BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A20

Length=564
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|EYU41945.1|  hypothetical protein MIMGU_mgv1a012043mg                331   1e-111   Erythranthe guttata [common monkey flower]
ref|XP_010553233.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    331   2e-111   Tarenaya hassleriana [spider flower]
ref|XP_011084586.1|  PREDICTED: 40S ribosomal protein S4                331   2e-111   Sesamum indicum [beniseed]
ref|XP_009368564.1|  PREDICTED: 40S ribosomal protein S4-3-like         330   2e-111   Pyrus x bretschneideri [bai li]
ref|XP_008233807.1|  PREDICTED: 40S ribosomal protein S4-1              330   2e-111   Prunus mume [ume]
ref|XP_011097305.1|  PREDICTED: 40S ribosomal protein S4-like           330   2e-111   Sesamum indicum [beniseed]
ref|XP_007156130.1|  hypothetical protein PHAVU_003G261200g             330   4e-111   Phaseolus vulgaris [French bean]
gb|KCW60004.1|  hypothetical protein EUGRSUZ_H02737                     328   6e-111   Eucalyptus grandis [rose gum]
ref|XP_010529053.1|  PREDICTED: 40S ribosomal protein S4-3-like         329   6e-111   Tarenaya hassleriana [spider flower]
ref|XP_007218753.1|  hypothetical protein PRUPE_ppa009337mg             330   6e-111   
ref|XP_002275063.1|  PREDICTED: 40S ribosomal protein S4                329   7e-111   Vitis vinifera
ref|XP_007211867.1|  hypothetical protein PRUPE_ppa010094mg             329   7e-111   Prunus persica
ref|XP_006488578.1|  PREDICTED: 40S ribosomal protein S4-like           329   7e-111   Citrus sinensis [apfelsine]
ref|XP_008383247.1|  PREDICTED: 40S ribosomal protein S4                329   7e-111   Malus domestica [apple tree]
dbj|BAE20168.1|  ribosomal protein S4                                   329   7e-111   Panax ginseng [Asiatic ginseng]
gb|AGZ15374.1|  40S ribosomal S4 protein                                329   1e-110   Phaseolus vulgaris [French bean]
ref|XP_009369212.1|  PREDICTED: 40S ribosomal protein S4-3              328   1e-110   Pyrus x bretschneideri [bai li]
ref|NP_001235428.1|  uncharacterized protein LOC100500000               326   1e-110   
gb|EYU19705.1|  hypothetical protein MIMGU_mgv1a012053mg                328   1e-110   Erythranthe guttata [common monkey flower]
ref|XP_010529903.1|  PREDICTED: 40S ribosomal protein S4-3-like         328   1e-110   Tarenaya hassleriana [spider flower]
gb|KDP45131.1|  hypothetical protein JCGZ_17463                         328   1e-110   Jatropha curcas
ref|XP_010553232.1|  PREDICTED: 40S ribosomal protein S4-3 isofor...    328   2e-110   Tarenaya hassleriana [spider flower]
gb|KDP30648.1|  hypothetical protein JCGZ_16213                         328   2e-110   Jatropha curcas
ref|XP_003516980.1|  PREDICTED: 40S ribosomal protein S4                328   2e-110   Glycine max [soybeans]
ref|XP_006576176.1|  PREDICTED: uncharacterized protein LOC100500...    328   2e-110   
gb|KHN48586.1|  40S ribosomal protein S4-2                              328   2e-110   Glycine soja [wild soybean]
ref|XP_003604568.1|  40S ribosomal protein S4                           328   2e-110   Medicago truncatula
ref|XP_003544057.1|  PREDICTED: 40S ribosomal protein S4-1              328   3e-110   Glycine max [soybeans]
ref|XP_006429477.1|  hypothetical protein CICLE_v10012499mg             327   3e-110   Citrus clementina [clementine]
ref|XP_008234249.1|  PREDICTED: 40S ribosomal protein S4                327   4e-110   Prunus mume [ume]
ref|XP_010934423.1|  PREDICTED: 40S ribosomal protein S4-3-like         327   4e-110   Elaeis guineensis
ref|XP_007205728.1|  hypothetical protein PRUPE_ppa010072mg             327   4e-110   Prunus persica
ref|XP_002268192.1|  PREDICTED: 40S ribosomal protein S4-3-like         327   6e-110   Vitis vinifera
ref|XP_002884052.1|  40S ribosomal protein S4                           327   7e-110   Arabidopsis lyrata subsp. lyrata
gb|KGN44410.1|  hypothetical protein Csa_7G281390                       327   7e-110   Cucumis sativus [cucumbers]
ref|XP_006409322.1|  hypothetical protein EUTSA_v10022813mg             327   7e-110   Eutrema salsugineum [saltwater cress]
ref|NP_001235826.1|  40S ribosomal S4 protein                           327   7e-110   Glycine max [soybeans]
ref|XP_004150395.1|  PREDICTED: 40S ribosomal protein S4-like           327   7e-110   
ref|XP_003547932.1|  PREDICTED: 40S ribosomal protein S4-1              327   7e-110   Glycine max [soybeans]
ref|XP_010243078.1|  PREDICTED: 40S ribosomal protein S4-3-like         327   8e-110   Nelumbo nucifera [Indian lotus]
ref|XP_010023674.1|  PREDICTED: 40S ribosomal protein S4-3              327   8e-110   Eucalyptus grandis [rose gum]
ref|XP_004294780.1|  PREDICTED: 40S ribosomal protein S4-3              327   9e-110   Fragaria vesca subsp. vesca
ref|XP_002871248.1|  40S ribosomal protein S4                           326   9e-110   Arabidopsis lyrata subsp. lyrata
ref|XP_002512717.1|  40S ribosomal protein S4, putative                 326   1e-109   Ricinus communis
ref|XP_002515668.1|  40S ribosomal protein S4, putative                 326   1e-109   Ricinus communis
ref|XP_010907826.1|  PREDICTED: 40S ribosomal protein S4-3-like         326   1e-109   Elaeis guineensis
ref|XP_004163526.1|  PREDICTED: 40S ribosomal protein S4-like           326   1e-109   
ref|XP_008454823.1|  PREDICTED: 40S ribosomal protein S4-3              326   1e-109   Cucumis melo [Oriental melon]
ref|XP_002276986.1|  PREDICTED: 40S ribosomal protein S4-1              326   1e-109   Vitis vinifera
ref|XP_009766580.1|  PREDICTED: 40S ribosomal protein S4                326   1e-109   Nicotiana sylvestris
ref|XP_009393217.1|  PREDICTED: 40S ribosomal protein S4-1-like         326   1e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010453688.1|  PREDICTED: 40S ribosomal protein S4-3-like         326   1e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010676809.1|  PREDICTED: 40S ribosomal protein S4-1-like         326   1e-109   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006399188.1|  hypothetical protein EUTSA_v10014417mg             325   2e-109   Eutrema salsugineum [saltwater cress]
ref|XP_002864574.1|  40S ribosomal protein S4                           325   2e-109   Arabidopsis lyrata subsp. lyrata
ref|XP_003623356.1|  40S ribosomal protein S4                           326   2e-109   Medicago truncatula
ref|NP_200650.1|  40S ribosomal protein S4-3                            325   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001189539.1|  40S ribosomal protein S4-1                         323   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006851828.1|  hypothetical protein AMTR_s00041p00058440          326   2e-109   
ref|NP_568179.1|  40S ribosomal protein S4-2                            325   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565414.1|  40S ribosomal protein S4-1                            325   2e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006298349.1|  hypothetical protein CARUB_v10014418mg             325   2e-109   Capsella rubella
ref|XP_006288484.1|  hypothetical protein CARUB_v10001743mg             325   2e-109   Capsella rubella
ref|XP_010491309.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   2e-109   Camelina sativa [gold-of-pleasure]
ref|XP_010515129.1|  PREDICTED: 40S ribosomal protein S4-1              325   2e-109   Camelina sativa [gold-of-pleasure]
gb|ACU24295.1|  unknown                                                 325   2e-109   Glycine max [soybeans]
ref|XP_006280972.1|  hypothetical protein CARUB_v10026972mg             325   2e-109   Capsella rubella
ref|XP_009391002.1|  PREDICTED: 40S ribosomal protein S4-3              325   2e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240421.1|  PREDICTED: 40S ribosomal protein S4                325   3e-109   Solanum lycopersicum
ref|XP_009385022.1|  PREDICTED: 40S ribosomal protein S4-1-like         325   3e-109   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009369565.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   3e-109   Pyrus x bretschneideri [bai li]
ref|XP_010036744.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   3e-109   Eucalyptus grandis [rose gum]
ref|XP_010938423.1|  PREDICTED: 40S ribosomal protein S4-3              325   3e-109   Elaeis guineensis
ref|XP_010423256.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   3e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004150397.1|  PREDICTED: 40S ribosomal protein S4-like           325   4e-109   Cucumis sativus [cucumbers]
ref|XP_004307685.1|  PREDICTED: 40S ribosomal protein S4-like           325   4e-109   Fragaria vesca subsp. vesca
ref|XP_008461463.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   4e-109   Cucumis melo [Oriental melon]
ref|NP_001275093.1|  40S ribosomal protein S4-like                      325   4e-109   Solanum tuberosum [potatoes]
ref|XP_006344073.1|  PREDICTED: 40S ribosomal protein S4-like           325   4e-109   
ref|XP_004492491.1|  PREDICTED: 40S ribosomal protein S4-2-like         325   4e-109   Cicer arietinum [garbanzo]
ref|XP_010037684.1|  PREDICTED: 40S ribosomal protein S4-3-like         325   5e-109   Eucalyptus grandis [rose gum]
ref|NP_001275148.1|  40S ribosomal protein S4                           325   5e-109   Solanum tuberosum [potatoes]
ref|XP_010443578.1|  PREDICTED: 40S ribosomal protein S4-3-like i...    325   5e-109   
ref|XP_010276734.1|  PREDICTED: 40S ribosomal protein S4-3              325   6e-109   Nelumbo nucifera [Indian lotus]
ref|XP_004293830.1|  PREDICTED: 40S ribosomal protein S4-3              324   6e-109   Fragaria vesca subsp. vesca
gb|AAL49933.1|  AT5g58420/mqj2_10                                       324   6e-109   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009597091.1|  PREDICTED: 40S ribosomal protein S4-like           324   6e-109   Nicotiana tomentosiformis
ref|XP_010483440.1|  PREDICTED: 40S ribosomal protein S4-3-like         324   7e-109   Camelina sativa [gold-of-pleasure]
ref|XP_004511996.1|  PREDICTED: 40S ribosomal protein S4-1-like         324   7e-109   Cicer arietinum [garbanzo]
ref|XP_009354210.1|  PREDICTED: 40S ribosomal protein S4-3-like         324   8e-109   Pyrus x bretschneideri [bai li]
emb|CDY60025.1|  BnaAnng16450D                                          325   8e-109   Brassica napus [oilseed rape]
ref|XP_004491013.1|  PREDICTED: 40S ribosomal protein S4-2-like         324   9e-109   Cicer arietinum [garbanzo]
ref|XP_002308235.1|  hypothetical protein POPTR_0006s10460g             324   9e-109   Populus trichocarpa [western balsam poplar]
ref|XP_009784493.1|  PREDICTED: 40S ribosomal protein S4-like           324   1e-108   Nicotiana sylvestris
ref|XP_010243101.1|  PREDICTED: 40S ribosomal protein S4-3-like         324   1e-108   Nelumbo nucifera [Indian lotus]
ref|XP_006374217.1|  40S ribosomal protein S4                           323   1e-108   Populus trichocarpa [western balsam poplar]
gb|ABK92450.1|  unknown                                                 323   1e-108   Populus trichocarpa [western balsam poplar]
ref|XP_010517120.1|  PREDICTED: 40S ribosomal protein S4-3-like         323   1e-108   Camelina sativa [gold-of-pleasure]
ref|XP_011046821.1|  PREDICTED: 40S ribosomal protein S4-3              323   1e-108   Populus euphratica
ref|XP_002463552.1|  hypothetical protein SORBIDRAFT_01g001850          323   1e-108   Sorghum bicolor [broomcorn]
ref|XP_011035547.1|  PREDICTED: 40S ribosomal protein S4-1              323   1e-108   Populus euphratica
ref|NP_001266498.1|  40S ribosomal protein S4                           323   1e-108   Zea mays [maize]
ref|XP_008461503.1|  PREDICTED: 40S ribosomal protein S4-3-like         323   1e-108   Cucumis melo [Oriental melon]
ref|XP_006352980.1|  PREDICTED: 40S ribosomal protein S4-like           323   1e-108   Solanum tuberosum [potatoes]
ref|XP_004233134.1|  PREDICTED: 40S ribosomal protein S4-like           323   1e-108   Solanum lycopersicum
ref|XP_009600336.1|  PREDICTED: 40S ribosomal protein S4                323   1e-108   Nicotiana tomentosiformis
ref|XP_009402521.1|  PREDICTED: 40S ribosomal protein S4-3-like         323   1e-108   Musa acuminata subsp. malaccensis [pisang utan]
gb|EPS63485.1|  hypothetical protein M569_11297                         323   2e-108   Genlisea aurea
ref|XP_002323021.2|  hypothetical protein POPTR_0016s13210g             323   2e-108   Populus trichocarpa [western balsam poplar]
ref|XP_004233133.1|  PREDICTED: 40S ribosomal protein S4-like           323   2e-108   Solanum lycopersicum
dbj|BAB11167.1|  40S ribosomal protein S4                               323   2e-108   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008789926.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    323   2e-108   
emb|CDY32986.1|  BnaA10g11920D                                          324   2e-108   Brassica napus [oilseed rape]
gb|KHN38535.1|  40S ribosomal protein S4-1                              323   2e-108   Glycine soja [wild soybean]
ref|XP_009120350.1|  PREDICTED: 40S ribosomal protein S4-1              323   2e-108   Brassica rapa
gb|ACU24626.1|  unknown                                                 323   2e-108   Glycine max [soybeans]
ref|XP_010316939.1|  PREDICTED: 40S ribosomal protein S4-like           323   3e-108   Solanum lycopersicum
ref|XP_009794044.1|  PREDICTED: 40S ribosomal protein S4-like           323   3e-108   Nicotiana sylvestris
gb|KDO67004.1|  hypothetical protein CISIN_1g024108mg                   323   3e-108   Citrus sinensis [apfelsine]
emb|CDY57385.1|  BnaCnng31910D                                          323   4e-108   Brassica napus [oilseed rape]
ref|XP_003611879.1|  40S ribosomal protein S4                           322   4e-108   Medicago truncatula
ref|XP_002455614.1|  hypothetical protein SORBIDRAFT_03g014380          322   4e-108   Sorghum bicolor [broomcorn]
ref|XP_010666843.1|  PREDICTED: 40S ribosomal protein S4-1              322   4e-108   
gb|ACV70143.1|  putative 40S ribosomal protein S4                       322   4e-108   Jatropha curcas
emb|CDY05015.1|  BnaAnng01970D                                          323   5e-108   
ref|XP_008356229.1|  PREDICTED: 40S ribosomal protein S4-3-like         322   5e-108   
emb|CDY14056.1|  BnaC02g01730D                                          323   5e-108   Brassica napus [oilseed rape]
ref|XP_009609731.1|  PREDICTED: 40S ribosomal protein S4-like           322   5e-108   Nicotiana tomentosiformis
ref|XP_009381027.1|  PREDICTED: 40S ribosomal protein S4-like           322   6e-108   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010685909.1|  PREDICTED: 40S ribosomal protein S4-1              322   6e-108   Beta vulgaris subsp. vulgaris [field beet]
gb|EPS70681.1|  hypothetical protein M569_04077                         321   7e-108   Genlisea aurea
ref|XP_006411034.1|  hypothetical protein EUTSA_v10017036mg             322   7e-108   
ref|XP_009132054.1|  PREDICTED: 40S ribosomal protein S4-2-like         322   8e-108   Brassica rapa
ref|XP_004962295.1|  PREDICTED: 40S ribosomal protein S4-like           321   8e-108   Setaria italica
ref|XP_007141735.1|  hypothetical protein PHAVU_008G221000g             321   1e-107   Phaseolus vulgaris [French bean]
ref|XP_006401084.1|  hypothetical protein EUTSA_v10014163mg             323   1e-107   
ref|XP_006352979.1|  PREDICTED: 40S ribosomal protein S4-like           321   1e-107   Solanum tuberosum [potatoes]
ref|XP_009595443.1|  PREDICTED: 40S ribosomal protein S4-like           321   1e-107   Nicotiana tomentosiformis
ref|XP_008789925.1|  PREDICTED: 40S ribosomal protein S4-1 isofor...    323   1e-107   Phoenix dactylifera
ref|XP_002322175.1|  hypothetical protein POPTR_0015s09110g             321   2e-107   Populus trichocarpa [western balsam poplar]
ref|XP_009125675.1|  PREDICTED: 40S ribosomal protein S4-1              320   2e-107   Brassica rapa
gb|AAS48726.1|  ribosomal protein S4                                    321   2e-107   Zea mays [maize]
gb|KFK36724.1|  hypothetical protein AALP_AA4G161500                    320   2e-107   Arabis alpina [alpine rockcress]
ref|XP_006645886.1|  PREDICTED: 40S ribosomal protein S4-like           321   2e-107   
ref|XP_011019071.1|  PREDICTED: 40S ribosomal protein S4-3-like         320   2e-107   Populus euphratica
ref|XP_011046165.1|  PREDICTED: 40S ribosomal protein S4-2-like         320   3e-107   Populus euphratica
ref|NP_001043015.1|  Os01g0358400                                       320   3e-107   
ref|NP_001242281.1|  uncharacterized protein LOC100812132               320   3e-107   Glycine max [soybeans]
ref|XP_002439678.1|  hypothetical protein SORBIDRAFT_09g018320          320   4e-107   Sorghum bicolor [broomcorn]
ref|XP_006646768.1|  PREDICTED: 40S ribosomal protein S4-like           319   5e-107   Oryza brachyantha
