

 Score =   250 bits (638),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_006419777.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
 gb|ESR33017.1| hypothetical protein CICLE_v10004606mg [Citrus clementina]
Length=588

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+EVKN RGD ++CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEVKNKRGDVIQCSHYVPILNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLASNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_008458537.1| PREDICTED: uncharacterized protein LOC103497914 isoform X1 [Cucumis 
melo]
Length=597

 Score =   249 bits (637),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDP NDLL++EF L+GK YQRKDLEVKNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLINFIIRPPRAEYDPNNDLLEDEFTLRGKLYQRKDLEVKNSRGDVLQCSHYLPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVF LDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFALDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>emb|CDX77500.1| BnaA07g06380D [Brassica napus]
Length=566

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_006283451.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16349.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=556

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_006283452.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
 gb|EOA16350.1| hypothetical protein CARUB_v10004497mg [Capsella rubella]
Length=558

 Score =   248 bits (633),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 112/127 (88%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLLD+EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLDQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_009102606.1| PREDICTED: uncharacterized protein LOC103828728 [Brassica rapa]
Length=566

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>emb|CDX85110.1| BnaC07g07960D [Brassica napus]
Length=566

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLE+KNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEIKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_006597567.1| PREDICTED: uncharacterized protein LOC100781610 isoform X1 [Glycine 
max]
Length=582

 Score =   248 bits (634),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_006597568.1| PREDICTED: uncharacterized protein LOC100781610 isoform X2 [Glycine 
max]
Length=580

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+YDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAKYDPKSDLLDHEFMLKGKWFQRKDMEIKNSRGDVLQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>gb|KEH32227.1| alpha/beta-hydrolase superfamily protein [Medicago truncatula]
Length=594

 Score =   249 bits (635),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 114/127 (90%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYDPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV Y
Sbjct  121  LTAVVNY  127



>ref|XP_007147794.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19788.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=591

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_007147795.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
 gb|ESW19789.1| hypothetical protein PHAVU_006G155700g [Phaseolus vulgaris]
Length=590

 Score =   248 bits (634),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN  GD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYDPKSDLLDSEFMLKGKWFQRKDVEIKNRHGDILQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_010450069.1| PREDICTED: uncharacterized protein LOC104732228 [Camelina sativa]
Length=556

 Score =   247 bits (631),  Expect = 5e-75, Method: Compositional matrix adjust.
 Identities = 111/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|NP_188996.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AAT06481.1| At3g23540 [Arabidopsis thaliana]
 gb|AEE76774.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=566

 Score =   247 bits (631),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MDQLVNFIIRPPRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>gb|KHN37552.1| Hypothetical protein glysoja_007255 [Glycine soja]
Length=597

 Score =   248 bits (633),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ME LVNFIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEPLVNFIIRPPRAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_006406019.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
 gb|ESQ47472.1| hypothetical protein EUTSA_v10020399mg [Eutrema salsugineum]
Length=566

 Score =   246 bits (629),  Expect = 9e-75, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYDP++DLL+++FM+KG+WYQRKDLEV NSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYQRKDLEVTNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIMLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>gb|ACJ85572.1| unknown [Medicago truncatula]
Length=464

 Score =   244 bits (622),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P +DLLD+EF+L+GKWYQRKD+E+KNSRGDAL+CSHYIPI   
Sbjct  1    MEQLVNFIIRPPRAEYGPNSDLLDKEFLLRGKWYQRKDVELKNSRGDALQCSHYIPIGSA  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV Y
Sbjct  121  LTAVVNY  127



>ref|XP_006414745.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
 gb|ESQ56198.1| hypothetical protein EUTSA_v10024836mg [Eutrema salsugineum]
Length=550

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 123/127 (97%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_010669834.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
 ref|XP_010669835.1| PREDICTED: uncharacterized protein LOC104886965 [Beta vulgaris 
subsp. vulgaris]
Length=556

 Score =   246 bits (628),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 113/127 (89%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLLD+EFMLKGKWYQRKD+E+KNSRGDAL+CSHY PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYSPEHDLLDQEFMLKGKWYQRKDIEIKNSRGDALQCSHYSPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GK LPCVIYCHGNSGCRADASEAAIILLP NITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   DGKLLPCVIYCHGNSGCRADASEAAIILLPLNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV+Y
Sbjct  121  LKAVVDY  127



>ref|XP_002315536.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
 gb|EEF01707.2| hypothetical protein POPTR_0010s03020g [Populus trichocarpa]
Length=563

 Score =   245 bits (626),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            + KPLPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAVILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV Y
Sbjct  121  LMAVVNY  127



>ref|XP_002883434.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH59693.1| hypothetical protein ARALYDRAFT_898866 [Arabidopsis lyrata subsp. 
lyrata]
Length=565

 Score =   245 bits (625),  Expect = 4e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEYD ++DLL++EFM+KG+WYQRKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYDAEHDLLEKEFMMKGRWYQRKDLEVKNSRGDVLQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVE+
Sbjct  121  LKAVVEF  127



>ref|XP_010440497.1| PREDICTED: uncharacterized protein LOC104723788 [Camelina sativa]
Length=559

 Score =   244 bits (624),  Expect = 5e-74, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG +VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGAYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_011014506.1| PREDICTED: uncharacterized protein LOC105118291 [Populus euphratica]
Length=583

 Score =   244 bits (623),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 110/127 (87%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK+DLLD+EFMLKGKWYQRKD+EV+N RGDAL+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNGRGDALQCSHYMPIVNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            + KPLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDFSGSGLSGG+HVTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIILLPSNITVFTLDFSGSGLSGGDHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV +
Sbjct  121  LMAVVNH  127



>ref|XP_009107962.1| PREDICTED: uncharacterized protein LOC103833638 [Brassica rapa]
 emb|CDY18119.1| BnaA01g23800D [Brassica napus]
Length=524

 Score =   243 bits (619),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>emb|CDY09027.1| BnaC01g30640D [Brassica napus]
Length=532

 Score =   243 bits (620),  Expect = 1e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQ VNFIIRPPRAEYDP++DLL+++FM+KG+WY RKDLEVKNSRGD L+CSHY+P+  P
Sbjct  1    MEQFVNFIIRPPRAEYDPEHDLLEKDFMMKGRWYHRKDLEVKNSRGDVLQCSHYMPVELP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRAD SEAA++LL SNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADGSEAAVVLLLSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|NP_193165.7| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
 gb|AEE83410.1| alpha/beta-hydrolase family protein [Arabidopsis thaliana]
Length=558

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNF+IRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFVIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_010435157.1| PREDICTED: uncharacterized protein LOC104719022 isoform X1 [Camelina 
sativa]
Length=559

 Score =   243 bits (621),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_010435158.1| PREDICTED: uncharacterized protein LOC104719022 isoform X2 [Camelina 
sativa]
Length=557

 Score =   243 bits (620),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EFMLKG+WYQRKDLEVKNSRGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFMLKGRWYQRKDLEVKNSRGDVLKCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEA I+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEK+D
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAVIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>gb|AES64344.2| alpha/beta hydrolase family protein [Medicago truncatula]
Length=535

 Score =   242 bits (618),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KN RGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDNEFMLKGKWFQRKDVEIKNDRGDVLQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_002868296.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44555.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=557

 Score =   241 bits (615),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 122/127 (96%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>emb|CDY12752.1| BnaC04g28890D [Brassica napus]
Length=506

 Score =   239 bits (611),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>emb|CDY49406.1| BnaCnng17160D [Brassica napus]
Length=505

 Score =   239 bits (610),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 107/127 (84%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLELP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            + +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   QDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_009139528.1| PREDICTED: uncharacterized protein LOC103863543 isoform X1 [Brassica 
rapa]
Length=550

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_009139529.1| PREDICTED: uncharacterized protein LOC103863543 isoform X2 [Brassica 
rapa]
Length=548

 Score =   240 bits (612),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_010035879.1| PREDICTED: uncharacterized protein LOC104425011 isoform X1 [Eucalyptus 
grandis]
 gb|KCW84317.1| hypothetical protein EUGRSUZ_B01162 [Eucalyptus grandis]
Length=590

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_010035885.1| PREDICTED: uncharacterized protein LOC104425011 isoform X2 [Eucalyptus 
grandis]
Length=588

 Score =   241 bits (614),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL++FIIRPPRAEY PK DLLD+EFMLK K Y+R DLEVKNSRG+ ++C+HY+P++ P
Sbjct  1    MEQLISFIIRPPRAEYSPKYDLLDDEFMLKDKLYRRNDLEVKNSRGEIIQCTHYVPVVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_004486108.1| PREDICTED: HBS1-like protein-like [Cicer arietinum]
Length=929

 Score =   246 bits (627),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 109/127 (86%), Positives = 120/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLV FIIRPPRAEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVKFIIRPPRAEYDPKSDLLDYEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +GKPLPCVIYCHGNSGCR DASEAA++LLPSNITVF LDFSGSG+SGGEHVTLGWNEKDD
Sbjct  61   DGKPLPCVIYCHGNSGCRVDASEAAMVLLPSNITVFALDFSGSGISGGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>gb|EPS65169.1| hypothetical protein M569_09610, partial [Genlisea aurea]
Length=431

 Score =   236 bits (603),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 119/127 (94%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEYDPK+DLL+ EFMLKG+WY+RKDLEV NSR D L+CSHY+P+I P
Sbjct  1    MEQLINFIIRPPRAEYDPKHDLLESEFMLKGRWYRRKDLEVVNSRSDVLQCSHYMPLILP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E K LPCVIYCHGNSGCR DASEAA+ILLPSN++VFTLDFSGSGLSGGEHVTLGWNE+DD
Sbjct  61   EDKTLPCVIYCHGNSGCRTDASEAAVILLPSNVSVFTLDFSGSGLSGGEHVTLGWNERDD  120