gb|KHN00473.1|  40S ribosomal protein S4-1                              320   5e-107   Glycine soja [wild soybean]
ref|XP_002318967.2|  hypothetical protein POPTR_0013s01230g             319   6e-107   Populus trichocarpa [western balsam poplar]
emb|CDY69841.1|  BnaAnng31720D                                          321   8e-107   Brassica napus [oilseed rape]
ref|NP_001045624.1|  Os02g0105900                                       319   9e-107   
gb|KFK25102.1|  hypothetical protein AALP_AA8G066400                    319   9e-107   Arabis alpina [alpine rockcress]
ref|XP_004960263.1|  PREDICTED: 40S ribosomal protein S4-like           319   1e-106   Setaria italica
gb|KFK27370.1|  hypothetical protein AALP_AA8G374100                    318   1e-106   Arabis alpina [alpine rockcress]
ref|XP_009122377.1|  PREDICTED: 40S ribosomal protein S4-1              318   1e-106   Brassica rapa
ref|XP_006644163.1|  PREDICTED: 40S ribosomal protein S4-like           318   1e-106   Oryza brachyantha
emb|CDX99006.1|  BnaC09g48290D                                          319   1e-106   
ref|XP_011023749.1|  PREDICTED: 40S ribosomal protein S4-2-like         318   2e-106   Populus euphratica
ref|XP_007050962.1|  Ribosomal protein S4 (RPS4A) family protein        318   2e-106   Theobroma cacao [chocolate]
gb|KHG30713.1|  40S ribosomal S4                                        318   2e-106   Gossypium arboreum [tree cotton]
ref|XP_007026596.1|  Ribosomal protein S4 (RPS4A) family protein        318   2e-106   
ref|NP_001288485.1|  40S ribosomal protein S4-like                      318   2e-106   Zea mays [maize]
ref|NP_001055342.1|  Os05g0368300                                       317   5e-106   
gb|KJB71672.1|  hypothetical protein B456_011G136800                    317   5e-106   Gossypium raimondii
gb|KHG26321.1|  40S ribosomal S4                                        317   5e-106   Gossypium arboreum [tree cotton]
gb|KHG02126.1|  40S ribosomal S4                                        317   6e-106   Gossypium arboreum [tree cotton]
dbj|BAJ94984.1|  predicted protein                                      317   7e-106   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDX81032.1|  BnaC03g02860D                                          317   8e-106   
emb|CDX70008.1|  BnaA10g23570D                                          317   9e-106   
gb|KJB37999.1|  hypothetical protein B456_006G231800                    316   1e-105   Gossypium raimondii
ref|XP_009130977.1|  PREDICTED: 40S ribosomal protein S4-1-like         315   2e-105   
ref|XP_010087529.1|  40S ribosomal protein S4                           317   2e-105   
gb|KHG02041.1|  40S ribosomal S4                                        315   2e-105   Gossypium arboreum [tree cotton]
emb|CDY58877.1|  BnaA03g55550D                                          315   4e-105   Brassica napus [oilseed rape]
gb|EAY97774.1|  hypothetical protein OsI_19685                          315   6e-105   Oryza sativa Indica Group [Indian rice]
sp|P46299.1|RS4_GOSHI  RecName: Full=40S ribosomal protein S4           313   1e-104   Gossypium hirsutum [American cotton]
emb|CDY02821.1|  BnaC02g10680D                                          313   2e-104   
ref|XP_003568916.1|  PREDICTED: 40S ribosomal protein S4                313   2e-104   Brachypodium distachyon [annual false brome]
dbj|BAD22763.1|  ribosomal protein                                      312   3e-104   Bromus inermis [awnless brome grass]
gb|KJB29915.1|  hypothetical protein B456_005G123400                    310   2e-103   Gossypium raimondii
gb|EEE63465.1|  hypothetical protein OsJ_18278                          315   3e-103   Oryza sativa Japonica Group [Japonica rice]
emb|CDY32700.1|  BnaA02g07620D                                          311   4e-103   Brassica napus [oilseed rape]
gb|KHG30303.1|  40S ribosomal S4                                        309   5e-103   Gossypium arboreum [tree cotton]
ref|XP_009781828.1|  PREDICTED: 40S ribosomal protein S4-like           305   1e-101   Nicotiana sylvestris
gb|EMT14698.1|  40S ribosomal protein S4                                305   2e-101   
ref|XP_009126753.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    306   3e-101   
gb|ABK21170.1|  unknown                                                 302   3e-100   Picea sitchensis
gb|ABK22322.1|  unknown                                                 302   4e-100   Picea sitchensis
sp|O81363.1|RS4_PRUAR  RecName: Full=40S ribosomal protein S4           297   3e-98    Prunus armeniaca
gb|KDO67006.1|  hypothetical protein CISIN_1g024108mg                   291   3e-96    Citrus sinensis [apfelsine]
emb|CBI15899.3|  unnamed protein product                                291   3e-96    Vitis vinifera
emb|CDP06439.1|  unnamed protein product                                291   4e-96    Coffea canephora [robusta coffee]
gb|KHN03095.1|  40S ribosomal protein S4                                291   6e-96    Glycine soja [wild soybean]
ref|XP_008778562.1|  PREDICTED: 40S ribosomal protein S4-3-like         290   9e-96    Phoenix dactylifera
gb|KDO63242.1|  hypothetical protein CISIN_1g023289mg                   290   1e-95    Citrus sinensis [apfelsine]
ref|XP_001780588.1|  predicted protein                                  289   5e-95    
ref|XP_001759850.1|  predicted protein                                  289   5e-95    
emb|CBI25428.3|  unnamed protein product                                288   6e-95    Vitis vinifera
ref|NP_001031846.1|  40S ribosomal protein S4-2                         287   1e-94    Arabidopsis thaliana [mouse-ear cress]
dbj|BAB10257.1|  ribosomal protein S4                                   287   1e-94    Arabidopsis thaliana [mouse-ear cress]
ref|XP_009126752.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    291   1e-94    
ref|XP_010509192.1|  PREDICTED: 40S ribosomal protein S4-3-like         286   2e-94    Camelina sativa [gold-of-pleasure]
ref|XP_001759591.1|  predicted protein                                  287   3e-94    
ref|XP_001751877.1|  predicted protein                                  287   3e-94    
ref|XP_001766039.1|  predicted protein                                  287   1e-93    
ref|XP_001785339.1|  predicted protein                                  285   1e-93    
gb|KFK40122.1|  hypothetical protein AALP_AA3G333200                    282   4e-93    Arabis alpina [alpine rockcress]
emb|CBI18118.3|  unnamed protein product                                281   7e-93    Vitis vinifera
gb|KHG11751.1|  40S ribosomal S4                                        281   2e-92    Gossypium arboreum [tree cotton]
gb|AAT38019.1|  putative 40S ribosomal protein S4                       281   3e-92    Oryza sativa Japonica Group [Japonica rice]
gb|KJB77064.1|  hypothetical protein B456_012G118500                    280   1e-91    Gossypium raimondii
gb|KJB38000.1|  hypothetical protein B456_006G231800                    279   2e-91    Gossypium raimondii
emb|CAA75242.1|  ribosomal protein S4                                   279   4e-91    Oryza sativa Japonica Group [Japonica rice]
ref|XP_002984314.1|  hypothetical protein SELMODRAFT_271698             277   2e-90    Selaginella moellendorffii
ref|XP_002972484.1|  hypothetical protein SELMODRAFT_148442             276   3e-90    Selaginella moellendorffii
gb|KJB29916.1|  hypothetical protein B456_005G123400                    275   7e-90    Gossypium raimondii
ref|XP_006576177.1|  PREDICTED: uncharacterized protein LOC100500...    273   5e-89    Glycine max [soybeans]
gb|KDO63240.1|  hypothetical protein CISIN_1g023289mg                   274   9e-89    Citrus sinensis [apfelsine]
gb|KDO63241.1|  hypothetical protein CISIN_1g023289mg                   271   2e-88    Citrus sinensis [apfelsine]
gb|AFK41206.1|  unknown                                                 262   3e-86    Lotus japonicus
dbj|GAN07411.1|  40S ribosomal protein S4                               264   2e-85    Mucor ambiguus
ref|XP_005850141.1|  hypothetical protein CHLNCDRAFT_59606              263   6e-85    Chlorella variabilis
gb|KFH71854.1|  40S ribosomal protein S4                                263   7e-85    Mortierella verticillata NRRL 6337
gb|EIE83303.1|  40S ribosomal protein S4                                263   9e-85    Rhizopus delemar RA 99-880
gb|KJB36905.1|  hypothetical protein B456_006G184600                    261   1e-84    Gossypium raimondii
gb|KJB77063.1|  hypothetical protein B456_012G118500                    262   1e-84    Gossypium raimondii
emb|CEG70586.1|  Putative 40S ribosomal protein S4-A                    262   1e-84    Rhizopus microsporus
gb|AAX19871.1|  putative ribosomal protein S4                           257   2e-84    Doryanthes excelsa
gb|KDD75424.1|  hypothetical protein H632_c691p0                        261   4e-84    Helicosporidium sp. ATCC 50920
emb|CEP14949.1|  hypothetical protein                                   261   4e-84    Parasitella parasitica
emb|CEI87363.1|  Putative 40S ribosomal protein S4-A                    261   5e-84    Rhizopus microsporus
emb|CEG72922.1|  Putative 40S ribosomal protein S4-A                    261   6e-84    Rhizopus microsporus
gb|EIE90129.1|  40S ribosomal protein S4-A                              260   7e-84    Rhizopus delemar RA 99-880
gb|EIE79548.1|  40S ribosomal protein S4-A                              260   1e-83    Rhizopus delemar RA 99-880
gb|KJB17112.1|  hypothetical protein B456_002G266000                    258   2e-83    Gossypium raimondii
ref|XP_006679983.1|  hypothetical protein BATDEDRAFT_35382              260   2e-83    Batrachochytrium dendrobatidis JAM81
ref|XP_011402198.1|  40S ribosomal protein S4-3                         258   5e-83    Auxenochlorella protothecoides
gb|KGG52703.1|  hypothetical protein DI09_141p50                        258   6e-83    Mitosporidium daphniae
ref|XP_002954897.1|  component of cytosolic 80S ribosome and 40S ...    258   9e-83    Volvox carteri f. nagariensis
ref|XP_008600052.1|  ribosomal family S4e                               257   1e-82    Beauveria bassiana ARSEF 2860
emb|CCE33652.1|  probable ribosomal protein S4.e, cytosolic             257   1e-82    Claviceps purpurea 20.1
ref|XP_001691218.1|  ribosomal protein S4, component of cytosolic...    257   2e-82    Chlamydomonas reinhardtii
gb|EQL02576.1|  Ribosomal protein S4e                                   255   5e-82    Ophiocordyceps sinensis CO18
gb|KID72648.1|  Ribosomal protein S4e                                   256   5e-82    Metarhizium brunneum ARSEF 3297
gb|EPZ32691.1|  40S ribosomal protein S4                                255   6e-82    Rozella allomycis CSF55
ref|XP_009259092.1|  hypothetical protein FPSE_07699                    254   1e-81    Fusarium pseudograminearum CS3096
ref|XP_007807221.1|  ribosomal protein S4                               254   1e-81    Metarhizium acridum CQMa 102
ref|XP_007823560.1|  hypothetical protein MAA_07371                     254   1e-81    Metarhizium robertsii ARSEF 23
ref|XP_009022208.1|  hypothetical protein HELRODRAFT_185809             252   2e-81    Helobdella robusta
ref|XP_003052651.1|  40S ribosomal protein S4                           254   2e-81    [Nectria] haematococca mpVI 77-13-4
gb|KIE00269.1|  Ribosomal protein S4e                                   254   2e-81    Metarhizium majus ARSEF 297
gb|KID89485.1|  Ribosomal protein S4e                                   254   2e-81    Metarhizium guizhouense ARSEF 977
ref|XP_006668474.1|  ribosomal protein S4                               253   3e-81    Cordyceps militaris CM01
ref|XP_001421876.1|  Ribosomal protein S4, component of cytosolic...    253   4e-81    Ostreococcus lucimarinus CCE9901
ref|XP_002502247.1|  predicted protein                                  253   4e-81    Micromonas commoda
emb|CDS09843.1|  Putative 40S ribosomal protein S4-A                    253   4e-81    Lichtheimia ramosa
emb|CDH52779.1|  40s ribosomal protein s4                               253   4e-81    Lichtheimia corymbifera JMRC:FSU:9682
gb|EGU80487.1|  hypothetical protein FOXB_08947                         253   4e-81    Fusarium oxysporum Fo5176
gb|ELU11454.1|  hypothetical protein CAPTEDRAFT_152725                  253   5e-81    Capitella teleta
emb|CCE33007.1|  probable ribosomal protein S4.e, cytosolic             253   6e-81    Claviceps purpurea 20.1
ref|XP_006691808.1|  40S ribosomal protein S4-like protein              253   6e-81    Chaetomium thermophilum var. thermophilum DSM 1495
gb|KIL89636.1|  hypothetical protein FAVG1_07216                        252   1e-80    Fusarium avenaceum
emb|CDO92178.1|  unnamed protein product                                252   1e-80    Kluyveromyces dobzhanskii CBS 2104
ref|XP_005536157.1|  40S ribosomal protein S4                           252   1e-80    Cyanidioschyzon merolae strain 10D
gb|KEY68677.1|  hypothetical protein S7711_00551                        252   2e-80    Stachybotrys chartarum IBT 7711
ref|XP_005189699.1|  PREDICTED: 40S ribosomal protein S4                252   2e-80    Musca domestica
gb|KFA60798.1|  hypothetical protein S40285_07752                       252   2e-80    Stachybotrys chlorohalonata IBT 40285
gb|EXX69253.1|  ribosomal 40S subunit protein S4A                       251   2e-80    Rhizophagus irregularis DAOM 197198w
ref|XP_006685622.1|  ribosomal protein S4e                              252   2e-80    Yamadazyma tenuis ATCC 10573
ref|XP_964251.2|  40S ribosomal protein S4                              251   2e-80    Neurospora crassa OR74A
dbj|BAK03384.1|  predicted protein                                      252   2e-80    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010758820.1|  40S ribosomal protein S4                           251   2e-80    Paracoccidioides brasiliensis Pb18
ref|XP_001222557.1|  40S ribosomal protein S4                           251   2e-80    Chaetomium globosum CBS 148.51
emb|CEG70587.1|  Putative 40S ribosomal protein S4-A                    251   2e-80    Rhizopus microsporus
ref|XP_002794223.1|  40S ribosomal protein S4                           251   2e-80    Paracoccidioides lutzii Pb01
ref|XP_003651472.1|  40S ribosomal protein S4                           251   3e-80    Thielavia terrestris NRRL 8126
ref|XP_007872809.1|  hypothetical protein PNEG_00898                    251   3e-80    
gb|EHK42992.1|  hypothetical protein TRIATDRAFT_300975                  251   3e-80    
gb|EPX72118.1|  40S ribosomal protein S4                                251   4e-80    
emb|CEI97230.1|  Putative 40S ribosomal protein S4-A                    251   4e-80    
gb|AJR59975.1|  Rps4ap                                                  251   4e-80    
ref|XP_451697.1|  40S ribosomal protein S4                              251   5e-80    
emb|CEG00570.1|  Ribosomal protein S4e                                  250   5e-80    
gb|KDN64809.1|  putative ribosomal family S4e                           250   5e-80    
ref|XP_003956128.1|  hypothetical protein KAFR_0B06960                  250   7e-80    
gb|EPY50701.1|  40S ribosomal protein S4                                250   7e-80    
gb|EPY52081.1|  40S ribosomal protein S4                                250   7e-80    
ref|XP_002175438.1|  40S ribosomal protein S4                           250   8e-80    
gb|KIN07653.1|  hypothetical protein OIDMADRAFT_16250                   250   8e-80    
dbj|BAO40506.1|  40S ribosomal protein S4                               250   8e-80    
ref|NP_012073.1|  ribosomal 40S subunit protein S4B                     250   8e-80    
gb|EPY52214.1|  40S ribosomal protein S4                                250   8e-80    
emb|CDR46586.1|  CYFA0S24e00562g1_1                                     250   9e-80    
ref|XP_005706608.1|  40S ribosomal protein S4e                          250   9e-80    
ref|XP_003957732.1|  hypothetical protein KAFR_0E04470                  250   9e-80    
sp|Q95V34.1|RS4_SPOFR  RecName: Full=40S ribosomal protein S4           250   1e-79    
dbj|BAM17680.1|  ribosomal protein S4                                   249   1e-79    
ref|XP_003347065.1|  40S ribosomal protein S4                           249   1e-79    
gb|ESW97160.1|  40S ribosomal protein S4-A                              249   1e-79    
ref|XP_003660094.1|  hypothetical protein MYCTH_2297948                 249   1e-79    
emb|CCF38284.1|  40S ribosomal protein S4                               249   1e-79    
emb|CEJ90606.1|  Putative 40S ribosomal protein S4                      249   2e-79    
gb|KGQ99291.1|  40S ribosomal protein S4                                249   2e-79    
ref|XP_009495182.1|  40S ribosomal protein S4                           249   2e-79    
gb|KDR20779.1|  40S ribosomal protein S4                                249   2e-79    