Query  581  LKAVVEY  601
            L+AVV+Y
Sbjct  121  LRAVVDY  127



>ref|XP_009139530.1| PREDICTED: uncharacterized protein LOC103863543 isoform X3 [Brassica 
rapa]
Length=546

 Score =   239 bits (610),  Expect = 4e-72, Method: Compositional matrix adjust.
 Identities = 108/127 (85%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY P++DLL++EF+LKG+WYQRKDLEVKN RGD LKCSHY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYKPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDVLKCSHYMPLERP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E +PLPCVIYCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLGWNEKDD
Sbjct  61   EDRPLPCVIYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVVEY
Sbjct  121  LKAVVEY  127



>ref|XP_009109570.1| PREDICTED: uncharacterized protein LOC103835198 [Brassica rapa]
Length=530

 Score =   237 bits (605),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ C 
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVECS  60

Query  401  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  577
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  578  DLKAVVEY  601
            DLKAVVEY
Sbjct  121  DLKAVVEY  128



>ref|XP_011009029.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
 ref|XP_011009030.1| PREDICTED: uncharacterized protein LOC105114237 isoform X1 [Populus 
euphratica]
Length=588

 Score =   237 bits (605),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV+Y
Sbjct  121  LMAVVDY  127



>ref|XP_011009032.1| PREDICTED: uncharacterized protein LOC105114237 isoform X3 [Populus 
euphratica]
Length=573

 Score =   237 bits (604),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 121/127 (95%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK+DLLD+EF+LKGKWYQRKD+EV+NSRGD L+CSHY+PI+ P
Sbjct  1    MEQLVNFIIRPPRAEYNPKHDLLDQEFLLKGKWYQRKDVEVQNSRGDVLQCSHYMPIVNP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            + KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNEKDD
Sbjct  61   QEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV+Y
Sbjct  121  LMAVVDY  127



>emb|CDY12069.1| BnaC03g59850D [Brassica napus]
Length=537

 Score =   236 bits (601),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 122/128 (95%), Gaps = 1/128 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI-IC  397
            MEQLVNFIIRPPRAEY+P+NDLL++EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+ + 
Sbjct  1    MEQLVNFIIRPPRAEYNPENDLLEQEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVELS  60

Query  398  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  577
             + +PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGE+VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEYVTLGSNEKD  120

Query  578  DLKAVVEY  601
            DLKAVVEY
Sbjct  121  DLKAVVEY  128



>ref|XP_010942429.1| PREDICTED: uncharacterized protein LOC105060435 isoform X2 [Elaeis 
guineensis]
Length=557

 Score =   234 bits (598),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>gb|EMS48134.1| hypothetical protein TRIUR3_10822 [Triticum urartu]
Length=366

 Score =   228 bits (582),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>gb|EMT30875.1| hypothetical protein F775_08510 [Aegilops tauschii]
Length=383

 Score =   229 bits (583),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_010942428.1| PREDICTED: uncharacterized protein LOC105060435 isoform X1 [Elaeis 
guineensis]
Length=610

 Score =   234 bits (597),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y PKNDLLD EFML+G+WYQRKDLEV N +G  L+CSHY+P++  
Sbjct  1    MDQLVNFIIRPPRADYSPKNDLLDPEFMLRGRWYQRKDLEVINGQGKKLQCSHYVPLVMT  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPSKITVFTLDFSGSGLSDGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV Y
Sbjct  121  LRAVVNY  127



>ref|XP_004984312.1| PREDICTED: uncharacterized protein LOC101769070 isoform X1 [Setaria 
italica]
Length=572

 Score =   233 bits (594),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEVKN  G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_009393893.1| PREDICTED: uncharacterized protein LOC103979459 [Musa acuminata 
subsp. malaccensis]
Length=560

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+Y P++DLL++EFMLKG+W+QRKDLEV N RG  L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYSPQDDLLEQEFMLKGRWFQRKDLEVINGRGKKLQCSHYVPLVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAI+LLPSNITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKVLPCVIYCHGNSGCRADASEAAIVLLPSNITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            L AVV+Y
Sbjct  121  LTAVVDY  127



>dbj|BAJ88870.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=434

 Score =   229 bits (584),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV NS+G  L+CSHYIP + P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFQRKDLEVVNSQGKKLQCSHYIPAVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG  LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNEK+D
Sbjct  61   EGTALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNEKED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_003557834.1| PREDICTED: uncharacterized protein LOC100838212 [Brachypodium 
distachyon]
Length=573

 Score =   232 bits (591),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 118/127 (93%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPDDDLLEQEFMLKGRWFQRKDLEVINGQGKKLQCSHYMPVVMP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGKPLPCVIYCHGNSGCRADASEAAIILLP+NITVFTLDFSGSG+S GEHVTLGWNE++D
Sbjct  61   EGKPLPCVIYCHGNSGCRADASEAAIILLPTNITVFTLDFSGSGISEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>emb|CDX90263.1| BnaA08g17210D [Brassica napus]
Length=538

 Score =   231 bits (588),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 106/128 (83%), Positives = 120/128 (94%), Gaps = 1/128 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+P++DLL+ EF+LKG+WYQRKDLEVKNSRGD LKCSHY+P+   
Sbjct  1    MEQLVNFIIRPPRAEYNPEHDLLEHEFLLKGRWYQRKDLEVKNSRGDTLKCSHYMPVEHS  60

Query  401  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  577
            E + PLPCV+YCHGNSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGG++VTLG NEKD
Sbjct  61   EDRRPLPCVVYCHGNSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGDYVTLGSNEKD  120

Query  578  DLKAVVEY  601
            DLKAVVEY
Sbjct  121  DLKAVVEY  128



>gb|ABF96061.1| expressed protein [Oryza sativa Japonica Group]
 gb|EAZ26989.1| hypothetical protein OsJ_10915 [Oryza sativa Japonica Group]
Length=574

 Score =   231 bits (590),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV +
Sbjct  121  LKAVVNH  127



>gb|EAY90076.1| hypothetical protein OsI_11646 [Oryza sativa Indica Group]
Length=575

 Score =   231 bits (589),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRAEY P +DLL++EFMLKG+W+QRKDLEV N +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKGRWFQRKDLEVVNGQGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV +
Sbjct  121  LKAVVNH  127



>ref|NP_001141958.1| hypothetical protein [Zea mays]
 gb|ACF87375.1| unknown [Zea mays]
 tpg|DAA45457.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=564

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_008668219.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 tpg|DAA45458.1| TPA: hypothetical protein ZEAMMB73_531210 [Zea mays]
Length=566

 Score =   231 bits (588),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006850814.1| hypothetical protein AMTR_s00025p00118390 [Amborella trichopoda]
 gb|ERN12395.1| hypothetical protein AMTR_s00025p00118390 [Amborella trichopoda]
Length=554

 Score =   229 bits (584),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 105/127 (83%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRAEY+PK DLLDE+F+LKG+W+QRKDLEV NSRG+ LKC+HY+P+  P
Sbjct  1    MEQLVNFIIRPPRAEYNPKTDLLDEKFVLKGQWFQRKDLEVVNSRGNVLKCTHYLPLNIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EG+ LPCVIYCHGNSGCRADASEAAIILLPS ITVF LDF+GSGLS GEHVTLGWNEKDD
Sbjct  61   EGRSLPCVIYCHGNSGCRADASEAAIILLPSYITVFALDFAGSGLSEGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV +
Sbjct  121  LKAVVNH  127



>ref|XP_008797057.1| PREDICTED: uncharacterized protein LOC103712341 [Phoenix dactylifera]
Length=591

 Score =   230 bits (586),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+Y PKNDLLD+EFMLKG+WYQRKDLEV N +G  L+CSHY+P+   
Sbjct  1    MEQLVNFIIRPPRADYSPKNDLLDQEFMLKGRWYQRKDLEVINGQGKKLQCSHYVPLAMT  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLG NEKDD
Sbjct  61   EGKTLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGCNEKDD  120

Query  581  LKAVVEY  601
            L+AVV +
Sbjct  121  LRAVVNF  127



>emb|CDO98976.1| unnamed protein product [Coffea canephora]
Length=572

 Score =   229 bits (585),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 106/127 (83%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQL+NFIIRPPRAEY+PKNDLLD+EF LK KWYQRKDLEV N RG+ L+CSHY+PI   
Sbjct  1    MEQLINFIIRPPRAEYNPKNDLLDQEFKLKRKWYQRKDLEVSNCRGEILQCSHYMPIGFS  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRAD SEAAIILLP NITVFTLDFSGSGLSGGE+V+LGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADGSEAAIILLPLNITVFTLDFSGSGLSGGEYVSLGWNEKDD  120

Query  581  LKAVVEY  601
            L+AVV+Y
Sbjct  121  LRAVVDY  127



>ref|XP_006650100.1| PREDICTED: uncharacterized protein LOC102716943 [Oryza brachyantha]
Length=573

 Score =   229 bits (584),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 115/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRAEY P +DLL++EFMLK +W+QRKDLEV N +G  L+CSHY+P + P
Sbjct  1    MDQLVNFIIRPPRAEYSPNDDLLEQEFMLKRRWFQRKDLEVVNGQGKKLQCSHYMPTVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWNE++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNERED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_010255853.1| PREDICTED: uncharacterized protein LOC104596404 [Nelumbo nucifera]
Length=580