ref|NP_983705.1|  40S ribosomal protein S4                              249   2e-79    
ref|XP_004679117.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    249   2e-79    
ref|XP_004526806.1|  PREDICTED: 40S ribosomal protein S4-like           249   2e-79    
ref|XP_005650091.1|  ribosomal protein S4 component of cytosolic ...    249   2e-79    
gb|ABQ18253.1|  ribosomal protein S4e                                   249   2e-79    
ref|XP_007829569.1|  40S ribosomal protein S4                           249   2e-79    
gb|EPB85233.1|  40S ribosomal protein S4-A                              249   2e-79    
ref|XP_003064004.1|  predicted protein                                  249   2e-79    
ref|XP_011212693.1|  PREDICTED: 40S ribosomal protein S4                249   2e-79    
ref|XP_003672432.1|  ribosomal protein S4                               249   2e-79    
ref|XP_003669897.1|  ribosomal protein S4                               249   3e-79    
ref|XP_461869.1|  40S ribosomal protein S4                              249   3e-79    
gb|EPE05262.1|  40s ribosomal protein s4                                249   3e-79    
gb|KFM79678.1|  40S ribosomal protein S4                                248   3e-79    
ref|XP_003684132.1|  40S ribosomal protein S4                           249   3e-79    
gb|KGQ98564.1|  40S ribosomal protein S4                                249   3e-79    
ref|XP_011275622.1|  40S ribosomal protein                              249   3e-79    
gb|EHK22484.1|  hypothetical protein TRIVIDRAFT_84016                   248   3e-79    
gb|EFX62690.1|  hypothetical protein DAPPUDRAFT_300650                  248   3e-79    
ref|XP_006962266.1|  hypothetical protein TRIREDRAFT_74568              248   3e-79    
gb|KHC68343.1|  40S ribosomal protein S4                                248   3e-79    
emb|CDH16776.1|  40S ribosomal protein S4-B                             248   3e-79    
gb|EFQ26693.1|  ribosomal family S4e                                    248   3e-79    
gb|ADT80676.1|  ribosomal protein S4                                    248   3e-79    
ref|XP_003673582.1|  hypothetical protein NCAS_0A06410                  248   3e-79    
emb|CEP15508.1|  hypothetical protein                                   248   3e-79    
ref|XP_003721009.1|  40S ribosomal protein S4-A                         248   3e-79    
ref|XP_001387773.1|  40S ribosomal protein S4                           248   3e-79    
ref|NP_001187069.1|  40S ribosomal protein S4                           248   3e-79    
emb|CDF91666.1|  ZYBA0S13-00738g1_1                                     248   3e-79    
ref|XP_007913637.1|  putative 40s ribosomal protein s4 protein          248   3e-79    
gb|EPS26877.1|  hypothetical protein PDE_01817                          248   4e-79    
gb|EGE82775.1|  40S ribosomal protein S4                                249   4e-79    
ref|XP_002493655.1|  40S ribosomal protein S4                           249   4e-79    
ref|XP_004484345.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   4e-79    
gb|ACD65137.1|  putative 40S ribosomal protein RPS4                     247   4e-79    
ref|XP_003678541.1|  hypothetical protein NCAS_0J02250                  248   4e-79    
gb|KFH43552.1|  40S ribosomal protein S4-like protein                   248   4e-79    
ref|XP_002498034.1|  40S ribosomal protein S4                           248   4e-79    
emb|CEP65035.1|  LALA0S18e00254g1_1                                     248   4e-79    
ref|XP_011153375.1|  PREDICTED: 40S ribosomal protein S4                248   4e-79    
ref|XP_003680830.1|  40S ribosomal protein S4                           248   4e-79    
ref|XP_011300956.1|  PREDICTED: 40S ribosomal protein S4                248   5e-79    
gb|AGH70188.1|  40S ribosomal protein S4                                248   5e-79    
ref|NP_595677.1|  40S ribosomal protein S4                              248   5e-79    
ref|XP_002112468.1|  conserved hypothetical protein                     248   5e-79    
ref|NP_001037257.1|  40S ribosomal protein S4                           248   5e-79    
ref|XP_004887478.1|  PREDICTED: 40S ribosomal protein S4-like iso...    248   5e-79    
ref|XP_010989591.1|  PREDICTED: 40S ribosomal protein S4, X isoform     249   5e-79    
ref|XP_001482877.1|  40S ribosomal protein S4                           248   5e-79    
gb|ACY95325.1|  ribosomal protein S4                                    248   6e-79    
ref|XP_969262.1|  PREDICTED: 40S ribosomal protein S4                   248   6e-79    
ref|XP_502766.1|  40S ribosomal protein S4                              248   6e-79    
ref|XP_007374214.1|  ribosomal protein S4                               248   7e-79    
ref|XP_717144.1|  likely cytosolic ribosomal protein S4                 248   7e-79    
ref|XP_004181063.1|  hypothetical protein TBLA_0E04950                  248   7e-79    
ref|XP_004887477.1|  PREDICTED: 40S ribosomal protein S4-like iso...    248   7e-79    
ref|NP_596350.1|  40S ribosomal protein S4                              248   8e-79    
ref|XP_002553456.1|  40S ribosomal protein S4                           248   8e-79    
dbj|BAB29207.1|  unnamed protein product                                248   8e-79    
ref|XP_001525769.1|  40S ribosomal protein S4                           248   8e-79    
ref|XP_010383061.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   9e-79    
gb|AEL28856.1|  ribosomal protein S4                                    247   9e-79    
ref|XP_446360.1|  40S ribosomal protein S4                              247   9e-79    
pdb|4CUY|E  Chain E, Kluyveromyces Lactis 80s Ribosome In Complex...    247   1e-78    
ref|XP_007590516.1|  ribosomal family S4e                               247   1e-78    
ref|XP_460509.1|  40S ribosomal protein S4                              247   1e-78    
ref|XP_009227728.1|  40S ribosomal protein S4-A                         247   1e-78    
gb|EAW71816.1|  ribosomal protein S4, X-linked, isoform CRA_b           246   1e-78    
ref|XP_004203912.1|  Piso0_000935                                       247   1e-78    
ref|NP_594174.1|  40S ribosomal protein S4                              247   1e-78    
gb|KHN98797.1|  ribosomal protein S4                                    247   1e-78    
ref|XP_001907457.1|  hypothetical protein                               247   1e-78    
ref|XP_011380547.1|  PREDICTED: 40S ribosomal protein S4-like           247   1e-78    
ref|XP_001386303.1|  40S ribosomal protein S4                           247   1e-78    
ref|NP_001233602.1|  40S ribosomal protein S4                           247   1e-78    
ref|XP_006923115.1|  PREDICTED: 40S ribosomal protein S4-like iso...    247   1e-78    
emb|CCK72874.1|  hypothetical protein KNAG_0M00210                      247   1e-78    
ref|XP_007242077.1|  PREDICTED: 40S ribosomal protein S4-like           247   1e-78    
emb|CAM34499.1|  putative ribosomal protein S4                          247   1e-78    
gb|EZG03440.1|  40S ribosomal protein S4                                247   1e-78    
ref|XP_001246620.1|  40S ribosomal protein S4                           247   1e-78    
emb|CCE40910.1|  hypothetical protein CPAR2_109480                      247   1e-78    
ref|XP_008554238.1|  PREDICTED: 40S ribosomal protein S4 isoform X1     247   1e-78    
gb|EGD95553.1|  40S ribosomal protein S4                                247   2e-78    
ref|XP_005701142.1|  PREDICTED: 40S ribosomal protein S4-like           247   2e-78    
ref|XP_006908610.1|  PREDICTED: 40S ribosomal protein S4-like           247   2e-78    
ref|XP_009204777.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    247   2e-78    
emb|CAJ17169.1|  ribosomal protein S4e                                  246   2e-78    
ref|XP_006926381.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    247   2e-78    
ref|XP_002416828.1|  40S ribosomal protein S4                           246   2e-78    
emb|CCE44986.1|  hypothetical protein CPAR2_407890                      247   2e-78    
ref|XP_003237687.1|  40S ribosomal protein S4                           246   2e-78    
gb|ESZ97229.1|  40S ribosomal protein S4                                246   2e-78    
ref|XP_003648106.1|  hypothetical protein Ecym_7471                     246   2e-78    
dbj|BAE22507.1|  unnamed protein product                                246   2e-78    
ref|XP_004990087.1|  ribosomal protein s4 X isoform                     246   2e-78    
dbj|BAN20754.1|  ribosomal protein S4                                   246   2e-78    
ref|XP_001949785.1|  PREDICTED: 40S ribosomal protein S4                246   2e-78    
ref|XP_001985577.1|  GH17143                                            246   2e-78    
gb|ELR52713.1|  40S ribosomal protein S4                                247   2e-78    
ref|XP_010358394.1|  PREDICTED: 40S ribosomal protein S4-like           245   2e-78    
ref|XP_004327034.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   2e-78    
emb|CCX29556.1|  Similar to 40S ribosomal protein S4; acc. no. O5...    246   2e-78    
gb|EFW99258.1|  40S ribosomal protein s4                                246   2e-78    
ref|XP_004484344.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   2e-78    
ref|XP_010606265.1|  PREDICTED: 40S ribosomal protein S4, X isoform     246   2e-78    
ref|XP_006910196.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   2e-78    
ref|NP_001005589.1|  40S ribosomal protein S4, X isoform                246   3e-78    
ref|XP_003172932.1|  40S ribosomal protein S4                           246   3e-78    
ref|XP_008157005.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   3e-78    
ref|XP_002842984.1|  40S ribosomal protein S4                           246   3e-78    
ref|NP_000998.1|  40S ribosomal protein S4, X isoform X isoform         246   3e-78    
ref|XP_008069053.1|  PREDICTED: 40S ribosomal protein S4, X isoform     246   3e-78    
ref|XP_006082927.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   3e-78    
ref|XP_001599933.1|  PREDICTED: 40S ribosomal protein S4                246   3e-78    
ref|XP_006199437.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   3e-78    
ref|XP_003471039.1|  PREDICTED: 40S ribosomal protein S4, X isoform     246   3e-78    
ref|XP_005885533.1|  PREDICTED: 40S ribosomal protein S4, X isoform     246   3e-78    
emb|CDH12274.1|  40S ribosomal protein S4-B                             246   3e-78    
ref|XP_006622629.1|  PREDICTED: 40S ribosomal protein S4-like           244   3e-78    
ref|XP_011122246.1|  hypothetical protein AOL_s00079g69                 246   3e-78    
prf||1617101C  ribosomal protein S4                                     246   3e-78 
gb|AFM89946.1|  40S ribosomal protein S4                                246   3e-78    
sp|Q4PMB3.1|RS4_IXOSC  RecName: Full=40S ribosomal protein S4           246   4e-78    
ref|XP_004203329.1|  Piso0_000935                                       246   4e-78    
ref|XP_001365342.1|  PREDICTED: 40S ribosomal protein S4-like           246   4e-78    
ref|XP_004015500.1|  PREDICTED: 40S ribosomal protein S4-like           245   4e-78    
ref|XP_003803397.1|  PREDICTED: 40S ribosomal protein S4, X isoform     246   4e-78    
ref|XP_007169373.1|  PREDICTED: 40S ribosomal protein S4-like           246   4e-78    
gb|AFM90857.1|  40S ribosomal protein S4                                246   4e-78    
ref|XP_009651491.1|  40S ribosomal protein S4-A                         246   4e-78    
ref|XP_005880123.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   4e-78    
ref|XP_001537815.1|  40S ribosomal protein S4                           246   5e-78    
gb|ENH86947.1|  40s ribosomal protein s4                                246   5e-78    
ref|XP_004893287.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    246   5e-78    
ref|XP_007003999.1|  hypothetical protein TREMEDRAFT_43729              246   5e-78    
ref|XP_003007897.1|  40S ribosomal protein S4-A                         243   5e-78    
ref|XP_008810991.1|  PREDICTED: 40S ribosomal protein S4-1-like i...    241   5e-78    
ref|XP_011144347.1|  PREDICTED: 40S ribosomal protein S4-like           245   5e-78    
ref|XP_623050.1|  PREDICTED: 40S ribosomal protein S4-like isoform 1    245   5e-78    
emb|CAJ17168.1|  ribosomal protein S4e                                  245   5e-78    
ref|XP_011066661.1|  PREDICTED: 40S ribosomal protein S4                245   5e-78    
gb|ELR61790.1|  hypothetical protein M91_18687                          246   5e-78    
emb|CAJ17164.1|  ribosomal protein S4e                                  245   6e-78    
ref|XP_004777312.1|  PREDICTED: 40S ribosomal protein S4-like           245   6e-78    
sp|Q4GXU6.1|RS4_CARGR  RecName: Full=40S ribosomal protein S4           245   6e-78    
emb|CAJ17167.1|  ribosomal protein S4e                                  245   6e-78    
ref|XP_005147776.1|  PREDICTED: 40S ribosomal protein S4-like iso...    245   6e-78    
gb|AFM87151.1|  40S ribosomal protein S4                                245   6e-78    
ref|XP_002629529.1|  40S ribosomal protein S4                           245   6e-78    
gb|AFM90173.1|  40S ribosomal protein S4                                245   6e-78    
gb|ABD98758.1|  putative ribosomal protein S4e                          245   6e-78    
ref|XP_002008552.1|  GI11752                                            245   6e-78    
gb|AFM90836.1|  40S ribosomal protein S4                                245   6e-78    
ref|XP_003766510.1|  PREDICTED: 40S ribosomal protein S4-like iso...    245   6e-78    
ref|XP_001545862.1|  40S ribosomal protein S4                           245   6e-78    
ref|XP_003898985.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    245   7e-78    
ref|XP_006124705.1|  PREDICTED: 40S ribosomal protein S4-like           245   7e-78    
ref|XP_001586067.1|  40S ribosomal protein S4                           245   7e-78    
gb|KEZ41361.1|  hypothetical protein SAPIO_CDS7475                      245   7e-78    
ref|XP_007889271.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    245   7e-78    
ref|XP_007276029.1|  40s ribosomal protein s4                           245   7e-78    
gb|AFM90738.1|  40S ribosomal protein S4                                245   7e-78    
ref|XP_003398498.1|  PREDICTED: 40S ribosomal protein S4-like iso...    245   7e-78    
ref|XP_009002753.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    245   7e-78    
gb|AFM86071.1|  40S ribosomal protein S4                                245   7e-78    
ref|XP_004198623.1|  Piso0_002004                                       245   7e-78    
ref|NP_001279537.1|  ribosomal protein S4, X-linked                     245   7e-78    
dbj|BAD96199.1|  ribosomal protein S4, X-linked X isoform variant       245   7e-78    
ref|XP_002752965.2|  PREDICTED: 40S ribosomal protein S4, X isofo...    245   7e-78    
gb|AFM86794.1|  40S ribosomal protein S4                                245   8e-78    
gb|KHJ31509.1|  putative 40s ribosomal protein s4                       245   8e-78    
gb|AFM88094.1|  40S ribosomal protein S4                                245   8e-78    
gb|AFM86034.1|  40S ribosomal protein S4                                245   8e-78    
ref|XP_011114587.1|  hypothetical protein H072_8904                     245   8e-78    
ref|XP_010565368.1|  PREDICTED: 40S ribosomal protein S4, X isoform     245   8e-78    
ref|XP_004887479.1|  PREDICTED: 40S ribosomal protein S4-like iso...    245   8e-78    
ref|XP_004201802.1|  Piso0_002004                                       245   8e-78    
ref|NP_001090472.1|  40S ribosomal protein S4                           245   8e-78    
ref|XP_009438182.1|  PREDICTED: 40S ribosomal protein S4, Y isofo...    244   9e-78    
ref|XP_004605913.1|  PREDICTED: 40S ribosomal protein S4, X isofo...    245   9e-78    
ref|XP_008433376.1|  PREDICTED: 40S ribosomal protein S4, X isoform     245   9e-78    
ref|XP_002047468.1|  GJ13462                                            244   9e-78    
sp|Q56FH2.1|RS4_LYSTE  RecName: Full=40S ribosomal protein S4           244   1e-77    
gb|EAX02770.1|  ribosomal protein S4, Y-linked 1, isoform CRA_a         242   1e-77    
dbj|BAA33778.1|  ribosomal protein S4                                   244   1e-77    
ref|XP_005898249.1|  PREDICTED: 40S ribosomal protein S4-like           244   1e-77    
ref|XP_005313894.1|  PREDICTED: 40S ribosomal protein S4 isoform X2     244   1e-77    
gb|EPQ66493.1|  Protein component of the small (40S) ribosomal su...    244   1e-77    
ref|XP_005992934.1|  PREDICTED: 40S ribosomal protein S4-like           244   1e-77    
ref|XP_003871516.1|  Rps4a predicted ribosomal protein                  244   1e-77    