 Score =   229 bits (583),  Expect = 8e-68, Method: Compositional matrix adjust.
 Identities = 103/127 (81%), Positives = 117/127 (92%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+Y+P+NDL+D+EF L+G+ + RKDL+V NSRG+ L+CSHY+P++ P
Sbjct  1    MEQLVNFIIRPPRADYNPQNDLVDQEFTLRGQRFHRKDLQVTNSRGNVLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSYITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>gb|ACF83402.1| unknown [Zea mays]
Length=564

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 102/127 (80%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            M+QLVNFIIRPPRA+Y P +DLL++EFMLKG+W+ RKDLEVKN +G  L+CSHY+P++ P
Sbjct  1    MDQLVNFIIRPPRADYSPNDDLLEQEFMLKGRWFLRKDLEVKNGQGKKLQCSHYMPVVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLS GEHVTLGWN ++D
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSEGEHVTLGWNGRED  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>dbj|BAB02772.1| unnamed protein product [Arabidopsis thaliana]
Length=599

 Score =   226 bits (577),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 107/135 (79%), Positives = 120/135 (89%), Gaps = 11/135 (8%)
 Frame = +2

Query  221  MEQLVNFIIRPPR--------AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCS  376
            M+QLVNFIIRPPR        AEYDP++DLL+++FM+KG+WYQRKDLEVKNSRGD L+CS
Sbjct  1    MDQLVNFIIRPPRFDLLVCCRAEYDPEHDLLEKKFMMKGRWYQRKDLEVKNSRGDVLQCS  60

Query  377  HYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVT  556
            HY+P+  PEGKPLPCVIYCHGN   RAD SEAAI+LLPSNITVFTLDFSGSGLSGGEHVT
Sbjct  61   HYMPVERPEGKPLPCVIYCHGN---RADGSEAAIVLLPSNITVFTLDFSGSGLSGGEHVT  117

Query  557  LGWNEKDDLKAVVEY  601
            LGWNEKDDLKAVVE+
Sbjct  118  LGWNEKDDLKAVVEF  132



>ref|XP_010278880.1| PREDICTED: uncharacterized protein LOC104612914 isoform X1 [Nelumbo 
nucifera]
Length=584

 Score =   226 bits (576),  Expect = 8e-67, Method: Compositional matrix adjust.
 Identities = 104/127 (82%), Positives = 116/127 (91%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            MEQLVNFIIRPPRA+Y+PKNDLL++EF L+G+ + RKDL+V NSRG+ L+CSHY+P + P
Sbjct  1    MEQLVNFIIRPPRADYNPKNDLLEQEFTLQGQRFHRKDLQVTNSRGNVLQCSHYVPDVIP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            EGK LPCVIYCHGNSGCRADASEAAIILLPS ITVFTLDFSGSGLS GEHVTLGWNEKDD
Sbjct  61   EGKALPCVIYCHGNSGCRADASEAAIILLPSCITVFTLDFSGSGLSEGEHVTLGWNEKDD  120

Query  581  LKAVVEY  601
            LKAVV Y
Sbjct  121  LKAVVNY  127



>ref|XP_006595393.1| PREDICTED: uncharacterized protein LOC100815597 [Glycine max]
Length=592

 Score =   224 bits (571),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 98/115 (85%), Positives = 110/115 (96%), Gaps = 0/115 (0%)
 Frame = +2

Query  257  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  436
            +AEYDPK+DLLD EFMLKGKW+QRKD+E+KNSRGD L+CSHY+PI+ P+GKPLPCVIYCH
Sbjct  8    KAEYDPKSDLLDHEFMLKGKWFQRKDVEIKNSRGDVLQCSHYMPIVSPDGKPLPCVIYCH  67

Query  437  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            GNSGCR DASEAA+ILLPSNITVFTLDFSGSG+SGGEHVTLGWNEKDDL+AVV Y
Sbjct  68   GNSGCRVDASEAALILLPSNITVFTLDFSGSGISGGEHVTLGWNEKDDLRAVVNY  122



>emb|CAB10208.1| hypothetical protein [Arabidopsis thaliana]
 emb|CAB78471.1| hypothetical protein [Arabidopsis thaliana]
Length=505

 Score =   214 bits (544),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 109/114 (96%), Gaps = 0/114 (0%)
 Frame = +2

Query  260  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  439
            AEY+P++DLL++EF+LKG+WYQRKDLEVKN RGD L+CSHY+P+  PE +PLPCVIYCHG
Sbjct  62   AEYNPEHDLLEQEFLLKGRWYQRKDLEVKNIRGDILQCSHYMPVERPEDRPLPCVIYCHG  121

Query  440  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            NSGCRADASEAAI+LLPSNIT+FTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY
Sbjct  122  NSGCRADASEAAIVLLPSNITIFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  175



>ref|XP_002311822.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
 gb|EEE89189.2| hypothetical protein POPTR_0008s20480g [Populus trichocarpa]
Length=591

 Score =   212 bits (539),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 97/130 (75%), Positives = 115/130 (88%), Gaps = 2/130 (2%)
 Frame = +2

Query  218  CMEQLVNFIIRP--PRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPI  391
            CM + + F++      AEY+PK+DLLD+EFMLKGKWYQRKD+EV+NSRGD L+CSHY+PI
Sbjct  3    CMPRKLQFLMTGYLSIAEYNPKHDLLDQEFMLKGKWYQRKDVEVQNSRGDVLQCSHYMPI  62

Query  392  ICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNE  571
            + P+ KPLPCVIYCHGNSGCR DASEAAI+LLPSNITV TLDFSGSG+SGG++VTLGWNE
Sbjct  63   VNPQEKPLPCVIYCHGNSGCRVDASEAAIVLLPSNITVLTLDFSGSGISGGDYVTLGWNE  122

Query  572  KDDLKAVVEY  601
            KDDL AVV+Y
Sbjct  123  KDDLMAVVDY  132



>ref|XP_003535011.1| PREDICTED: uncharacterized protein LOC100787162 isoform X1 [Glycine 
max]
 ref|XP_006586805.1| PREDICTED: uncharacterized protein LOC100787162 isoform X2 [Glycine 
max]
Length=496

 Score =   204 bits (519),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/127 (75%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG ALKCSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLELKNSRGYALKCSHYLPSRLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKMVVSH  128



>gb|KDO78612.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=284

 Score =   198 bits (503),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_006597639.1| PREDICTED: uncharacterized protein LOC100778204 isoform X8 [Glycine 
max]
Length=350

 Score =   199 bits (507),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKMVVSH  128



>ref|XP_007147555.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 ref|XP_007147556.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19549.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
 gb|ESW19550.1| hypothetical protein PHAVU_006G134600g [Phaseolus vulgaris]
Length=496

 Score =   203 bits (516),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNI+VFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVIYCHGNSGCRADANEAAVILLPSNISVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>ref|XP_006584122.1| PREDICTED: alpha/beta hydrolase domain-containing protein 13-like 
[Glycine max]
Length=397

 Score =   200 bits (509),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLAGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>ref|XP_003594373.1| Abhydrolase domain-containing protein [Medicago truncatula]
Length=500

 Score =   202 bits (513),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  43   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  102

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  103  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  162

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  163  LKMVVSY  169



>gb|KDO78613.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=381

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_006449959.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63199.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=381

 Score =   199 bits (505),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_003550951.1| PREDICTED: uncharacterized protein LOC100784510 isoform X1 [Glycine 
max]
 ref|XP_006600274.1| PREDICTED: uncharacterized protein LOC100784510 isoform X2 [Glycine 
max]
Length=481

 Score =   201 bits (510),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLTGRTYQRQDLELKNTRGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>gb|AES64624.2| alpha/beta superfamily hydrolase [Medicago truncatula]
Length=516

 Score =   201 bits (511),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 93/127 (73%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NFIIRPPRAEYDP   L ++EF L G+ YQRKDLE+KN+RG  LKCSHYIP   P
Sbjct  57   IDQFINFIIRPPRAEYDPDQYLCEKEFTLLGRQYQRKDLELKNARGYTLKCSHYIPSHFP  116

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCR DA+EAA++LLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  117  EDISLPCVIYCHGNSGCRVDANEAAVVLLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  176

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  177  LKMVVSY  183



>ref|XP_004486396.1| PREDICTED: uncharacterized protein LOC101505258 isoform X1 [Cicer 
arietinum]
 ref|XP_004486397.1| PREDICTED: uncharacterized protein LOC101505258 isoform X2 [Cicer 
arietinum]
Length=480

 Score =   200 bits (509),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 91/127 (72%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L ++EF L GK +QRKDLE+KN+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKEFTLAGKNFQRKDLELKNTRGYTLQCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
               PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   ANIPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>ref|XP_001769780.1| predicted protein [Physcomitrella patens]
 gb|EDQ65342.1| predicted protein [Physcomitrella patens]
Length=352

 Score =   197 bits (501),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 94/129 (73%), Positives = 108/129 (84%), Gaps = 2/129 (2%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE--VKNSRGDALKCSHYIPII  394
            MEQLVNF+IRPPRA Y P  DLL++EF+LKG+ Y RKDL+  V N+RG  L+CSHY P  
Sbjct  2    MEQLVNFVIRPPRASYSPSLDLLEQEFLLKGRKYSRKDLQAGVLNNRGHVLQCSHYTPQS  61

Query  395  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  574
             P+ +PLPCVIYCHGNSGCRADA+EAAIILLP NITVFTLDFSGSGLS G +V+LGWNE 
Sbjct  62   PPDDEPLPCVIYCHGNSGCRADANEAAIILLPCNITVFTLDFSGSGLSDGNYVSLGWNET  121

Query  575  DDLKAVVEY  601
            DDLKAVV +
Sbjct  122  DDLKAVVNH  130



>gb|KDO78610.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=391

 Score =   198 bits (503),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>gb|KEH32722.1| esterase/lipase domain protein [Medicago truncatula]
Length=401