>gb|EYU41945.1| hypothetical protein MIMGU_mgv1a012043mg [Erythranthe guttata]
Length=263

 Score =   331 bits (849),  Expect = 1e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRH+LVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFGKKGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGKKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010553233.1| PREDICTED: 40S ribosomal protein S4-3 isoform X2 [Tarenaya hassleriana]
Length=262

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_011084586.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
 ref|XP_011095064.1| PREDICTED: 40S ribosomal protein S4 [Sesamum indicum]
Length=263

 Score =   331 bits (848),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009368564.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008233807.1| PREDICTED: 40S ribosomal protein S4-1 [Prunus mume]
Length=264

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_011097305.1| PREDICTED: 40S ribosomal protein S4-like [Sesamum indicum]
Length=263

 Score =   330 bits (847),  Expect = 2e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_007156130.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
 gb|ESW28124.1| hypothetical protein PHAVU_003G261200g [Phaseolus vulgaris]
Length=264

 Score =   330 bits (845),  Expect = 4e-111, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KCW60004.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=215

 Score =   328 bits (840),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLD  163



>ref|XP_010529053.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   329 bits (844),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLC+VRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCRVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_007218753.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
 gb|EMJ19952.1| hypothetical protein PRUPE_ppa009337mg [Prunus persica]
Length=296

 Score =   330 bits (847),  Expect = 6e-111, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  33   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  92

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  93   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  152

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  153  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  195



>ref|XP_002275063.1| PREDICTED: 40S ribosomal protein S4 [Vitis vinifera]
Length=264

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_007211867.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
 ref|XP_008225941.1| PREDICTED: 40S ribosomal protein S4-like [Prunus mume]
 gb|EMJ13066.1| hypothetical protein PRUPE_ppa010094mg [Prunus persica]
Length=264

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006488578.1| PREDICTED: 40S ribosomal protein S4-like [Citrus sinensis]
 gb|KDO67005.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=265

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008383247.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_008364235.1| PREDICTED: 40S ribosomal protein S4 [Malus domestica]
 ref|XP_009363280.1| PREDICTED: 40S ribosomal protein S4 [Pyrus x bretschneideri]
Length=264

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 155/163 (95%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>dbj|BAE20168.1| ribosomal protein S4 [Panax ginseng]
Length=264

 Score =   329 bits (844),  Expect = 7e-111, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VQSILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>gb|AGZ15374.1| 40S ribosomal S4 protein [Phaseolus vulgaris]
Length=264

 Score =   329 bits (843),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009369212.1| PREDICTED: 40S ribosomal protein S4-3 [Pyrus x bretschneideri]
Length=264

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_001235428.1| uncharacterized protein LOC100500000 [Glycine max]
 gb|ACU14556.1| unknown [Glycine max]
Length=205

 Score =   326 bits (836),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|EYU19705.1| hypothetical protein MIMGU_mgv1a012053mg [Erythranthe guttata]
Length=263

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010529903.1| PREDICTED: 40S ribosomal protein S4-3-like [Tarenaya hassleriana]
Length=262

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 154/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KDP45131.1| hypothetical protein JCGZ_17463 [Jatropha curcas]
Length=264

 Score =   328 bits (842),  Expect = 1e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010553232.1| PREDICTED: 40S ribosomal protein S4-3 isoform X1 [Tarenaya hassleriana]
Length=263

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 154/162 (95%), Positives = 161/162 (99%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYREV
Sbjct  3    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYREV  62

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKF
Sbjct  63   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  122

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  123  KLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  164



>gb|KDP30648.1| hypothetical protein JCGZ_16213 [Jatropha curcas]
Length=263

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_003516980.1| PREDICTED: 40S ribosomal protein S4 [Glycine max]
Length=264

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006576176.1| PREDICTED: uncharacterized protein LOC100500000 isoform X1 [Glycine 
max]
Length=264

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KHN48586.1| 40S ribosomal protein S4-2 [Glycine soja]
Length=264

 Score =   328 bits (841),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLD  163



>ref|XP_003604568.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES86765.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=264

 Score =   328 bits (840),  Expect = 2e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_003544057.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
Length=264

 Score =   328 bits (840),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLD  163



>ref|XP_006429477.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 ref|XP_006481102.1| PREDICTED: 40S ribosomal protein S4-2-like [Citrus sinensis]
 gb|ESR42717.1| hypothetical protein CICLE_v10012499mg [Citrus clementina]
 gb|KDO63239.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=262

 Score =   327 bits (839),  Expect = 3e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008234249.1| PREDICTED: 40S ribosomal protein S4 [Prunus mume]
Length=265

 Score =   327 bits (839),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010934423.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   327 bits (839),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_007205728.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
 gb|EMJ06927.1| hypothetical protein PRUPE_ppa010072mg [Prunus persica]
Length=265

 Score =   327 bits (839),  Expect = 4e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002268192.1| PREDICTED: 40S ribosomal protein S4-3-like [Vitis vinifera]
Length=264

 Score =   327 bits (838),  Expect = 6e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKV+ VQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLD
Sbjct  121  FKLCKVKGVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLD  163



>ref|XP_002884052.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH60311.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=261

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLD  163



>gb|KGN44410.1| hypothetical protein Csa_7G281390 [Cucumis sativus]
Length=264

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006409322.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 ref|XP_006411040.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
 gb|ESQ50775.1| hypothetical protein EUTSA_v10022813mg [Eutrema salsugineum]
 gb|ESQ52493.1| hypothetical protein EUTSA_v10017108mg [Eutrema salsugineum]
Length=262

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|NP_001235826.1| 40S ribosomal S4 protein [Glycine max]
 gb|AAM93434.1| 40S ribosomal S4 protein [Glycine max]
 gb|ACU21252.1| unknown [Glycine max]
Length=264

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_004150395.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160252.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
Length=264

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_003547932.1| PREDICTED: 40S ribosomal protein S4-1 [Glycine max]
 gb|KHN01598.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   327 bits (837),  Expect = 7e-110, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_010243078.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=265

 Score =   327 bits (837),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP+INTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGDKGIPYINTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_010023674.1| PREDICTED: 40S ribosomal protein S4-3 [Eucalyptus grandis]
 gb|KCW60003.1| hypothetical protein EUGRSUZ_H02737 [Eucalyptus grandis]
Length=264

 Score =   327 bits (837),  Expect = 8e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDTVKLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTVKLD  163



>ref|XP_004294780.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   327 bits (837),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002871248.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH47507.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   326 bits (836),  Expect = 9e-110, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KR+NAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRINAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIPF+NTYDGRTIRYPDPLIK NDTVKLD
Sbjct  121  FKLCKVRSIQFGQKGIPFLNTYDGRTIRYPDPLIKPNDTVKLD  163



>ref|XP_002512717.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF50169.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002515668.1| 40S ribosomal protein S4, putative [Ricinus communis]
 gb|EEF46720.1| 40S ribosomal protein S4, putative [Ricinus communis]
Length=263

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010907826.1| PREDICTED: 40S ribosomal protein S4-3-like [Elaeis guineensis]
Length=265

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGHKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004163526.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN50688.1| hypothetical protein Csa_5G212590 [Cucumis sativus]
 gb|KGN50692.1| hypothetical protein Csa_5G215120 [Cucumis sativus]
Length=264

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008454823.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
 ref|XP_008454824.1| PREDICTED: 40S ribosomal protein S4-3 [Cucumis melo]
Length=264

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKT+ENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002276986.1| PREDICTED: 40S ribosomal protein S4-1 [Vitis vinifera]
Length=264

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRH+ VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHIFVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009766580.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana sylvestris]
Length=264

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009393217.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   326 bits (836),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010453688.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   326 bits (835),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 153/163 (94%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_010676809.1| PREDICTED: 40S ribosomal protein S4-1-like [Beta vulgaris subsp. 
vulgaris]
Length=263

 Score =   326 bits (835),  Expect = 1e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRH+LVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHILVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006399188.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
 gb|ESQ40641.1| hypothetical protein EUTSA_v10014417mg [Eutrema salsugineum]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_002864574.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH40833.1| 40S ribosomal protein S4 [Arabidopsis lyrata subsp. lyrata]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEA+
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAQ  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_003623356.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|AES79574.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK36229.1| unknown [Medicago truncatula]
Length=265

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_200650.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
 sp|Q8VYK6.2|RS43_ARATH RecName: Full=40S ribosomal protein S4-3 [Arabidopsis thaliana]
 gb|AAL16117.1|AF428285_1 AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAM64284.1| ribosomal protein S4-like [Arabidopsis thaliana]
 gb|AED97051.1| 40S ribosomal protein S4-3 [Arabidopsis thaliana]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|NP_001189539.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AEC06617.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=184

 Score =   323 bits (827),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_006851828.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
 gb|ERN13295.1| hypothetical protein AMTR_s00041p00058440 [Amborella trichopoda]
Length=268

 Score =   326 bits (835),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 151/167 (90%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  242
            ++ T ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYAL
Sbjct  1    MAKTWARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYAL  60

Query  243  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  422
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS++D
Sbjct  61   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVKD  120

Query  423  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            EEAKFKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  EEAKFKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLD  167