 Score =   198 bits (504),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_006597638.1| PREDICTED: uncharacterized protein LOC100778204 isoform X7 [Glycine 
max]
Length=432

 Score =   199 bits (505),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKMVVSH  128



>ref|XP_002968666.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
 ref|XP_002989915.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ08928.1| hypothetical protein SELMODRAFT_184921 [Selaginella moellendorffii]
 gb|EFJ29782.1| hypothetical protein SELMODRAFT_170125 [Selaginella moellendorffii]
Length=330

 Score =   195 bits (495),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 94/131 (72%), Positives = 109/131 (83%), Gaps = 4/131 (3%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE----VKNSRGDALKCSHYIP  388
            ++QLVNF+IRPPRA+Y P +DLL+ EF+LKG  Y+RKDLE    + NSRG  L+CSHY P
Sbjct  2    IDQLVNFVIRPPRADYMPSHDLLEREFVLKGHRYERKDLEASLFITNSRGHVLQCSHYRP  61

Query  389  IICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWN  568
               PE   LPCVIYCHGNSGCRADA+EAAIILLPSNITVFTLDFSGSGLS G++V+LGWN
Sbjct  62   RPLPEDVSLPCVIYCHGNSGCRADANEAAIILLPSNITVFTLDFSGSGLSEGKYVSLGWN  121

Query  569  EKDDLKAVVEY  601
            E DDLKAVV +
Sbjct  122  ETDDLKAVVTH  132



>gb|KEH32721.1| esterase/lipase domain protein [Medicago truncatula]
Length=440

 Score =   198 bits (503),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_010252925.1| PREDICTED: uncharacterized protein LOC104594357 isoform X2 [Nelumbo 
nucifera]
Length=499

 Score =   199 bits (506),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLELVNGRGHTLQCSHYVPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKDD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>gb|KDO78611.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=446

 Score =   198 bits (503),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_006449960.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
 gb|ESR63200.1| hypothetical protein CICLE_v10015057mg [Citrus clementina]
Length=486

 Score =   199 bits (505),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_006467246.1| PREDICTED: uncharacterized protein LOC102629222 isoform X1 [Citrus 
sinensis]
 ref|XP_006467247.1| PREDICTED: uncharacterized protein LOC102629222 isoform X2 [Citrus 
sinensis]
 ref|XP_006467248.1| PREDICTED: uncharacterized protein LOC102629222 isoform X3 [Citrus 
sinensis]
 gb|KDO78609.1| hypothetical protein CISIN_1g011425mg [Citrus sinensis]
Length=486

 Score =   198 bits (504),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +FML G+ Y+R+DLE++N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFMLAGRSYKRQDLEIRNARGHVLQCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_003547304.1| PREDICTED: uncharacterized protein LOC100778204 isoform X1 [Glycine 
max]
 ref|XP_006597633.1| PREDICTED: uncharacterized protein LOC100778204 isoform X2 [Glycine 
max]
 ref|XP_006597634.1| PREDICTED: uncharacterized protein LOC100778204 isoform X3 [Glycine 
max]
Length=492

 Score =   198 bits (504),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE+KNSRG  L+CSHY+P   P
Sbjct  2    IEQFINFIIRPPRAQYDPNQYLWEKEFTLAGRTYQRQDLELKNSRGYTLQCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDD
Sbjct  62   EDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKMVVSH  128



>ref|XP_008440941.1| PREDICTED: uncharacterized protein LOC103485206 isoform X2 [Cucumis 
melo]
Length=470

 Score =   198 bits (503),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVTY  128



>ref|XP_004134817.1| PREDICTED: uncharacterized protein LOC101211724 [Cucumis sativus]
 ref|XP_004163397.1| PREDICTED: uncharacterized protein LOC101223332 [Cucumis sativus]
 gb|KGN49009.1| hypothetical protein Csa_6G510270 [Cucumis sativus]
Length=489

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKSFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVTY  128



>ref|XP_008440940.1| PREDICTED: uncharacterized protein LOC103485206 isoform X1 [Cucumis 
melo]
Length=489

 Score =   198 bits (503),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++ F L G+ YQR+DLE++NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKNFTLAGRAYQRQDLELRNSRGHTLQCSHYLPSSIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVTY  128



>ref|XP_007154081.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26075.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=453

 Score =   197 bits (500),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>ref|XP_011090821.1| PREDICTED: uncharacterized protein LOC105171411 isoform X6 [Sesamum 
indicum]
Length=588

 Score =   199 bits (507),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 90/100 (90%), Positives = 94/100 (94%), Gaps = 0/100 (0%)
 Frame = +2

Query  302  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  481
            MLKGKWY RKDLEV NSRGD L+CSHY+PIICPEG  LPCVIYCHGNSGCR DASEAA+I
Sbjct  1    MLKGKWYHRKDLEVTNSRGDVLQCSHYMPIICPEGTKLPCVIYCHGNSGCRTDASEAAVI  60

Query  482  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVV+Y
Sbjct  61   LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVDY  100



>gb|KEH32720.1| esterase/lipase domain protein [Medicago truncatula]
Length=502

 Score =   198 bits (503),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPFPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>gb|KJB57898.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=375

 Score =   195 bits (495),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>gb|KJB57899.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=395

 Score =   195 bits (495),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_007154082.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
 gb|ESW26076.1| hypothetical protein PHAVU_003G089300g [Phaseolus vulgaris]
Length=499

 Score =   197 bits (502),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L ++EF L  + YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKEFTLASRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKMVVSY  128



>ref|XP_004499346.1| PREDICTED: uncharacterized protein LOC101489957 isoform X3 [Cicer 
arietinum]
Length=469

 Score =   197 bits (500),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_009411958.1| PREDICTED: uncharacterized protein LOC103993570 isoform X1 [Musa 
acuminata subsp. malaccensis]
Length=528

 Score =   197 bits (502),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFTLAGRKYKRLDLELTNGRGHTLQCSHYVPSFVP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ESTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK  V +
Sbjct  122  LKTAVSF  128



>ref|XP_004499344.1| PREDICTED: uncharacterized protein LOC101489957 isoform X1 [Cicer 
arietinum]
 ref|XP_004499345.1| PREDICTED: uncharacterized protein LOC101489957 isoform X2 [Cicer 
arietinum]
Length=497

 Score =   197 bits (501),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 89/127 (70%), Positives = 108/127 (85%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L ++EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEKEFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_010233983.1| PREDICTED: uncharacterized protein LOC100830635 isoform X2 [Brachypodium 
distachyon]
Length=496

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  581  LKAVVEY  601
            LK+VV +
Sbjct  122  LKSVVSF  128



>ref|XP_003571271.1| PREDICTED: uncharacterized protein LOC100830635 isoform X1 [Brachypodium 
distachyon]
Length=500

 Score =   196 bits (499),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRRYKRLDLELTNARGHTLKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHEKED  121

Query  581  LKAVVEY  601
            LK+VV +
Sbjct  122  LKSVVSF  128



>gb|KJB57903.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=432

 Score =   194 bits (493),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_007026441.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
 gb|EOY29063.1| Alpha/beta-Hydrolases superfamily protein isoform 3, partial 
[Theobroma cacao]
Length=378

 Score =   192 bits (489),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>gb|ACN85333.1| unknown [Oryza granulata]
Length=502

 Score =   196 bits (497),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R  ALKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQALKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>gb|KHN40755.1| Hypothetical protein glysoja_015122 [Glycine soja]
Length=497

 Score =   195 bits (496),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 95/139 (68%), Positives = 109/139 (78%), Gaps = 12/139 (9%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE------------VKNSRGDA  364
            +EQ +NFIIRPPRAEYDP   L ++EF L G+ YQR+DLE            +KNSRG A
Sbjct  2    IEQFINFIIRPPRAEYDPDQYLWEKEFSLAGRTYQRQDLEANRLSSFFLTLQLKNSRGYA  61

Query  365  LKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGG  544
            LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G
Sbjct  62   LKCSHYLPSRLPEDISLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDG  121

Query  545  EHVTLGWNEKDDLKAVVEY  601
            +HV+LGW+EKDDLK VV +
Sbjct  122  DHVSLGWHEKDDLKMVVSH  140



>gb|KJB57901.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=450

 Score =   194 bits (493),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010647089.1| PREDICTED: uncharacterized protein LOC100242843 [Vitis vinifera]
Length=457

 Score =   194 bits (493),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  L CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWEKDFTLAGRTYKRQDLELTNGRGHTLHCSHYVPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKVVVSH  128



>gb|KJB57895.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=473

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010530100.1| PREDICTED: uncharacterized protein LOC104806750 isoform X6 [Tarenaya 
hassleriana]
Length=377

 Score =   192 bits (487),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_006380855.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58652.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=331

 Score =   191 bits (484),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  227  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  406
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  407  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  586
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  587  AVVEY  601
             VV Y
Sbjct  124  VVVSY  128



>gb|KJB57896.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57900.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
 gb|KJB57902.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=496

 Score =   194 bits (494),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010252924.1| PREDICTED: uncharacterized protein LOC104594357 isoform X1 [Nelumbo 
nucifera]
Length=500

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 89/128 (70%), Positives = 107/128 (84%), Gaps = 1/128 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-VKNSRGDALKCSHYIPIIC  397
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y+R+DLE + N RG  L+CSHY+P   
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEADFTLAGRKYKRQDLEQLVNGRGHTLQCSHYVPSPF  61

Query  398  PEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  577
            PE  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGGE+V+LGW+EKD
Sbjct  62   PEDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGEYVSLGWHEKD  121

Query  578  DLKAVVEY  601
            DLK VV Y
Sbjct  122  DLKVVVSY  129



>ref|XP_001780178.1| predicted protein [Physcomitrella patens]
 gb|EDQ55019.1| predicted protein [Physcomitrella patens]
Length=328

 Score =   190 bits (482),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 90/132 (68%), Positives = 106/132 (80%), Gaps = 5/132 (4%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLE-----VKNSRGDALKCSHYI  385
            MEQLVNF+IRPPRA+Y P  DLL +EF+LK + + RKDL+     +   RG  L+CSHY 
Sbjct  2    MEQLVNFVIRPPRADYSPSFDLLSQEFLLKSRKFTRKDLQAGSLLLSGCRGHVLQCSHYT  61

Query  386  PIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGW  565
            P+   E +PLPCVIYCHGNSGCRADA+EAAI+LLP NITVFTLDFSGSGLS G +V+LGW
Sbjct  62   PLSPLEDEPLPCVIYCHGNSGCRADANEAAIVLLPCNITVFTLDFSGSGLSDGNYVSLGW  121

Query  566  NEKDDLKAVVEY  601
            NEKDDLKAVV +
Sbjct  122  NEKDDLKAVVNH  133



>ref|XP_003563634.1| PREDICTED: uncharacterized protein LOC100831715 [Brachypodium 
distachyon]
Length=497

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELSNERNQTLKCSHYVPSVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>gb|KJB57897.1| hypothetical protein B456_009G185500 [Gossypium raimondii]
Length=524

 Score =   194 bits (494),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P+  L ++EF L G+ ++R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPEQYLWEKEFTLAGRQFKRQDLELTNARGHKLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>gb|AFW70735.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=444

 Score =   193 bits (490),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  581  LKAVV  595
            LK  V
Sbjct  122  LKCAV  126



>ref|XP_006656239.1| PREDICTED: uncharacterized protein LOC102719683 [Oryza brachyantha]
 gb|ACN85318.1| unknown [Oryza brachyantha]
Length=502

 Score =   194 bits (493),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVVP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   ENTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>ref|XP_008644127.1| PREDICTED: hypothetical protein isoform X2 [Zea mays]
Length=471

 Score =   193 bits (491),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  581  LKAVV  595
            LK  V
Sbjct  122  LKCAV  126



>ref|XP_004965908.1| PREDICTED: uncharacterized protein LOC101783766 [Setaria italica]
Length=502

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS GE+V+LGW+EK D
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK  V +
Sbjct  122  LKCAVSF  128



>ref|XP_004514787.1| PREDICTED: uncharacterized protein LOC101501041 isoform X2 [Cicer 
arietinum]
Length=468

 Score =   193 bits (490),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_004951562.1| PREDICTED: uncharacterized protein LOC101776234 [Setaria italica]
Length=503

 Score =   194 bits (492),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 87/125 (70%), Positives = 104/125 (83%), Gaps = 0/125 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EYDP   L D EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYDPDQYLWDTEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILL SNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLSSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  581  LKAVV  595
            LK  V
Sbjct  122  LKCAV  126



>ref|XP_008794704.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
 ref|XP_008794705.1| PREDICTED: uncharacterized protein LOC103710654 [Phoenix dactylifera]
Length=503

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L + EF    + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWESEFSFASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDD
Sbjct  62   ENSTLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ V+ +
Sbjct  122  LRVVISF  128



>ref|XP_004514786.1| PREDICTED: uncharacterized protein LOC101501041 isoform X1 [Cicer 
arietinum]
Length=495

 Score =   193 bits (491),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 88/127 (69%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P   L + EF L G+ YQR+DLE+KN+RG  LKCSHY+P   P
Sbjct  2    IEQFINFVIRPPRADYNPDQYLWEREFSLAGRTYQRQDLELKNARGYTLKCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDF GSGLS G++V+LGW+EKDD
Sbjct  62   EDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFLGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKIVVSH  128



>ref|XP_010530099.1| PREDICTED: uncharacterized protein LOC104806750 isoform X5 [Tarenaya 
hassleriana]
Length=419

 Score =   191 bits (486),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_006857594.1| hypothetical protein AMTR_s00061p00094480 [Amborella trichopoda]
 gb|ERN19061.1| hypothetical protein AMTR_s00061p00094480 [Amborella trichopoda]
Length=509

 Score =   193 bits (491),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRAEY+P   L + +F + G+ Y+R+DLE+ N RG  L+CSHY+P   P
Sbjct  2    IEQFINFVIRPPRAEYNPDQYLWETDFTIAGRKYKRQDLELTNGRGHVLQCSHYVPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+EKDD
Sbjct  62   ENTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFILDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV++
Sbjct  122  LKTVVDF  128



>ref|NP_001170041.1| hypothetical protein [Zea mays]
 gb|ACN35611.1| unknown [Zea mays]
 gb|AFW70736.1| hypothetical protein ZEAMMB73_068292 [Zea mays]
Length=504

 Score =   193 bits (490),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  581  LKAVV  595
            LK  V
Sbjct  122  LKCAV  126



>ref|XP_008644126.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
Length=502

 Score =   193 bits (490),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 86/125 (69%), Positives = 106/125 (85%), Gaps = 0/125 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L ++EF+L G+ Y+R DLE+ N+RG  LKCSHY+P   P
Sbjct  2    IEQFVNFVIRPPRSEYNPDQYLWEKEFILAGRKYKRLDLELTNARGYILKCSHYVPAFIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKED  121

Query  581  LKAVV  595
            LK  V
Sbjct  122  LKCAV  126



>ref|XP_006380856.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
 gb|ERP58653.1| hypothetical protein POPTR_0006s00280g [Populus trichocarpa]
Length=429

 Score =   191 bits (485),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 105/125 (84%), Gaps = 0/125 (0%)
 Frame = +2

Query  227  QLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEG  406
            Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   PE 
Sbjct  4    QFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFPED  63

Query  407  KPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLK  586
             PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DDLK
Sbjct  64   TPLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDDLK  123

Query  587  AVVEY  601
             VV Y
Sbjct  124  VVVSY  128



>ref|XP_008782969.1| PREDICTED: uncharacterized protein LOC103702352 isoform X2 [Phoenix 
dactylifera]
Length=503

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV +
Sbjct  122  LRIVVSF  128



>ref|XP_010530097.1| PREDICTED: uncharacterized protein LOC104806750 isoform X3 [Tarenaya 
hassleriana]
Length=475

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>gb|ACN85219.1| unknown [Oryza punctata]
Length=502

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>gb|ACN85247.1| unknown [Oryza officinalis]
Length=502

 Score =   192 bits (489),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>gb|ACN85260.1| unknown [Oryza alta]
Length=502

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>ref|NP_001118998.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 gb|AEE83855.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=387

 Score =   189 bits (481),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_007026439.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 ref|XP_007026440.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29061.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
 gb|EOY29062.1| Alpha/beta-Hydrolases superfamily protein isoform 1 [Theobroma 
cacao]
Length=492

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 107/127 (84%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L + EF L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEREFTLAGRQYKRQDLELTNARGYMLRCSHYMPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   KETPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>gb|KDP29023.1| hypothetical protein JCGZ_16412 [Jatropha curcas]
Length=493

 Score =   192 bits (488),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L + +F L  + Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWERDFTLASRAYKRQDLELTNARGHTLRCSHYVPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK V+ Y
Sbjct  122  LKVVISY  128



>ref|XP_010530091.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530092.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530094.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010530095.1| PREDICTED: uncharacterized protein LOC104806750 isoform X1 [Tarenaya 
hassleriana]
Length=494

 Score =   192 bits (487),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+HV+LGW+E DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDHVSLGWHESDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_006373549.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 ref|XP_006373550.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51346.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
 gb|ERP51347.1| hypothetical protein POPTR_0016s00300g [Populus trichocarpa]
Length=482

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G+HV+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDHVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>gb|ACN85273.1| unknown [Oryza alta]
Length=502

 Score =   192 bits (487),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWETEFTLAGRKYRRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +    PCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTAFPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKCVVSF  128



>ref|XP_008782966.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782967.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
 ref|XP_008782968.1| PREDICTED: uncharacterized protein LOC103702352 isoform X1 [Phoenix 
dactylifera]
Length=535

 Score =   192 bits (488),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q VNF+IRPPRAEYDP   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFVNFVIRPPRAEYDPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   ENTALPCVVYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV +
Sbjct  122  LRIVVSF  128



>ref|XP_010686591.1| PREDICTED: uncharacterized protein LOC104900779 isoform X4 [Beta 
vulgaris subsp. vulgaris]
Length=415

 Score =   189 bits (481),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV Y
Sbjct  122  LRVVVAY  128



>ref|XP_006350228.1| PREDICTED: uncharacterized protein LOC102589452 isoform X2 [Solanum 
tuberosum]
Length=490

 Score =   191 bits (486),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_006350227.1| PREDICTED: uncharacterized protein LOC102589452 isoform X1 [Solanum 
tuberosum]
Length=492

 Score =   191 bits (486),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_002525239.1| catalytic, putative [Ricinus communis]
 gb|EEF37205.1| catalytic, putative [Ricinus communis]
Length=493

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA Y+P   L + +F L G+ Y+R DLE+ N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAAYNPDQYLWERDFTLAGRAYKRLDLELTNIRGHTLQCSHYVPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_010942494.1| PREDICTED: uncharacterized protein LOC105060476 [Elaeis guineensis]
Length=503

 Score =   191 bits (485),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWESEFTLASRKFKRLDLELTNARGHTLQCSHYVPSDIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG++V+LGW+EKDD
Sbjct  62   EDTALPCVIYCHGNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV +
Sbjct  122  LRIVVSF  128