>ref|NP_568179.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 sp|P49204.4|RS42_ARATH RecName: Full=40S ribosomal protein S4-2 [Arabidopsis thaliana]
 emb|CAB87265.1| ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAK93610.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL50106.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAL85148.1| putative 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAM10339.1| AT5g07090/T28J14_30 [Arabidopsis thaliana]
 gb|AAM61755.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
 gb|AED91107.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|NP_565414.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
 sp|Q93VH9.1|RS41_ARATH RecName: Full=40S ribosomal protein S4-1 [Arabidopsis thaliana]
 gb|AAK43846.1|AF370469_1 Unknown protein [Arabidopsis thaliana]
 gb|AAK59636.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL34157.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AAL47338.1| unknown protein [Arabidopsis thaliana]
 gb|AAM60830.1| putative ribosomal protein S4 [Arabidopsis thaliana]
 gb|AEC06616.1| 40S ribosomal protein S4-1 [Arabidopsis thaliana]
Length=261

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_006298349.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
 gb|EOA31247.1| hypothetical protein CARUB_v10014418mg [Capsella rubella]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_006288484.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
 ref|XP_010452659.1| PREDICTED: 40S ribosomal protein S4-3 [Camelina sativa]
 gb|EOA21382.1| hypothetical protein CARUB_v10001743mg [Capsella rubella]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_010491309.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_010515129.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010467507.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
 ref|XP_010489362.1| PREDICTED: 40S ribosomal protein S4-1 [Camelina sativa]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>gb|ACU24295.1| unknown [Glycine max]
Length=264

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKK++KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKYLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDTVKLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTVKLD  163



>ref|XP_006280972.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
 gb|EOA13870.1| hypothetical protein CARUB_v10026972mg [Capsella rubella]
Length=262

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_009391002.1| PREDICTED: 40S ribosomal protein S4-3 [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   325 bits (834),  Expect = 2e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004240421.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   325 bits (834),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009385022.1| PREDICTED: 40S ribosomal protein S4-1-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   325 bits (834),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009369565.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=264

 Score =   325 bits (833),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010036744.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW88215.1| hypothetical protein EUGRSUZ_A00608 [Eucalyptus grandis]
Length=264

 Score =   325 bits (833),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010938423.1| PREDICTED: 40S ribosomal protein S4-3 [Elaeis guineensis]
Length=265

 Score =   325 bits (833),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010423256.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=258

 Score =   325 bits (832),  Expect = 3e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_004150397.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 ref|XP_004160251.1| PREDICTED: 40S ribosomal protein S4-like [Cucumis sativus]
 gb|KGN44413.1| hypothetical protein Csa_7G282410 [Cucumis sativus]
Length=264

 Score =   325 bits (833),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004307685.1| PREDICTED: 40S ribosomal protein S4-like [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   325 bits (833),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008461463.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   325 bits (833),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKT+PAGFMDVVSIPKT+ENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDVVSIPKTSENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_001275093.1| 40S ribosomal protein S4-like [Solanum tuberosum]
 gb|ABB72798.1| 40S ribosomal protein S4-like protein [Solanum tuberosum]
Length=264

 Score =   325 bits (832),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006344073.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   325 bits (832),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004492491.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=264

 Score =   325 bits (832),  Expect = 4e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010037684.1| PREDICTED: 40S ribosomal protein S4-3-like [Eucalyptus grandis]
 gb|KCW49427.1| hypothetical protein EUGRSUZ_K02962 [Eucalyptus grandis]
Length=264

 Score =   325 bits (832),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP+IKANDTVKLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPVIKANDTVKLD  163



>ref|NP_001275148.1| 40S ribosomal protein S4 [Solanum tuberosum]
 sp|P46300.1|RS4_SOLTU RecName: Full=40S ribosomal protein S4 [Solanum tuberosum]
 emb|CAA54095.1| ribosomal protein S4 [Solanum tuberosum]
Length=264

 Score =   325 bits (832),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIIMRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+K
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010443578.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X1 [Camelina 
sativa]
 ref|XP_010443579.1| PREDICTED: 40S ribosomal protein S4-3-like isoform X2 [Camelina 
sativa]
Length=262

 Score =   325 bits (832),  Expect = 5e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_010276734.1| PREDICTED: 40S ribosomal protein S4-3 [Nelumbo nucifera]
Length=267

 Score =   325 bits (832),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_004293830.1| PREDICTED: 40S ribosomal protein S4-3 [Fragaria vesca subsp. 
vesca]
Length=264

 Score =   324 bits (831),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+K IP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKNIPYINTYDGRTIRYPDPLIKANDTIKLD  163



>gb|AAL49933.1| AT5g58420/mqj2_10 [Arabidopsis thaliana]
 gb|AAN28773.1| At5g58420/mqj2_10 [Arabidopsis thaliana]
Length=262

 Score =   324 bits (831),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRL+YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLEYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_009597091.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   324 bits (831),  Expect = 6e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010483440.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   324 bits (831),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 152/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
             KLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  LKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_004511996.1| PREDICTED: 40S ribosomal protein S4-1-like [Cicer arietinum]
Length=264

 Score =   324 bits (831),  Expect = 7e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIKANDTIKLD  163



>ref|XP_009354210.1| PREDICTED: 40S ribosomal protein S4-3-like [Pyrus x bretschneideri]
Length=265

 Score =   324 bits (830),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLVLILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRDEEAK
Sbjct  61   VVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  163



>emb|CDY60025.1| BnaAnng16450D [Brassica napus]
Length=285

 Score =   325 bits (832),  Expect = 8e-109, Method: Compositional matrix adjust.
 Identities = 151/166 (91%), Positives = 161/166 (97%), Gaps = 0/166 (0%)
 Frame = +3

Query  66   STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  245
            +T MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT
Sbjct  21   ATHMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALT  80

Query  246  YREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDE  425
            YREVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDE
Sbjct  81   YREVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDE  140

Query  426  EAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            EAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  141  EAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  186



>ref|XP_004491013.1| PREDICTED: 40S ribosomal protein S4-2-like [Cicer arietinum]
Length=265

 Score =   324 bits (830),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDNKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002308235.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
 gb|EEE91758.1| hypothetical protein POPTR_0006s10460g [Populus trichocarpa]
Length=263

 Score =   324 bits (830),  Expect = 9e-109, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009784493.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   324 bits (830),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010243101.1| PREDICTED: 40S ribosomal protein S4-3-like [Nelumbo nucifera]
Length=264

 Score =   324 bits (830),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLI+ANDT+K+D
Sbjct  121  FKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLIRANDTIKID  163



>ref|XP_006374217.1| 40S ribosomal protein S4 [Populus trichocarpa]
 gb|ERP52014.1| 40S ribosomal protein S4 [Populus trichocarpa]
Length=263

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|ABK92450.1| unknown [Populus trichocarpa]
Length=263

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010517120.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=262

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_011046821.1| PREDICTED: 40S ribosomal protein S4-3 [Populus euphratica]
Length=263

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_002463552.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
 gb|EER90550.1| hypothetical protein SORBIDRAFT_01g001850 [Sorghum bicolor]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_011035547.1| PREDICTED: 40S ribosomal protein S4-1 [Populus euphratica]
Length=263

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_001266498.1| 40S ribosomal protein S4 [Zea mays]
 sp|O22424.1|RS4_MAIZE RecName: Full=40S ribosomal protein S4 [Zea mays]
 gb|AAB66899.1| ribosomal protein S4 type I [Zea mays]
 gb|ACF83328.1| unknown [Zea mays]
 gb|ACG30922.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG34655.1| 40S ribosomal protein S4 [Zea mays]
 gb|AFW67028.1| putative ribosomal protein S4 (RPS4A) family protein [Zea mays]
Length=265

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_008461503.1| PREDICTED: 40S ribosomal protein S4-3-like [Cucumis melo]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKT+PAGFMD++SIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTFPAGFMDILSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_006352980.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004233134.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233136.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
 ref|XP_004233137.1| PREDICTED: 40S ribosomal protein S4 [Solanum lycopersicum]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009600336.1| PREDICTED: 40S ribosomal protein S4 [Nicotiana tomentosiformis]
Length=264

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYGE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009402521.1| PREDICTED: 40S ribosomal protein S4-3-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   323 bits (829),  Expect = 1e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSV+FG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVRFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|EPS63485.1| hypothetical protein M569_11297, partial [Genlisea aurea]
Length=262

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 152/162 (94%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAKF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEEAKF  120

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  162



>ref|XP_002323021.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
 gb|EEF04782.2| hypothetical protein POPTR_0016s13210g [Populus trichocarpa]
Length=263

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_004233133.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>dbj|BAB11167.1| 40S ribosomal protein S4 [Arabidopsis thaliana]
Length=263

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
             ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  2    QARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  61

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  62   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  121

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  122  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  164



>ref|XP_008789926.1| PREDICTED: 40S ribosomal protein S4-1 isoform X2 [Phoenix dactylifera]
Length=263

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLD  163



>emb|CDY32986.1| BnaA10g11920D [Brassica napus]
Length=288

 Score =   324 bits (830),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  27   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  86

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  87   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  146

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  147  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  189



>gb|KHN38535.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=264

 Score =   323 bits (828),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNA KHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNARKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_009120350.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>gb|ACU24626.1| unknown [Glycine max]
Length=264

 Score =   323 bits (827),  Expect = 2e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMD VSIPKTNENF L YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDAVSIPKTNENFHLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_010316939.1| PREDICTED: 40S ribosomal protein S4-like [Solanum lycopersicum]
Length=264

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGK+RTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKIRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009794044.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGSKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KDO67004.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=272

 Score =   323 bits (827),  Expect = 3e-108, Method: Compositional matrix adjust.
 Identities = 154/170 (91%), Positives = 161/170 (95%), Gaps = 7/170 (4%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  -------FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
                   FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  ALILLFQFKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  170



>emb|CDY57385.1| BnaCnng31910D [Brassica napus]
Length=298

 Score =   323 bits (829),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  37   MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  96

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  97   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  156

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  157  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  199



>ref|XP_003611879.1| 40S ribosomal protein S4 [Medicago truncatula]
 ref|XP_003628299.1| 40S ribosomal protein S4 [Medicago truncatula]
 gb|ACJ85463.1| unknown [Medicago truncatula]
 gb|AES94837.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AET02775.1| 40S ribosomal S4-like protein [Medicago truncatula]
 gb|AFK34966.1| unknown [Medicago truncatula]
 gb|AFK42812.1| unknown [Medicago truncatula]
 gb|KEH27546.1| 40S ribosomal S4-like protein [Medicago truncatula]
Length=265

 Score =   322 bits (826),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+I+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPVIRANDTIKLD  163



>ref|XP_002455614.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
 gb|EES00734.1| hypothetical protein SORBIDRAFT_03g014380 [Sorghum bicolor]
Length=265

 Score =   322 bits (826),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYP+GFMDV+SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPSGFMDVISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_010666843.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHSIRDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>gb|ACV70143.1| putative 40S ribosomal protein S4 [Jatropha curcas]
Length=264

 Score =   322 bits (825),  Expect = 4e-108, Method: Compositional matrix adjust.
 Identities = 151/163 (93%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRL YALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLPYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLV GKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVVGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>emb|CDY05015.1| BnaAnng01970D [Brassica napus]
Length=305

 Score =   323 bits (829),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/169 (89%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  57   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  236
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  38   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  97

Query  237  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  416
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  98   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  157

Query  417  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  158  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  206



>ref|XP_008356229.1| PREDICTED: 40S ribosomal protein S4-3-like [Malus domestica]
Length=269

 Score =   322 bits (826),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 148/167 (89%), Positives = 163/167 (98%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  242
            ++  +ARGLKKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPLVLI+RNRLKYAL
Sbjct  1    MTEDLARGLKKHLKRLNAPKHWMLDKLGGXFAPKPSSGPHKARECLPLVLILRNRLKYAL  60

Query  243  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  422
            TYREV+SILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL +DTKGRFRLHSIRD
Sbjct  61   TYREVVSILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLFDTKGRFRLHSIRD  120

Query  423  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            EEAKFKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  EEAKFKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  167



>emb|CDY14056.1| BnaC02g01730D [Brassica napus]
Length=291

 Score =   323 bits (828),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 149/169 (88%), Positives = 162/169 (96%), Gaps = 0/169 (0%)
 Frame = +3

Query  57   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  236
            ++ +  MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  24   SETTANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  83

Query  237  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  416
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+
Sbjct  84   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSL  143

Query  417  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            RDEEAKFKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  144  RDEEAKFKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  192



>ref|XP_009609731.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
 ref|XP_009764136.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=264

 Score =   322 bits (825),  Expect = 5e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIIMRNRLKYALTYGE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLMYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009381027.1| PREDICTED: 40S ribosomal protein S4-like [Musa acuminata subsp. 
malaccensis]
Length=265

 Score =   322 bits (825),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NT+DGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTFDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_010685909.1| PREDICTED: 40S ribosomal protein S4-1 [Beta vulgaris subsp. vulgaris]
Length=262

 Score =   322 bits (824),  Expect = 6e-108, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYAL YRE
Sbjct  1    MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALVYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNENFRL YD KGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDAKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR+VQFG KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRNVQFGTKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>gb|EPS70681.1| hypothetical protein M569_04077, partial [Genlisea aurea]
Length=256

 Score =   321 bits (823),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 151/162 (93%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  1    ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  60

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISI+MQR VLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEE+KF
Sbjct  61   ISIMMQRLVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHTIRDEESKF  120

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFGKKGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  KLCKVRSVQFGKKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  162



>ref|XP_006411034.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
 gb|ESQ52487.1| hypothetical protein EUTSA_v10017036mg [Eutrema salsugineum]
Length=288

 Score =   322 bits (826),  Expect = 7e-108, Method: Compositional matrix adjust.
 Identities = 151/165 (92%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  69   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY  248
              MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECL LVLIIRN LKYALTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLTLVLIIRNSLKYALTY  84

Query  249  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEE  428
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  429  AKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            AKFKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  145  AKFKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  189



>ref|XP_009132054.1| PREDICTED: 40S ribosomal protein S4-2-like [Brassica rapa]
Length=262

 Score =   322 bits (824),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLD
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLD  163



>ref|XP_004962295.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=262

 Score =   321 bits (823),  Expect = 8e-108, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_007141735.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 ref|XP_007141738.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
 gb|ESW13729.1| hypothetical protein PHAVU_008G221000g [Phaseolus vulgaris]
 gb|ESW13732.1| hypothetical protein PHAVU_008G221300g [Phaseolus vulgaris]
Length=264

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKV+SVQFG+KGIP++NT+DGRTIRYPDP+I+ANDT+KLD
Sbjct  121  FKLCKVKSVQFGQKGIPYLNTFDGRTIRYPDPVIRANDTIKLD  163



>ref|XP_006401084.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
 gb|ESQ42537.1| hypothetical protein EUTSA_v10014163mg [Eutrema salsugineum]
Length=312

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 151/176 (86%), Positives = 165/176 (94%), Gaps = 3/176 (2%)
 Frame = +3

Query  45   RRPNTQL---STTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  215
            + P ++L   +  MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI
Sbjct  38   KSPGSELRLQTPNMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLI  97