>ref|XP_010434713.1| PREDICTED: uncharacterized protein LOC104718633 isoform X1 [Camelina 
sativa]
Length=506

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|NP_001058047.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAD35477.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19961.1| Os06g0609700 [Oryza sativa Japonica Group]
 dbj|BAG90325.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC80956.1| hypothetical protein OsI_23672 [Oryza sativa Indica Group]
 gb|EEE66001.1| hypothetical protein OsJ_21943 [Oryza sativa Japonica Group]
 gb|ACN85169.1| unknown [Oryza nivara]
 gb|ACN85186.1| unknown [Oryza rufipogon]
 gb|ACN85202.1| unknown [Oryza glaberrima]
Length=502

 Score =   191 bits (484),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRIDLELTNGRDQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +   LPCVIYCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLSGGE+V+LGW+EK D
Sbjct  62   DNTALPCVIYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSGGEYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK  V +
Sbjct  122  LKCAVSF  128



>ref|XP_010434714.1| PREDICTED: uncharacterized protein LOC104718633 isoform X2 [Camelina 
sativa]
Length=505

 Score =   191 bits (484),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYIPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_009802385.1| PREDICTED: uncharacterized protein LOC104247929 isoform X2 [Nicotiana 
sylvestris]
Length=490

 Score =   190 bits (483),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKVVVSH  128



>ref|XP_008384339.1| PREDICTED: uncharacterized protein LOC103446950 isoform X3 [Malus 
domestica]
Length=456

 Score =   189 bits (481),  Expect = 6e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010440051.1| PREDICTED: uncharacterized protein LOC104723387 isoform X4 [Camelina 
sativa]
Length=475

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_009620526.1| PREDICTED: uncharacterized protein LOC104112345 [Nicotiana tomentosiformis]
Length=490

 Score =   190 bits (482),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IEQFINFVIRPPRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKVVVSH  128



>ref|NP_001172844.1| Os02g0197900 [Oryza sativa Japonica Group]
 dbj|BAH91573.1| Os02g0197900, partial [Oryza sativa Japonica Group]
Length=161

 Score =   181 bits (458),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 80/117 (68%), Positives = 99/117 (85%), Gaps = 0/117 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPR+EY+P   L + EF+L G+ Y+R DLE+ N+RG  +KCSHY+P   P
Sbjct  9    IEQFVNFVIRPPRSEYNPDQYLWETEFILAGRKYKRLDLELTNARGLTIKCSHYVPAFIP  68

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNE  571
            E   LPCVIYCHGNSGCRADA+EAA+ILLP+NITVFTLDFSGSGLSGG++V+LGW+E
Sbjct  69   ENTSLPCVIYCHGNSGCRADANEAAVILLPANITVFTLDFSGSGLSGGDYVSLGWHE  125



>ref|XP_008384338.1| PREDICTED: uncharacterized protein LOC103446950 isoform X2 [Malus 
domestica]
Length=482

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_008384332.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384333.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384335.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384336.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
 ref|XP_008384337.1| PREDICTED: uncharacterized protein LOC103446950 isoform X1 [Malus 
domestica]
Length=483

 Score =   190 bits (482),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010686590.1| PREDICTED: uncharacterized protein LOC104900779 isoform X3 [Beta 
vulgaris subsp. vulgaris]
Length=439

 Score =   189 bits (479),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV Y
Sbjct  122  LRVVVAY  128



>ref|XP_010440049.1| PREDICTED: uncharacterized protein LOC104723387 isoform X2 [Camelina 
sativa]
Length=501

 Score =   190 bits (482),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_007213932.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15131.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=491

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_010440050.1| PREDICTED: uncharacterized protein LOC104723387 isoform X3 [Camelina 
sativa]
Length=500

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_010440048.1| PREDICTED: uncharacterized protein LOC104723387 isoform X1 [Camelina 
sativa]
Length=502

 Score =   190 bits (482),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 103/127 (81%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGNYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_007213931.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
 gb|EMJ15130.1| hypothetical protein PRUPE_ppa004766mg [Prunus persica]
Length=492

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLRCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|NP_193448.2| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
 dbj|BAC43443.1| unknown protein [Arabidopsis thaliana]
 gb|AEE83854.1| alpha/beta-Hydrolases superfamily protein [Arabidopsis thaliana]
Length=502

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKRQDLELTNSRGHTLRCSHYVPSSSR  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_010686588.1| PREDICTED: uncharacterized protein LOC104900779 isoform X1 [Beta 
vulgaris subsp. vulgaris]
Length=478

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ +NF+IRPPRA YDP   L ++EF L G+ Y+R+DLE+++ RG+ LKCSHY+P + P
Sbjct  2    IEQFINFVIRPPRAVYDPDQYLWEKEFTLAGRAYKREDLELESGRGETLKCSHYMPYLNP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EA  +LLP+NITVFTLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   EDSALPCVVYCHGNSGCRADANEAVTVLLPANITVFTLDFSGSGLSEGNYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            L+ VV Y
Sbjct  122  LRVVVAY  128



>ref|XP_011040087.1| PREDICTED: uncharacterized protein LOC105136438 isoform X3 [Populus 
euphratica]
Length=482

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_011040086.1| PREDICTED: uncharacterized protein LOC105136438 isoform X2 [Populus 
euphratica]
Length=493

 Score =   189 bits (480),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_011040085.1| PREDICTED: uncharacterized protein LOC105136438 isoform X1 [Populus 
euphratica]
Length=497

 Score =   189 bits (481),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 106/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVF LDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDTHLPCVIYCHGNSGCRADANEAAVILLPSNITVFALDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>ref|XP_010058007.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC104445782 
[Eucalyptus grandis]
Length=491

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L +++F L G+ Y+R+DLE+ N RG  LKCSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWEKDFTLAGRSYKRQDLELTNKRGHTLKCSHYVPAPLP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNS CRADA+EA +ILLPSNITVFTLDFSGSGLS GE V+LGW+EK+D
Sbjct  62   EETPLPCVIYCHGNSXCRADANEAVVILLPSNITVFTLDFSGSGLSDGEFVSLGWHEKND  121

Query  581  LKAVVEY  601
            L+ VV +
Sbjct  122  LQVVVSH  128



>ref|XP_002870121.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46380.1| hypothetical protein ARALYDRAFT_915007 [Arabidopsis lyrata subsp. 
lyrata]
Length=501

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 86/127 (68%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTECKRQDLELTNSRGHTLRCSHYVPSSSL  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSEGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_008649080.1| PREDICTED: uncharacterized protein LOC103629745 [Zea mays]
Length=501

 Score =   189 bits (480),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            +EQ VNF+IRPPRAEY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + P
Sbjct  2    IEQFVNFVIRPPRAEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK D
Sbjct  62   ENTSLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQD  121

Query  581  LKAVVEY  601
            LK  V +
Sbjct  122  LKCAVSF  128



>ref|XP_004293431.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460084.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460085.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
 ref|XP_011460086.1| PREDICTED: uncharacterized protein LOC101309618 isoform X1 [Fragaria 
vesca subsp. vesca]
Length=488

 Score =   189 bits (479),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_011095854.1| PREDICTED: uncharacterized protein LOC105175196 [Sesamum indicum]
Length=471

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 109/127 (86%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++  +NF+IRPPRA+Y+P + L +++F L G+ Y+R+D+E++N RG  L+CSHY+P   P
Sbjct  2    IDLFINFVIRPPRADYNPDHYLWEKDFTLSGRKYKREDVELRNERGHTLRCSHYVPSEFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  62   DDSPLPCVIYCHGNSGCRADANEAAVVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKND  121

Query  581  LKAVVEY  601
            LKAV+ Y
Sbjct  122  LKAVLSY  128



>ref|XP_011460088.1| PREDICTED: uncharacterized protein LOC101309618 isoform X2 [Fragaria 
vesca subsp. vesca]
Length=487

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRA+Y+P   L + +F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRADYNPDQYLWERDFTLAGRAYKRQDLELTNARGHTLQCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCV+YCHGNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDSSLPCVVYCHGNSGCRADANEAALILLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKIVVSY  128



>ref|XP_010319209.1| PREDICTED: uncharacterized protein LOC101251464 [Solanum lycopersicum]
Length=490

 Score =   188 bits (478),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L ++EF L G+ Y+R+D E+KN RG  L+CSHY P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQFLWEKEFSLGGRKYKREDFELKNERGHTLRCSHYTPSSFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +G PLPCVIYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G +V+LGW+EKDD
Sbjct  62   DGAPLPCVIYCHGNSGCRADANEAAVILLSSNITVVTLDFSGSGLSDGNYVSLGWHEKDD  121

Query  581  LKAVVEY  601
            LK VV +
Sbjct  122  LKVVVSH  128



>ref|XP_010449663.1| PREDICTED: uncharacterized protein LOC104731865 isoform X1 [Camelina 
sativa]
Length=500

 Score =   189 bits (479),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L ++EF L G   +R+DLE+ NSRG  L+CSHY+P    
Sbjct  11   IDQFINFVIRPPRAEYDPDQYLWEKEFSLGGTKCKREDLELTNSRGHTLRCSHYVPSSSQ  70

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  71   DDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  130

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  131  LKTVVSY  137



>ref|XP_008224685.1| PREDICTED: uncharacterized protein LOC103324410 [Prunus mume]
Length=480

 Score =   188 bits (477),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 84/127 (66%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEY+P   L + +F L G+ Y R+DLE+ N+RG  L CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYNPDQYLWERDFTLAGRTYIRQDLELTNARGHTLHCSHYLPSPFP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+E+DD
Sbjct  62   EDASLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGDYVSLGWHERDD  121

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  122  LKVVVSY  128



>gb|KFK32200.1| hypothetical protein AALP_AA6G210300 [Arabis alpina]
Length=493

 Score =   187 bits (475),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 103/127 (81%), Gaps = 2/127 (2%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L D++F L G   QR+DLE+ NSRG  L+CSHYIP    
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWDKDFTLAGTNCQRQDLELTNSRGHTLRCSHYIP--SS  59

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
               PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  60   HTPPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  119

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  120  LKTVVTY  126



>ref|XP_006414266.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
 gb|ESQ55719.1| hypothetical protein EUTSA_v10027147mg [Eutrema salsugineum]
Length=505

 Score =   187 bits (475),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 85/127 (67%), Positives = 104/127 (82%), Gaps = 0/127 (0%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F +     +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGSTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKDD
Sbjct  72   EDNPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKDD  131

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  132  LKTVVSY  138



>ref|XP_004984313.1| PREDICTED: uncharacterized protein LOC101769070 isoform X2 [Setaria 
italica]
Length=545

 Score =   187 bits (475),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 84/100 (84%), Positives = 92/100 (92%), Gaps = 0/100 (0%)
 Frame = +2

Query  302  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  481
            MLKG+W+QRKDLEVKN  G  L+CSHY+P++ PEGK LPCVIYCHGNSGCRADASEAAII
Sbjct  1    MLKGRWFQRKDLEVKNDLGKKLQCSHYMPVVIPEGKALPCVIYCHGNSGCRADASEAAII  60

Query  482  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            LLP+NITVFTLDFSGSGLS GEHVTLGWNEK+DLKAVV Y
Sbjct  61   LLPTNITVFTLDFSGSGLSEGEHVTLGWNEKEDLKAVVNY  100



>ref|XP_002885117.1| hypothetical protein ARALYDRAFT_897893 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH61376.1| hypothetical protein ARALYDRAFT_897893 [Arabidopsis lyrata subsp. 
lyrata]
Length=140

 Score =   176 bits (446),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 100/130 (77%), Gaps = 18/130 (14%)
 Frame = +2

Query  221  MEQLVNFIIRPPR-----------AEYDPKNDLLD--EEFMLKGKWYQRKDLEVKNSRGD  361
            MEQLVNFIIRPPR           AE     +++    EFM++G+WYQRKDLE +     
Sbjct  1    MEQLVNFIIRPPRLSICELTCLCAAELSMTRNMISWKREFMMRGRWYQRKDLERR-----  55

Query  362  ALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSG  541
             L+CSHY+P+  PEGKPLPCVIYCHGNSGCRAD SEAAI+LLPSNITVFTLDFSGSGLSG
Sbjct  56   CLQCSHYMPVERPEGKPLPCVIYCHGNSGCRADGSEAAIVLLPSNITVFTLDFSGSGLSG  115

Query  542  GEHVTLGWNE  571
            GE+VTLGWNE
Sbjct  116  GEYVTLGWNE  125



>ref|XP_009108297.1| PREDICTED: uncharacterized protein LOC103833996 isoform X1 [Brassica 
rapa]
Length=500

 Score =   186 bits (471),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 105/128 (82%), Gaps = 1/128 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F + G   +R+DLE+ NSRG  L+CSHYIP    
Sbjct  12   IDQFINFVIRPPRAEYDPDQYLWEKDFSIGGTKCKRQDLELTNSRGHTLRCSHYIPSSSL  71

Query  401  EGK-PLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKD  577
            E   PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EKD
Sbjct  72   ENTTPLPCVIYCHGNSGCRADANEAAMVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKD  131

Query  578  DLKAVVEY  601
            DLK VV Y
Sbjct  132  DLKTVVSY  139



>gb|KHN14394.1| Hypothetical protein glysoja_012432 [Glycine soja]
Length=494

 Score =   185 bits (470),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/129 (67%), Positives = 102/129 (79%), Gaps = 2/129 (2%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNS--RGDALKCSHYIPII  394
            +EQ +NFIIRPPRA+YDP   L ++EF L G+ YQR+DLE       G  L+CSHY+P  
Sbjct  2    IEQFINFIIRPPRAQYDPDQYLWEKEFTLAGRTYQRQDLEASMDIFLGYTLQCSHYLPSP  61

Query  395  CPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEK  574
             PE   LPCV+YCHGNSGCRADA+EA +ILLPSNITVFTLDFSGSGLS GEHV+LGW+EK
Sbjct  62   LPEDISLPCVVYCHGNSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGEHVSLGWHEK  121

Query  575  DDLKAVVEY  601
            DDLK VV +
Sbjct  122  DDLKMVVSH  130



>gb|EYU27617.1| hypothetical protein MIMGU_mgv1a005188mg [Erythranthe guttata]
Length=494

 Score =   181 bits (460),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 80/127 (63%), Positives = 105/127 (83%), Gaps = 2/127 (2%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DL   N RG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRADYNPDQYLWEKDFTLAGRKYKREDL--TNERGHTLRCSHYVPSQFP  59

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +  PLPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G++V+LGW+EK+D
Sbjct  60   DDSPLPCVIYCHGNSGCRADANEAAVVLLPSNITVFTLDFSGSGLSDGDYVSLGWHEKND  119

Query  581  LKAVVEY  601
            LK V+ +
Sbjct  120  LKVVISH  126



>ref|XP_009374809.1| PREDICTED: uncharacterized protein LOC103963697 [Pyrus x bretschneideri]
Length=491

 Score =   181 bits (459),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 103/127 (81%), Gaps = 1/127 (1%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            + Q +NF+IRPPRAEY+P +  L E F L G+ Y+R+DLE+ N+RG  L+CSHY+P   P
Sbjct  2    IHQFINFVIRPPRAEYNP-DQYLWESFTLAGRAYKRQDLELTNARGHTLRCSHYLPSPFP  60

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            +   LPCVIYCHGNSGCRADA+EAA++LLPSNITVFTLDFSGSGLS G +V+LGW+E+ D
Sbjct  61   DDVSLPCVIYCHGNSGCRADANEAAVMLLPSNITVFTLDFSGSGLSDGNYVSLGWHERYD  120

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  121  LKIVVSY  127



>ref|XP_010911200.1| PREDICTED: uncharacterized protein LOC105037208, partial [Elaeis 
guineensis]
Length=182

 Score =   172 bits (436),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 78/115 (68%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  257  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  436
            RAEY+P   L + EF L  + ++R DLE+ N+RG  L+CSHY+P   PE   LPCVIYCH
Sbjct  5    RAEYNPDQYLWESEFTLASRKFKRLDLELTNTRGHTLQCSHYVPSDVPENMALPCVIYCH  64

Query  437  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            GNSGCRADA+EAA+ILLPSNITVFTLDFSGSGLSGG+HV+LGW+EKDDL+ VV +
Sbjct  65   GNSGCRADANEAAVILLPSNITVFTLDFSGSGLSGGDHVSLGWHEKDDLRIVVSF  119



>gb|EEC72683.1| hypothetical protein OsI_06247 [Oryza sativa Indica Group]
Length=514

 Score =   175 bits (444),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 86/146 (59%), Positives = 106/146 (73%), Gaps = 19/146 (13%)
 Frame = +2

Query  221  MEQLVNFIIRPPR-----------AEYDPKNDLLDEEFMLKGKWYQRKDLE--------V  343
            +EQ VNF+IRPPR           +EY+P   L + EF+L G+ Y+R DLE        +
Sbjct  2    IEQFVNFVIRPPRYPHSVALVCLWSEYNPDQYLWETEFILAGRKYKRLDLEATLFCLYQL  61

Query  344  KNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFS  523
             N+RG  +KCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLP+NITVFTLDFS
Sbjct  62   TNARGLTIKCSHYVPAFIPENTSLPCVIYCHGNSGCRADANEAAVILLPANITVFTLDFS  121

Query  524  GSGLSGGEHVTLGWNEKDDLKAVVEY  601
            GSGLSGG++V+LG +EK+DLK VV Y
Sbjct  122  GSGLSGGDYVSLGCHEKEDLKCVVSY  147



>gb|EYU45603.1| hypothetical protein MIMGU_mgv1a0037051mg, partial [Erythranthe 
guttata]
Length=529

 Score =   174 bits (440),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 77/87 (89%), Positives = 82/87 (94%), Gaps = 0/87 (0%)
 Frame = +2

Query  341  VKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDF  520
            + N RGD L+CSHY+PIICP+G PLPCVIYCHGNSGCR DASEAAIILLPSNITVFTLDF
Sbjct  1    IVNVRGDTLQCSHYVPIICPDGNPLPCVIYCHGNSGCRTDASEAAIILLPSNITVFTLDF  60

Query  521  SGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            SGSGLSGGEHVTLGWNEKDDLKAVV+Y
Sbjct  61   SGSGLSGGEHVTLGWNEKDDLKAVVDY  87



>ref|XP_010530096.1| PREDICTED: uncharacterized protein LOC104806750 isoform X2 [Tarenaya 
hassleriana]
Length=487

 Score =   172 bits (437),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 81/127 (64%), Positives = 97/127 (76%), Gaps = 7/127 (6%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRAEYDP   L +++F L G   +R+DLE+ NSRG  L+CSHY+P   P
Sbjct  2    IDQFINFVIRPPRAEYDPDQYLWEKDFRLGGTQCRRQDLELTNSRGHTLRCSHYMPSSSP  61

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
            E  PLPCVIYCHGNSGCRADA+EA ++LLPSNITVFTLDFSGSGLS G+H        DD
Sbjct  62   EDTPLPCVIYCHGNSGCRADANEAVMVLLPSNITVFTLDFSGSGLSDGDH-------SDD  114