Query  216  IRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKG  395
            IRNRLKYAL YREV+SILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKG
Sbjct  98   IRNRLKYALNYREVVSILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKG  157

Query  396  RFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            RFRLHSIRDEEAK+KLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  158  RFRLHSIRDEEAKYKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  213



>ref|XP_006352979.1| PREDICTED: 40S ribosomal protein S4-like [Solanum tuberosum]
Length=264

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLV+I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYPAGFMDVV+IPKTNE+FRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISILMQRQVMVDGKVRTDKTYPAGFMDVVTIPKTNESFRLLYDTKGRFRLHSLRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009595443.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana tomentosiformis]
Length=264

 Score =   321 bits (823),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLH+IRDEEAK
Sbjct  61   VIAILMQRQVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHAIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGTKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_008789925.1| PREDICTED: 40S ribosomal protein S4-1 isoform X1 [Phoenix dactylifera]
Length=319

 Score =   323 bits (828),  Expect = 1e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKV+TD+TYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VIAILMQRHVMVDGKVKTDRTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIK+NDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKSNDTIKLD  163



>ref|XP_002322175.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
 gb|EEF06302.1| hypothetical protein POPTR_0015s09110g [Populus trichocarpa]
Length=263

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009125675.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRTIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>gb|AAS48726.1| ribosomal protein S4 [Zea mays]
Length=265

 Score =   321 bits (822),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP IKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPPIKANDTIKID  163



>gb|KFK36724.1| hypothetical protein AALP_AA4G161500 [Arabis alpina]
Length=262

 Score =   320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI DEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDP IK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLD  163



>ref|XP_006645886.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=285

 Score =   321 bits (823),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 149/167 (89%), Positives = 161/167 (96%), Gaps = 0/167 (0%)
 Frame = +3

Query  63   LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYAL  242
            L T  ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL
Sbjct  17   LGTDAARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYAL  76

Query  243  TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRD  422
            TYREVISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++D
Sbjct  77   TYREVISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKD  136

Query  423  EEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            E+AKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  137  EDAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  183



>ref|XP_011019071.1| PREDICTED: 40S ribosomal protein S4-3-like [Populus euphratica]
Length=263

 Score =   320 bits (821),  Expect = 2e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 162/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKK+MKRL+APKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKNMKRLHAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_011046165.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV VDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VIAILMQRHVFVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_001043015.1| Os01g0358400 [Oryza sativa Japonica Group]
 dbj|BAD52963.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF04929.1| Os01g0358400 [Oryza sativa Japonica Group]
 gb|EAY74000.1| hypothetical protein OsI_01884 [Oryza sativa Indica Group]
 gb|EAZ11863.1| hypothetical protein OsJ_01737 [Oryza sativa Japonica Group]
 gb|ABR25672.1| 40S ribosomal protein S4 [Oryza sativa Indica Group]
 dbj|BAG88133.1| unnamed protein product [Oryza sativa Japonica Group]
Length=265

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|NP_001242281.1| uncharacterized protein LOC100812132 [Glycine max]
 gb|ACU23059.1| unknown [Glycine max]
Length=264

 Score =   320 bits (820),  Expect = 3e-107, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLK ALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKCALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAK
Sbjct  61   VIAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  163



>ref|XP_002439678.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
 gb|EES18108.1| hypothetical protein SORBIDRAFT_09g018320 [Sorghum bicolor]
Length=263

 Score =   320 bits (819),  Expect = 4e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VDGKVRTDKTYP+GFMDVVSIPKT ENFRL YDTKGRFRLHSIRD+EAK
Sbjct  61   VISILMQRLVMVDGKVRTDKTYPSGFMDVVSIPKTGENFRLLYDTKGRFRLHSIRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FK+CKVRSVQFG+KGIPF+NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKMCKVRSVQFGQKGIPFLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_006646768.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   319 bits (818),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL SI+DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSIKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKID  163



>gb|KHN00473.1| 40S ribosomal protein S4-1 [Glycine soja]
Length=296

 Score =   320 bits (821),  Expect = 5e-107, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 160/162 (99%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  34   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  93

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            I+ILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+ D+EAKF
Sbjct  94   IAILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVIDDEAKF  153

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLI+ANDT+KLD
Sbjct  154  KLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIRANDTIKLD  195



>ref|XP_002318967.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
 gb|ABK94293.1| unknown [Populus trichocarpa]
 gb|EEE94890.2| hypothetical protein POPTR_0013s01230g [Populus trichocarpa]
Length=263

 Score =   319 bits (818),  Expect = 6e-107, Method: Compositional matrix adjust.
 Identities = 148/163 (91%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+RD+EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLRDDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>emb|CDY69841.1| BnaAnng31720D [Brassica napus]
Length=311

 Score =   321 bits (822),  Expect = 8e-107, Method: Compositional matrix adjust.
 Identities = 149/164 (91%), Positives = 158/164 (96%), Gaps = 0/164 (0%)
 Frame = +3

Query  72   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  251
             MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR
Sbjct  49   NMARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  108

Query  252  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  431
            EVISILMQRH+ VDGKVRTDKTYPAGFMDV+SIPKTNENFRL YDTKGRFRLHSIRDEEA
Sbjct  109  EVISILMQRHIQVDGKVRTDKTYPAGFMDVISIPKTNENFRLLYDTKGRFRLHSIRDEEA  168

Query  432  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KFKLCKVR++Q G+KGIP++NTYDGRTIRYPDP IK NDT+KLD
Sbjct  169  KFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPFIKPNDTIKLD  212



>ref|NP_001045624.1| Os02g0105900 [Oryza sativa Japonica Group]
 sp|P49398.3|RS4_ORYSJ RecName: Full=40S ribosomal protein S4; AltName: Full=SCAR protein 
SS620 [Oryza sativa Japonica Group]
 pdb|3J60|E Chain E, Localization Of The Small Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 dbj|BAD28085.1| putative ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAF07538.1| Os02g0105900 [Oryza sativa Japonica Group]
 gb|EAY84111.1| hypothetical protein OsI_05494 [Oryza sativa Indica Group]
 gb|EAZ21423.1| hypothetical protein OsJ_05027 [Oryza sativa Japonica Group]
 gb|ACA50490.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
 dbj|BAG96339.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG95549.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|ADM86872.1| 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=265

 Score =   319 bits (817),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDP+IKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPIIKANDTIKID  163



>gb|KFK25102.1| hypothetical protein AALP_AA8G066400 [Arabis alpina]
Length=262

 Score =   319 bits (817),  Expect = 9e-107, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_004960263.1| PREDICTED: 40S ribosomal protein S4-like [Setaria italica]
Length=265

 Score =   319 bits (817),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKTNEN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTNENYRLLYDTKGRFRLHPIRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
             KLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  TKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>gb|KFK27370.1| hypothetical protein AALP_AA8G374100 [Arabis alpina]
Length=262

 Score =   318 bits (816),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 150/163 (92%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY E
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYGE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI D EAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSISDVEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_009122377.1| PREDICTED: 40S ribosomal protein S4-1 [Brassica rapa]
Length=262

 Score =   318 bits (816),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAK
Sbjct  61   VISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_006644163.1| PREDICTED: 40S ribosomal protein S4-like [Oryza brachyantha]
Length=265

 Score =   318 bits (816),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 160/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>emb|CDX99006.1| BnaC09g48290D [Brassica napus]
Length=288

 Score =   319 bits (818),  Expect = 1e-106, Method: Compositional matrix adjust.
 Identities = 149/165 (90%), Positives = 158/165 (96%), Gaps = 0/165 (0%)
 Frame = +3

Query  69   TTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTY  248
              MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTY
Sbjct  25   ANMARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTY  84

Query  249  REVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEE  428
            REVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEE
Sbjct  85   REVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEE  144

Query  429  AKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            AKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  145  AKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  189



>ref|XP_011023749.1| PREDICTED: 40S ribosomal protein S4-2-like [Populus euphratica]
Length=263

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 161/163 (99%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALT RE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++ILMQRHVLVDGKVRTDKTYP+GFMDVVSIPKTNE+FRL YDTKGRFRLHS+R++EAK
Sbjct  61   VLAILMQRHVLVDGKVRTDKTYPSGFMDVVSIPKTNESFRLLYDTKGRFRLHSLREDEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_007050962.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOX95119.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KHG30713.1| 40S ribosomal S4 [Gossypium arboreum]
Length=268

 Score =   318 bits (815),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/168 (88%), Positives = 161/168 (96%), Gaps = 0/168 (0%)
 Frame = +3

Query  60   QLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYA  239
            QL   +ARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYA
Sbjct  2    QLLGFLARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYA  61

Query  240  LTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIR  419
            LTYREVI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I 
Sbjct  62   LTYREVIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAIS  121

Query  420  DEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
             +E KFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  122  GDETKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  169



>ref|XP_007026596.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
 gb|EOY07098.1| Ribosomal protein S4 (RPS4A) family protein [Theobroma cacao]
Length=262

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|NP_001288485.1| 40S ribosomal protein S4-like [Zea mays]
 gb|AAB67831.1| ribsomal protein S4 [Zea mays]
 gb|ACF87994.1| unknown [Zea mays]
 gb|ACG25377.1| 40S ribosomal protein S4 [Zea mays]
 gb|ACG45984.1| 40S ribosomal protein S4 [Zea mays]
 tpg|DAA52405.1| TPA: ribosomal protein S4 [Zea mays]
Length=265

 Score =   318 bits (814),  Expect = 2e-106, Method: Compositional matrix adjust.
 Identities = 149/163 (91%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYAL YRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRLH IRDE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTMENYRLLYDTKGRFRLHPIRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>ref|NP_001055342.1| Os05g0368300 [Oryza sativa Japonica Group]
 dbj|BAF17256.1| Os05g0368300 [Oryza sativa Japonica Group]
Length=263

 Score =   317 bits (812),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AK
Sbjct  61   VISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKID  163



>gb|KJB71672.1| hypothetical protein B456_011G136800 [Gossypium raimondii]
Length=262

 Score =   317 bits (812),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KHG26321.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   317 bits (812),  Expect = 5e-106, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|KHG02126.1| 40S ribosomal S4 [Gossypium arboreum]
 gb|KJB36904.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
 gb|KJB77062.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=262

 Score =   317 bits (811),  Expect = 6e-106, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>dbj|BAJ94984.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMS49926.1| 40S ribosomal protein S4 [Triticum urartu]
 gb|EMT30796.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=265

 Score =   317 bits (811),  Expect = 7e-106, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>emb|CDX81032.1| BnaC03g02860D [Brassica napus]
Length=279

 Score =   317 bits (812),  Expect = 8e-106, Method: Compositional matrix adjust.
 Identities = 149/162 (92%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKF  138

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVR++Q G+KGIPF+NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  139  KLCKVRTIQLGQKGIPFLNTYDGRTIRYPDPLIKPNDTIKLD  180



>emb|CDX70008.1| BnaA10g23570D [Brassica napus]
Length=269

 Score =   317 bits (811),  Expect = 9e-106, Method: Compositional matrix adjust.
 Identities = 148/169 (88%), Positives = 159/169 (94%), Gaps = 0/169 (0%)
 Frame = +3

Query  57   TQLSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKY  236
            ++     ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKY
Sbjct  2    SECKILQARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKY  61

Query  237  ALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSI  416
            ALTYREVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI
Sbjct  62   ALTYREVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSI  121

Query  417  RDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            RDEEAKFKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  122  RDEEAKFKLCKVRTIQVGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  170



>gb|KJB37999.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=262

 Score =   316 bits (810),  Expect = 1e-105, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 159/163 (98%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K D
Sbjct  121  FKLCKVRSVQFGRKGIPYLNTYDGRTIRYPDPLIKANDTIKFD  163



>ref|XP_009130977.1| PREDICTED: 40S ribosomal protein S4-1-like [Brassica rapa]
Length=262

 Score =   315 bits (808),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 147/163 (90%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VIS LMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAK
Sbjct  61   VISSLMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  FKLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  163



>ref|XP_010087529.1| 40S ribosomal protein S4 [Morus notabilis]
 gb|EXB29260.1| 40S ribosomal protein S4 [Morus notabilis]
Length=318

 Score =   317 bits (813),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 152/177 (86%), Positives = 161/177 (91%), Gaps = 15/177 (8%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREV
Sbjct  41   ARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREV  100

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFM---------------DVVSIPKTNENFRLFYDTK  392
            ISILMQRHVLVDGKVRTDKTYP+GFM               DVVSIPKTNENFRL YDTK
Sbjct  101  ISILMQRHVLVDGKVRTDKTYPSGFMVQVVVFFESNVTLVTDVVSIPKTNENFRLLYDTK  160

Query  393  GRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            GRFRLHSIRD+EAKFKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  161  GRFRLHSIRDDEAKFKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  217



>gb|KHG02041.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   315 bits (807),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 146/163 (90%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGLKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>emb|CDY58877.1| BnaA03g55550D [Brassica napus]
Length=279

 Score =   315 bits (807),  Expect = 4e-105, Method: Compositional matrix adjust.
 Identities = 147/162 (91%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAPKHW LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYREV
Sbjct  19   ARGLKKHLKRLNAPKHWDLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYREV  78

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKF
Sbjct  79   ISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKF  138

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVR++Q G+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  139  KLCKVRTIQLGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  180



>gb|EAY97774.1| hypothetical protein OsI_19685 [Oryza sativa Indica Group]
Length=279

 Score =   315 bits (806),  Expect = 6e-105, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  18   ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  77

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  78   ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  137

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+D
Sbjct  138  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKID  179



>sp|P46299.1|RS4_GOSHI RecName: Full=40S ribosomal protein S4 [Gossypium hirsutum]
 emb|CAA55882.1| ribosomal protein, small subunit 4e (RS4e) [Gossypium hirsutum]
 gb|KJB17110.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=262

 Score =   313 bits (803),  Expect = 1e-104, Method: Compositional matrix adjust.
 Identities = 145/163 (89%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>emb|CDY02821.1| BnaC02g10680D [Brassica napus]
Length=275

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 147/164 (90%), Positives = 157/164 (96%), Gaps = 0/164 (0%)
 Frame = +3

Query  72   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  251
            TM RGLKKH+KRLNAPK W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYR
Sbjct  16   TMTRGLKKHLKRLNAPKIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  75

Query  252  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  431
            EVISILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEA
Sbjct  76   EVISILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEA  135

Query  432  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  136  KFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  179



>ref|XP_003568916.1| PREDICTED: 40S ribosomal protein S4 [Brachypodium distachyon]
Length=265

 Score =   313 bits (801),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR +LVDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE++K
Sbjct  61   VQSILMQRQILVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDSK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKID  163



>dbj|BAD22763.1| ribosomal protein [Bromus inermis]
Length=265

 Score =   312 bits (800),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 142/163 (87%), Positives = 158/163 (97%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQRH++VDGKVRTDKTYPAGFMD++SIPKT EN+RL YDTKGRFRLHS+RDE+AK
Sbjct  61   VQSILMQRHIMVDGKVRTDKTYPAGFMDIISIPKTGENYRLLYDTKGRFRLHSVRDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG+KGIP++NT DGRTIRYPDPLIKANDT+KLD
Sbjct  121  YKLCKVRSVQFGQKGIPYLNTNDGRTIRYPDPLIKANDTIKLD  163