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  115  LKIVVSY  121



>ref|XP_009802386.1| PREDICTED: uncharacterized protein LOC104247929 isoform X3 [Nicotiana 
sylvestris]
Length=488

 Score =   168 bits (425),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 78/119 (66%), Positives = 97/119 (82%), Gaps = 2/119 (2%)
 Frame = +2

Query  251  PP--RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCV  424
            PP  RA+Y+P+  L ++EF + G+ Y+R+D E+KN RG  L+CSHY P   P+G PLPCV
Sbjct  8    PPLSRADYNPEQFLWEKEFSVGGRKYKREDFELKNERGHTLQCSHYTPSSFPDGAPLPCV  67

Query  425  IYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            IYCHGNSGCRADA+EAA+ILL SNITV TLDFSGSGLS G++V+LGW+EKDDLK VV +
Sbjct  68   IYCHGNSGCRADANEAAVILLSSNITVLTLDFSGSGLSDGDYVSLGWHEKDDLKVVVSH  126



>ref|XP_002438665.1| hypothetical protein SORBIDRAFT_10g023905 [Sorghum bicolor]
 gb|EER90032.1| hypothetical protein SORBIDRAFT_10g023905 [Sorghum bicolor]
Length=501

 Score =   165 bits (418),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 0/115 (0%)
 Frame = +2

Query  257  RAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCH  436
            R EY+P   L + EF L G+ Y+R DLE+ N R   LKCSHY+P + PE   LPCV+YCH
Sbjct  11   RLEYNPDQYLWEPEFTLAGRKYKRLDLELTNERSQTLKCSHYVPAVIPENTALPCVVYCH  70

Query  437  GNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            GNSGCRADA+EAA+ILLPSNIT+FTLDF+GSGLS G++V+LGW+EK DLK  V +
Sbjct  71   GNSGCRADANEAAVILLPSNITLFTLDFAGSGLSSGDYVSLGWHEKQDLKCAVSF  125



>emb|CDP04561.1| unnamed protein product [Coffea canephora]
Length=468

 Score =   161 bits (407),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 74/127 (58%), Positives = 95/127 (75%), Gaps = 19/127 (15%)
 Frame = +2

Query  221  MEQLVNFIIRPPRAEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICP  400
            ++Q +NF+IRPPRA+Y+P   L +++F L G+ Y+R+DLE                    
Sbjct  2    IDQFINFVIRPPRAQYNPDQYLWEKDFTLAGRKYKRQDLEA-------------------  42

Query  401  EGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDD  580
             G PLPCV+YCHGNSGCRADA+EAA+ILLPSNIT+FTLDFSGSGLSGG++V+LGW+EK+D
Sbjct  43   NGTPLPCVVYCHGNSGCRADANEAAVILLPSNITLFTLDFSGSGLSGGDYVSLGWHEKND  102

Query  581  LKAVVEY  601
            LK VV Y
Sbjct  103  LKVVVSY  109



>dbj|BAK06433.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=475

 Score =   157 bits (398),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 70/100 (70%), Positives = 84/100 (84%), Gaps = 0/100 (0%)
 Frame = +2

Query  302  MLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAII  481
            ML G+ Y+R DLE+ N+RG  LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA++
Sbjct  1    MLAGRRYKRIDLELTNARGHTLKCSHYLPAFVPENIALPCVIYCHGNSGCRADANEAAVV  60

Query  482  LLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            LLPSNITVFTLDFSGSGLS G++V+LGW+EK+DLK  V +
Sbjct  61   LLPSNITVFTLDFSGSGLSDGDYVSLGWHEKEDLKCAVSF  100



>ref|XP_006586806.1| PREDICTED: uncharacterized protein LOC100787162 isoform X3 [Glycine 
max]
Length=481

 Score =   152 bits (385),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 76/114 (67%), Positives = 86/114 (75%), Gaps = 5/114 (4%)
 Frame = +2

Query  260  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  439
            + Y  +N  L EE      W Q     +KNSRG ALKCSHY+P   PE   LPCVIYCHG
Sbjct  5    STYGKRNSPLQEEHTKGRIWRQ-----LKNSRGYALKCSHYLPSRLPEDISLPCVIYCHG  59

Query  440  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            NSGCRADA+EAA+ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDDLK VV +
Sbjct  60   NSGCRADANEAAVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDDLKMVVSH  113



>emb|CAN66506.1| hypothetical protein VITISV_035499 [Vitis vinifera]
Length=595

 Score =   150 bits (380),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 77/145 (53%), Positives = 95/145 (66%), Gaps = 30/145 (21%)
 Frame = +2

Query  257  RAEYDPKNDLLDEEFMLKGKWYQRKDLE-----------VKNSRGDALKCSHYIPIICPE  403
            +AEY+P   L +++F L G+ Y+R+DLE           + N RG  L CSHY+P   PE
Sbjct  12   QAEYNPDQYLWEKDFTLAGRTYKRQDLEASMDNSYQNFTLTNGRGHTLHCSHYVPSPFPE  71

Query  404  GKPLPCVIYCHGN-------------------SGCRADASEAAIILLPSNITVFTLDFSG  526
              PLPCVIYCHGN                   SGCRADA+EAA+ILLPSNITVFTLDFSG
Sbjct  72   DTPLPCVIYCHGNRVLRMREFRIDSFGSCGQYSGCRADANEAAVILLPSNITVFTLDFSG  131

Query  527  SGLSGGEHVTLGWNEKDDLKAVVEY  601
            SGLS G++V+LGW+E+DDLK VV +
Sbjct  132  SGLSDGDYVSLGWHERDDLKVVVSH  156



>ref|XP_010096514.1| hypothetical protein L484_017966 [Morus notabilis]
 gb|EXB64634.1| hypothetical protein L484_017966 [Morus notabilis]
Length=671

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  338  EVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLD  517
            E++NSRG  L+CSHY+P   PE  PLPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLD
Sbjct  222  ELRNSRGHVLRCSHYVPSQFPEDSPLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLD  281

Query  518  FSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            FSGSGLS G++V+LGW+EKDDLK V+ +
Sbjct  282  FSGSGLSDGDYVSLGWHEKDDLKTVISH  309



>ref|XP_011090822.1| PREDICTED: uncharacterized protein LOC105171411 isoform X7 [Sesamum 
indicum]
Length=561

 Score =   148 bits (374),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 67/73 (92%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +2

Query  383  IPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLG  562
            +PIICPEG  LPCVIYCHGNSGCR DASEAA+ILLPSNITVFTLDFSGSGLSGGEHVTLG
Sbjct  1    MPIICPEGTKLPCVIYCHGNSGCRTDASEAAVILLPSNITVFTLDFSGSGLSGGEHVTLG  60

Query  563  WNEKDDLKAVVEY  601
            WNEKDDLKAVV+Y
Sbjct  61   WNEKDDLKAVVDY  73



>ref|XP_006597635.1| PREDICTED: uncharacterized protein LOC100778204 isoform X4 [Glycine 
max]
Length=477

 Score =   147 bits (370),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 72/114 (63%), Positives = 84/114 (74%), Gaps = 5/114 (4%)
 Frame = +2

Query  260  AEYDPKNDLLDEEFMLKGKWYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHG  439
            + Y  +N  L EE      W Q     +KNSRG  L+CSHY+P   PE   LPCV+YCHG
Sbjct  5    STYGKRNSPLQEEHTKGRIWRQ-----LKNSRGYTLQCSHYLPSPLPEDISLPCVVYCHG  59

Query  440  NSGCRADASEAAIILLPSNITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            NSGCRADA+EA +ILLPSNITVFTLDFSGSGLS G+HV+LGW+EKDDLK VV +
Sbjct  60   NSGCRADANEAVVILLPSNITVFTLDFSGSGLSDGDHVSLGWHEKDDLKMVVSH  113



>gb|KHN40219.1| Hypothetical protein glysoja_038414 [Glycine soja]
Length=471

 Score =   146 bits (369),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 67/88 (76%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  338  EVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSNITVFTLD  517
            ++KN+RG  LKCSHY+P   PE   LPCVIYCHGNSGCRADA+EAA+ILLPSNITVFTLD
Sbjct  33   QLKNTRGYTLKCSHYLPSPFPEDTSLPCVIYCHGNSGCRADANEAAVILLPSNITVFTLD  92

Query  518  FSGSGLSGGEHVTLGWNEKDDLKAVVEY  601
            FSGSGLS G++V+LGW+EKDDLK VV Y
Sbjct  93   FSGSGLSDGDYVSLGWHEKDDLKMVVSY  120



>ref|XP_002451724.1| hypothetical protein SORBIDRAFT_04g006660 [Sorghum bicolor]
 gb|EES04700.1| hypothetical protein SORBIDRAFT_04g006660 [Sorghum bicolor]
Length=491

 Score =   146 bits (369),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +2

Query  317  WYQRKDLEVKNSRGDALKCSHYIPIICPEGKPLPCVIYCHGNSGCRADASEAAIILLPSN  496
            W+Q   + + N+RG  LKCSHY+P   PE   LPCV+YCHGNSGCRADA+EAA+ILLPSN
Sbjct  22   WFQIVCMMLTNARGYILKCSHYVPAFIPENTALPCVVYCHGNSGCRADANEAAVILLPSN  81

Query  497  ITVFTLDFSGSGLSGGEHVTLGWNEKDDLKAVV  595
            ITVFTLDFSGSGLSGG++V+LGW+EK+DLK  V
Sbjct  82   ITVFTLDFSGSGLSGGDYVSLGWHEKEDLKCAV  114



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940