>gb|KJB29915.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=262

 Score =   310 bits (794),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 157/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MTRGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>gb|EEE63465.1| hypothetical protein OsJ_18278 [Oryza sativa Japonica Group]
Length=398

 Score =   315 bits (806),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 146/162 (90%), Positives = 157/162 (97%), Gaps = 0/162 (0%)
 Frame = +3

Query  78   ARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREV  257
            ARGLKKH+KRLNAP HWMLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREV
Sbjct  137  ARGLKKHLKRLNAPSHWMLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREV  196

Query  258  ISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKF  437
            ISILMQRHV+VDGKVRTDKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKF
Sbjct  197  ISILMQRHVMVDGKVRTDKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKF  256

Query  438  KLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KLCKVRSVQFG+KGIPF+NT DGRTIRYPDPLIKANDT+K+D
Sbjct  257  KLCKVRSVQFGQKGIPFLNTNDGRTIRYPDPLIKANDTIKID  298



>emb|CDY32700.1| BnaA02g07620D [Brassica napus]
Length=301

 Score =   311 bits (796),  Expect = 4e-103, Method: Compositional matrix adjust.
 Identities = 145/164 (88%), Positives = 156/164 (95%), Gaps = 0/164 (0%)
 Frame = +3

Query  72   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  251
            TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYR
Sbjct  42   TMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  101

Query  252  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  431
            EVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DEEA
Sbjct  102  EVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDEEA  161

Query  432  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KFKLCKVR++ FG+KGIP++NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  162  KFKLCKVRTISFGQKGIPYLNTYDGRTIRYPDPLIKPNDTIKLD  205



>gb|KHG30303.1| 40S ribosomal S4 [Gossypium arboreum]
Length=262

 Score =   309 bits (792),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 143/163 (88%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VDGKVRTDKTYP GFMDVVSIPKTNE+FRL YDTKGRF LH+I  +E K
Sbjct  61   VIAILMQRHVMVDGKVRTDKTYPTGFMDVVSIPKTNEDFRLLYDTKGRFCLHAITGDETK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+K IP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  FKLCKVRSVQFGQKSIPYLNTYDGRTIRYPDPLIKANDTIKLD  163



>ref|XP_009781828.1| PREDICTED: 40S ribosomal protein S4-like [Nicotiana sylvestris]
Length=259

 Score =   305 bits (782),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 144/163 (88%), Positives = 155/163 (95%), Gaps = 5/163 (3%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPK+WMLDKLGGAFAPKPSSGPHKSRECLPL++I+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKYWMLDKLGGAFAPKPSSGPHKSRECLPLIIILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQR V+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS     AK
Sbjct  61   VISILMQRQVMVDSKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHS-----AK  115

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRS+QFG+KGIP++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  116  FKLCKVRSIQFGQKGIPYLNTYDGRTIRYPDPLIKANDTIKLD  158



>gb|EMT14698.1| 40S ribosomal protein S4 [Aegilops tauschii]
Length=259

 Score =   305 bits (782),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 138/163 (85%), Positives = 156/163 (96%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWM++KLGGAFAPKPSSGPHK+RECLPL+L++RNRLKYALTY E
Sbjct  1    MARGLKKHVKRLNAPKHWMVEKLGGAFAPKPSSGPHKARECLPLILMLRNRLKYALTYSE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SI+MQRH++VDGKVRTDKTYPAGFMDVVSIPKT ENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VVSIMMQRHIMVDGKVRTDKTYPAGFMDVVSIPKTGENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR+VQ G+KG+P +NTYDGRTIRYPDP IK NDT+K+D
Sbjct  121  FKLCKVRTVQCGQKGVPSLNTYDGRTIRYPDPAIKPNDTIKID  163



>ref|XP_009126753.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X2 [Brassica 
rapa]
Length=319

 Score =   306 bits (785),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/164 (88%), Positives = 155/164 (95%), Gaps = 0/164 (0%)
 Frame = +3

Query  72   TMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYR  251
            TMARGLKKH+KRLNAP  W LDKLGGAFAPKPSSGPHKSRECLPLVLIIRN+LKYALTYR
Sbjct  60   TMARGLKKHLKRLNAPTIWGLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNKLKYALTYR  119

Query  252  EVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEA  431
            EVI+ILMQRH+ VDGKVRTDKTYPAGFMDVVSIPKTNE FRL YDTKGRFRLHSI+DEEA
Sbjct  120  EVIAILMQRHIQVDGKVRTDKTYPAGFMDVVSIPKTNECFRLLYDTKGRFRLHSIKDEEA  179

Query  432  KFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            KFKLCKVR++ FG+KGIP++NTYDGR IRYPDPLIK NDT+KLD
Sbjct  180  KFKLCKVRTISFGQKGIPYLNTYDGRPIRYPDPLIKPNDTIKLD  223



>gb|ABK21170.1| unknown [Picea sitchensis]
 gb|ABK22318.1| unknown [Picea sitchensis]
 gb|ABR17884.1| unknown [Picea sitchensis]
Length=263

 Score =   302 bits (773),  Expect = 3e-100, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+D
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKID  163



>gb|ABK22322.1| unknown [Picea sitchensis]
 gb|ABK22679.1| unknown [Picea sitchensis]
 gb|ACN39835.1| unknown [Picea sitchensis]
 gb|ACN40504.1| unknown [Picea sitchensis]
 gb|ACN40833.1| unknown [Picea sitchensis]
Length=263

 Score =   302 bits (773),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 139/163 (85%), Positives = 154/163 (94%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV++IRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKGRECLPLVVLIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+I+MQR + VDGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRFRLHSI+DEEAK
Sbjct  61   VIAIVMQRLISVDGKVRTDKCYPAGFMDVLSIAKTNENFRLLYDAKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRSVQFG KGIP++NTYDGRTIRYPDPL+KANDT+K+D
Sbjct  121  YKLCKVRSVQFGDKGIPYLNTYDGRTIRYPDPLVKANDTIKVD  163



>sp|O81363.1|RS4_PRUAR RecName: Full=40S ribosomal protein S4 [Prunus armeniaca]
 gb|AAC24585.1| 40S ribosomal protein S4 [Prunus armeniaca]
Length=261

 Score =   297 bits (760),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 141/163 (87%), Positives = 152/163 (93%), Gaps = 4/163 (2%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQRH+LVDGK+     +     DVVSIPKTNENFRL YDTKGRFRLHSIRDEE+K
Sbjct  61   VVSILMQRHILVDGKIH----FCIRLSDVVSIPKTNENFRLLYDTKGRFRLHSIRDEESK  116

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVRSVQFG+KGIP+INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  117  FKLCKVRSVQFGQKGIPYINTYDGRTIRYPDPLIKANDTIKLD  159



>gb|KDO67006.1| hypothetical protein CISIN_1g024108mg [Citrus sinensis]
Length=247

 Score =   291 bits (746),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 137/145 (94%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVD KVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDAKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLD  145



>emb|CBI15899.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   291 bits (745),  Expect = 3e-96, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>emb|CDP06439.1| unnamed protein product [Coffea canephora]
Length=246

 Score =   291 bits (745),  Expect = 4e-96, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVISILMQRH+LVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVISILMQRHILVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>gb|KHN03095.1| 40S ribosomal protein S4 [Glycine soja]
Length=246

 Score =   291 bits (744),  Expect = 6e-96, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDTVKLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTVKLD  145



>ref|XP_008778562.1| PREDICTED: 40S ribosomal protein S4-3-like [Phoenix dactylifera]
Length=247

 Score =   290 bits (742),  Expect = 9e-96, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>gb|KDO63242.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=244

 Score =   290 bits (741),  Expect = 1e-95, Method: Compositional matrix adjust.
 Identities = 136/145 (94%), Positives = 144/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            INTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  INTYDGRTIRYPDPLIKANDTIKLD  145



>ref|XP_001780588.1| predicted protein [Physcomitrella patens]
 gb|EDQ54571.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKIN  163



>ref|XP_001759850.1| predicted protein [Physcomitrella patens]
 gb|EDQ75354.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   289 bits (739),  Expect = 5e-95, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 149/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS QFG KG+P+I T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRSAQFGDKGVPYITTFDGRTIRYPDPLIKANDTVKIN  163



>emb|CBI25428.3| unnamed protein product [Vitis vinifera]
Length=246

 Score =   288 bits (737),  Expect = 6e-95, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 143/145 (99%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHIFVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEEAKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>ref|NP_001031846.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
 gb|AED91108.1| 40S ribosomal protein S4-2 [Arabidopsis thaliana]
Length=244

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLD  145



>dbj|BAB10257.1| ribosomal protein S4 [Arabidopsis thaliana]
Length=244

 Score =   287 bits (735),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAKFKLCKVRSIQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLD  145



>ref|XP_009126752.1| PREDICTED: 40S ribosomal protein S4-1-like isoform X1 [Brassica 
rapa]
Length=348

 Score =   291 bits (744),  Expect = 1e-94, Method: Compositional matrix adjust.
 Identities = 144/193 (75%), Positives = 155/193 (80%), Gaps = 29/193 (15%)
 Frame = +3

Query  72   TMARGLKKHMKRLNAPKHWMLDKLGGAF-----------------------------APK  164
            TMARGLKKH+KRLNAP  W LDKLGGAF                             APK
Sbjct  60   TMARGLKKHLKRLNAPTIWGLDKLGGAFVCLLVSLYTHAFHLFIVWMTMLARIGSKQAPK  119

Query  165  PSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVV  344
            PSSGPHKSRECLPLVLIIRN+LKYALTYREVI+ILMQRH+ VDGKVRTDKTYPAGFMDVV
Sbjct  120  PSSGPHKSRECLPLVLIIRNKLKYALTYREVIAILMQRHIQVDGKVRTDKTYPAGFMDVV  179

Query  345  SIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYP  524
            SIPKTNE FRL YDTKGRFRLHSI+DEEAKFKLCKVR++ FG+KGIP++NTYDGR IRYP
Sbjct  180  SIPKTNECFRLLYDTKGRFRLHSIKDEEAKFKLCKVRTISFGQKGIPYLNTYDGRPIRYP  239

Query  525  DPLIKANDTVKLD  563
            DPLIK NDT+KLD
Sbjct  240  DPLIKPNDTIKLD  252



>ref|XP_010509192.1| PREDICTED: 40S ribosomal protein S4-3-like [Camelina sativa]
Length=244

 Score =   286 bits (733),  Expect = 2e-94, Method: Compositional matrix adjust.
 Identities = 135/145 (93%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHIQVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLHSIRDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNESFRLLYDTKGRFRLHSIRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLD  145



>ref|XP_001759591.1| predicted protein [Physcomitrella patens]
 gb|EDQ75503.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKIN  163



>ref|XP_001751877.1| predicted protein [Physcomitrella patens]
 gb|EDQ83312.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   287 bits (734),  Expect = 3e-94, Method: Compositional matrix adjust.
 Identities = 131/163 (80%), Positives = 148/163 (91%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAP+HWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPRHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH+I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHNISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKIN  163



>ref|XP_001766039.1| predicted protein [Physcomitrella patens]
 gb|EDQ69098.1| predicted protein [Physcomitrella patens]
Length=308

 Score =   287 bits (735),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 132/163 (81%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVRS QFG KG+P I T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRSAQFGDKGVPHITTFDGRTIRYPDPLIKANDTVKIN  163



>ref|XP_001785339.1| predicted protein [Physcomitrella patens]
 gb|EDQ49851.1| predicted protein [Physcomitrella patens]
Length=263

 Score =   285 bits (730),  Expect = 1e-93, Method: Compositional matrix adjust.
 Identities = 130/163 (80%), Positives = 147/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPS GPHK RECLPLV+++RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSPGPHKERECLPLVVMLRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQR + +DGKVRTDK YPAGFMDV+SI KTNENFRL YD KGRF LH I  EEAK
Sbjct  61   VVAIVMQRLISIDGKVRTDKCYPAGFMDVISIAKTNENFRLLYDNKGRFTLHHISAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVR+ QFG KG+P + T+DGRTIRYPDPLIKANDTVK++
Sbjct  121  YKLCKVRAAQFGDKGVPHVTTFDGRTIRYPDPLIKANDTVKIN  163



>gb|KFK40122.1| hypothetical protein AALP_AA3G333200 [Arabis alpina]
Length=216

 Score =   282 bits (722),  Expect = 4e-93, Method: Compositional matrix adjust.
 Identities = 133/145 (92%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLIIR+RLKYALTY EVISILMQRH+ VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRDRLKYALTYSEVISILMQRHIQVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRS+QFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSIQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIK NDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKPNDTIKLD  145



>emb|CBI18118.3| unnamed protein product [Vitis vinifera]
Length=205

 Score =   281 bits (719),  Expect = 7e-93, Method: Compositional matrix adjust.
 Identities = 132/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYP+GFMDVVSIPKTNENFRL YDTKGRFRLHSIRDEEAKFKLCKV+ VQFG+KGIP+
Sbjct  61   DKTYPSGFMDVVSIPKTNENFRLLYDTKGRFRLHSIRDEEAKFKLCKVKGVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVK  557
            +NTYDGRTIRYPDPLIKANDT K
Sbjct  121  LNTYDGRTIRYPDPLIKANDTHK  143



>gb|KHG11751.1| 40S ribosomal S4 [Gossypium arboreum]
Length=244

 Score =   281 bits (719),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 142/145 (98%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>gb|AAT38019.1| putative 40S ribosomal protein S4 [Oryza sativa Japonica Group]
Length=245

 Score =   281 bits (719),  Expect = 3e-92, Method: Compositional matrix adjust.
 Identities = 131/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHK+RECLPL+LI+RNRLKYALTYREVISILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKARECLPLILILRNRLKYALTYREVISILMQRHVMVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSI KT ENFRL YDTKGRFRLHSI+DE+AKFKLCKVRSVQFG+KGIPF
Sbjct  61   DKTYPAGFMDVVSIAKTGENFRLLYDTKGRFRLHSIKDEDAKFKLCKVRSVQFGQKGIPF  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NT DGRTIRYPDPLIKANDT+K+D
Sbjct  121  LNTNDGRTIRYPDPLIKANDTIKID  145



>gb|KJB77064.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=244

 Score =   280 bits (715),  Expect = 1e-91, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>gb|KJB38000.1| hypothetical protein B456_006G231800 [Gossypium raimondii]
Length=244

 Score =   279 bits (714),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 130/145 (90%), Positives = 141/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPLVLI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLVLILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKTNE+FRL YDTKGRFRLH+I  +E+KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTNEDFRLLYDTKGRFRLHAITGDESKFKLCKVRSVQFGRKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+K D
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKFD  145



>emb|CAA75242.1| ribosomal protein S4 [Oryza sativa Japonica Group]
Length=268

 Score =   279 bits (713),  Expect = 4e-91, Method: Compositional matrix adjust.
 Identities = 129/142 (91%), Positives = 139/142 (98%), Gaps = 0/142 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LIIRNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILIIRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VISILMQRHVLVDGKVRTDKTYPAGFMDV+SIPKT EN+RL YDTKGRFRL S++DE+AK
Sbjct  61   VISILMQRHVLVDGKVRTDKTYPAGFMDVISIPKTGENYRLLYDTKGRFRLQSVKDEDAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTY  500
            FKLCKVRSVQFG+KGIP++NTY
Sbjct  121  FKLCKVRSVQFGQKGIPYLNTY  142



>ref|XP_002984314.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
 gb|EFJ14824.1| hypothetical protein SELMODRAFT_271698 [Selaginella moellendorffii]
Length=258

 Score =   277 bits (709),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINSEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKID  163



>ref|XP_002972484.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
 gb|EFJ26570.1| hypothetical protein SELMODRAFT_148442 [Selaginella moellendorffii]
Length=258

 Score =   276 bits (707),  Expect = 3e-90, Method: Compositional matrix adjust.
 Identities = 125/163 (77%), Positives = 146/163 (90%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+K LNAPKHWML KLGGAFAPKPSSGPHK RECLPLV+++RNRL YALTYRE
Sbjct  1    MVRGPKKHLKVLNAPKHWMLSKLGGAFAPKPSSGPHKERECLPLVIVLRNRLNYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++I+MQ+ + +DGKVRTDK YPAGFMDV+++ K +EN+RL YD+KGRF LHSI  EEAK
Sbjct  61   VVAIVMQKLISIDGKVRTDKCYPAGFMDVLTVGKVDENYRLLYDSKGRFTLHSINAEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            FKLCKVR+V+FG KGIPF+ TYDGRTIRYPDPLIKANDT+K+D
Sbjct  121  FKLCKVRAVRFGAKGIPFLTTYDGRTIRYPDPLIKANDTIKID  163



>gb|KJB29916.1| hypothetical protein B456_005G123400 [Gossypium raimondii]
Length=244

 Score =   275 bits (703),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/145 (88%), Positives = 140/145 (97%), Gaps = 0/145 (0%)
 Frame = +3

Query  129  MLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRT  308
            MLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRT
Sbjct  1    MLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRT  60

Query  309  DKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPF  488
            DKTYPAGFMDVVSIPKT+E+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP+
Sbjct  61   DKTYPAGFMDVVSIPKTSEDFRLLYDTKGRFCLHAITSDETKFKLCKVRSVQFGQKGIPY  120

Query  489  INTYDGRTIRYPDPLIKANDTVKLD  563
            +NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  LNTYDGRTIRYPDPLIKANDTIKLD  145



>ref|XP_006576177.1| PREDICTED: uncharacterized protein LOC100500000 isoform X2 [Glycine 
max]
Length=248

 Score =   273 bits (698),  Expect = 5e-89, Method: Compositional matrix adjust.
 Identities = 129/147 (88%), Positives = 139/147 (95%), Gaps = 2/147 (1%)
 Frame = +3

Query  129  MLDKLG--GAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKV  302
            ML   G   + APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHVLVDGKV
Sbjct  1    MLQNTGCLTSLAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVLVDGKV  60

Query  303  RTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGI  482
            RTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEE+KFKLCKVRSVQFG+KGI
Sbjct  61   RTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSVRDEESKFKLCKVRSVQFGQKGI  120

Query  483  PFINTYDGRTIRYPDPLIKANDTVKLD  563
            P++NTYDGRTIRYPDPLIKANDT+KLD
Sbjct  121  PYLNTYDGRTIRYPDPLIKANDTIKLD  147



>gb|KDO63240.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=284

 Score =   274 bits (700),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 128/139 (92%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +3

Query  147  GAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPA  326
            G  APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPA
Sbjct  47   GLQAPKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPA  106

Query  327  GFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDG  506
            GFMDVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDG
Sbjct  107  GFMDVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDG  166

Query  507  RTIRYPDPLIKANDTVKLD  563
            RTIRYPDPLIKANDT+KLD
Sbjct  167  RTIRYPDPLIKANDTIKLD  185



>gb|KDO63241.1| hypothetical protein CISIN_1g023289mg [Citrus sinensis]
Length=254

 Score =   271 bits (694),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 127/136 (93%), Positives = 135/136 (99%), Gaps = 0/136 (0%)
 Frame = +3

Query  156  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  335
            APKPSSGPHKSRECLPL+L++RNRLKYALTYREVI+ILMQRHVLVDGKVRTDKTYPAGFM
Sbjct  20   APKPSSGPHKSRECLPLILVLRNRLKYALTYREVIAILMQRHVLVDGKVRTDKTYPAGFM  79

Query  336  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  515
            DVVSIPKTNENFRL YDTKGRFRLHS+RDEEAKFKLCKVRSVQFG+KGIP+INTYDGRTI
Sbjct  80   DVVSIPKTNENFRLLYDTKGRFRLHSLRDEEAKFKLCKVRSVQFGQKGIPYINTYDGRTI  139

Query  516  RYPDPLIKANDTVKLD  563
            RYPDPLIKANDT+KLD
Sbjct  140  RYPDPLIKANDTIKLD  155



>gb|AFK41206.1| unknown [Lotus japonicus]
Length=141

 Score =   262 bits (670),  Expect = 3e-86, Method: Compositional matrix adjust.
 Identities = 122/134 (91%), Positives = 132/134 (99%), Gaps = 0/134 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPL+LI+RNRLKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLILILRNRLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRH+LVDGKVRTDKTYP+GFMDVVSIPKTNENFRL YD KGRFRLHS+RD+EAK
Sbjct  61   VIAILMQRHILVDGKVRTDKTYPSGFMDVVSIPKTNENFRLLYDIKGRFRLHSVRDDEAK  120

Query  435  FKLCKVRSVQFGKK  476
            FKLCKVRSVQFG++
Sbjct  121  FKLCKVRSVQFGQR  134



>dbj|GAN07411.1| 40S ribosomal protein S4 [Mucor ambiguus]
 dbj|GAN00618.1| 40S ribosomal protein S4 [Mucor ambiguus]
Length=262

 Score =   264 bits (675),  Expect = 2e-85, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKHMKRL APKHWMLDKL GA+APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGAYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KG+P+I T+DGR+IRYPDPLIKANDT++ +
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRSIRYPDPLIKANDTIRFN  163



>ref|XP_005850141.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
 gb|EFN58039.1| hypothetical protein CHLNCDRAFT_59606 [Chlorella variabilis]
Length=261

 Score =   263 bits (672),  Expect = 6e-85, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKH+KRLNAPKHWMLDKLGG FAPKPS GPHK+RECLPL+L++RNRLKYALT +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLGGIFAPKPSPGPHKTRECLPLILLLRNRLKYALTGKE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTDKTYP GFMDV+ IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VTSILMQRLVEVDGKVRTDKTYPVGFMDVIDIPKTDEHFRLVYDAKGRFVVHRITKEEAS  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ + FGK GIP I T+DGRT+RYPDP IK NDTV LD
Sbjct  121  YKLCKVKRLAFGKGGIPHIGTHDGRTVRYPDPEIKVNDTVMLD  163



>gb|KFH71854.1| 40S ribosomal protein S4 [Mortierella verticillata NRRL 6337]
Length=259

 Score =   263 bits (672),  Expect = 7e-85, Method: Compositional matrix adjust.
 Identities = 122/163 (75%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKH+KRLNAPKHWMLDKL G +AP+P++GPHK RECLPLV++IRNRLKYAL  +E
Sbjct  1    MARGPKKHLKRLNAPKHWMLDKLTGTYAPRPTAGPHKLRECLPLVILIRNRLKYALNGKE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD TYPAGFMD ++I KT ENFRL YDTKGRF +H I  EEA+
Sbjct  61   VQSILMQRLVKVDGKVRTDSTYPAGFMDAITIEKTGENFRLVYDTKGRFTVHRITAEEAQ  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ VQ G KGIPF+ T+DGRT+RYPDPLIK NDT+KLD
Sbjct  121  YKLCKVKKVQLGAKGIPFVVTHDGRTLRYPDPLIKVNDTIKLD  163



>gb|EIE83303.1| 40S ribosomal protein S4 [Rhizopus delemar RA 99-880]
Length=263

 Score =   263 bits (671),  Expect = 9e-85, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ +
Sbjct  121  YKLCKVKKVLIGSKGVPYITTHDGRTIRYPDPLIKTNDTVRFN  163



>gb|KJB36905.1| hypothetical protein B456_006G184600 [Gossypium raimondii]
Length=237

 Score =   261 bits (668),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/136 (89%), Positives = 132/136 (97%), Gaps = 0/136 (0%)
 Frame = +3

Query  156  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  335
            APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  336  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  515
            DVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  516  RYPDPLIKANDTVKLD  563
            RYPDPLIKANDT+KLD
Sbjct  123  RYPDPLIKANDTIKLD  138



>gb|KJB77063.1| hypothetical protein B456_012G118500 [Gossypium raimondii]
Length=251

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 133/137 (97%), Gaps = 0/137 (0%)
 Frame = +3

Query  153  FAPKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGF  332
            +APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGF
Sbjct  16   YAPKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGF  75

Query  333  MDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRT  512
            MDVVSIPKTNE+FRL YDTKGRFRLH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRT
Sbjct  76   MDVVSIPKTNEDFRLLYDTKGRFRLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRT  135

Query  513  IRYPDPLIKANDTVKLD  563
            IRYPDPLIKANDT+KLD
Sbjct  136  IRYPDPLIKANDTIKLD  152



>emb|CEG70586.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI95018.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   262 bits (670),  Expect = 1e-84, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKVR V  G KG+P+I T+DGRTIRYPDPLIKANDT++ +
Sbjct  121  YKLCKVRKVMIGAKGVPYITTHDGRTIRYPDPLIKANDTIRFN  163



>gb|AAX19871.1| putative ribosomal protein S4, partial [Doryanthes excelsa]
Length=131

 Score =   257 bits (656),  Expect = 2e-84, Method: Compositional matrix adjust.
 Identities = 119/131 (91%), Positives = 129/131 (98%), Gaps = 0/131 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARGLKKH+KRLNAPKHWML+KLGGAFAPKPSSGPHK+RECLPL+LI+RN+LKYALTYRE
Sbjct  1    MARGLKKHLKRLNAPKHWMLNKLGGAFAPKPSSGPHKARECLPLILILRNKLKYALTYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            VI+ILMQRHV+VD KVRTDKTYPAGFMDVVSIPKTNENFRL YDTKGRFRLHSI+DEEAK
Sbjct  61   VIAILMQRHVMVDAKVRTDKTYPAGFMDVVSIPKTNENFRLLYDTKGRFRLHSIKDEEAK  120

Query  435  FKLCKVRSVQF  467
            FKLCKVR+VQF
Sbjct  121  FKLCKVRNVQF  131



>gb|KDD75424.1| hypothetical protein H632_c691p0 [Helicosporidium sp. ATCC 50920]
Length=262

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPSSGPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSSGPHKTRECLPLILMLRNRLKYALTGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILM R V VDGKVRTDKTYP GFMDVV+IPKT+E+FRL YD+KGRF +H I  EEA 
Sbjct  61   VTSILMNRLVEVDGKVRTDKTYPVGFMDVVTIPKTSEHFRLIYDSKGRFAVHRITPEEAT  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ +QFG+ G+P++ T+DGRT+RYPDP I+  DTV  D
Sbjct  121  YKLCKVKRMQFGRGGVPYVATHDGRTMRYPDPAIREGDTVVFD  163



>emb|CEP14949.1| hypothetical protein [Parasitella parasitica]
Length=264

 Score =   261 bits (667),  Expect = 4e-84, Method: Compositional matrix adjust.
 Identities = 123/163 (75%), Positives = 137/163 (84%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKQRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+SI KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDTV+ +
Sbjct  121  YKLCKVKKVLVGSKGVPYITTHDGRTIRYPDPLIKVNDTVRFN  163



>emb|CEI87363.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   261 bits (666),  Expect = 5e-84, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +
Sbjct  121  YKLCKVKKVLIGAKGIPYITTHDGRTIRYPDPLIKANDTIRFN  163



>emb|CEG72922.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
 emb|CEI90971.1| Putative 40S ribosomal protein S4-A [Rhizopus microsporus]
Length=263

 Score =   261 bits (666),  Expect = 6e-84, Method: Compositional matrix adjust.
 Identities = 124/163 (76%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG KKHMKRL APKHWMLDKL G +APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MARGPKKHMKRLAAPKHWMLDKLLGNYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+ I KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVIQIEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KGIP+I T+DGRTIRYPDPLIKANDT++ +
Sbjct  121  YKLCKVKKVLVGAKGIPYITTHDGRTIRYPDPLIKANDTIRFN  163



>gb|EIE90129.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   260 bits (665),  Expect = 7e-84, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ +
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFN  163



>gb|EIE79548.1| 40S ribosomal protein S4-A [Rhizopus delemar RA 99-880]
Length=262

 Score =   260 bits (664),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 121/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKHMKRL APKHWMLDKL G++APKPSSGPHK+RECLPL++ IRNRLKYAL  RE
Sbjct  1    MGRGPKKHMKRLAAPKHWMLDKLLGSYAPKPSSGPHKTRECLPLIVFIRNRLKYALNGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD T+PAGFMDV+S+ KT ENFRL YD KGRF +H I DEEAK
Sbjct  61   VQSILMQRLVKVDGKVRTDSTFPAGFMDVISVEKTGENFRLVYDVKGRFAVHRITDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ V  G KG+P+I T+DGRTIRYPDPLIK NDT++ +
Sbjct  121  YKLCKVKKVMIGSKGVPYITTHDGRTIRYPDPLIKTNDTIRFN  163



>gb|KJB17112.1| hypothetical protein B456_002G266000 [Gossypium raimondii]
Length=237

 Score =   258 bits (660),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 120/136 (88%), Positives = 131/136 (96%), Gaps = 0/136 (0%)
 Frame = +3

Query  156  APKPSSGPHKSRECLPLVLIIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFM  335
            APKPSSGPHKSRECLPL+LI+RNRLKYALTYREVI+ILMQRHV+VDGKVRTDKTYPAGFM
Sbjct  3    APKPSSGPHKSRECLPLILILRNRLKYALTYREVIAILMQRHVMVDGKVRTDKTYPAGFM  62

Query  336  DVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTI  515
            DVVSIPKTNE+FRL YDTKGRF LH+I  +E KFKLCKVRSVQFG+KGIP++NTYDGRTI
Sbjct  63   DVVSIPKTNEDFRLLYDTKGRFCLHAITGDETKFKLCKVRSVQFGQKGIPYLNTYDGRTI  122

Query  516  RYPDPLIKANDTVKLD  563
            RYPDPLIKANDT+KLD
Sbjct  123  RYPDPLIKANDTIKLD  138



>ref|XP_006679983.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF79221.1| hypothetical protein BATDEDRAFT_35382 [Batrachochytrium dendrobatidis 
JAM81]
Length=293

 Score =   260 bits (665),  Expect = 2e-83, Method: Compositional matrix adjust.
 Identities = 123/177 (69%), Positives = 145/177 (82%), Gaps = 2/177 (1%)
 Frame = +3

Query  39   HRRRPNTQ--LSTTMARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVL  212
            H   P+ Q  LS+   RG KKH+KRLNAPKHWMLDKL G +APKPS+GPHK+RECLPL++
Sbjct  17   HDEIPSRQYRLSSDNGRGPKKHLKRLNAPKHWMLDKLTGTWAPKPSAGPHKTRECLPLIV  76

Query  213  IIRNRLKYALTYREVISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTK  392
             IRNRL+YALT +E  +I+ QR + VDGKVRTD TYPAGFMDV+SI KT ENFRL YD K
Sbjct  77   FIRNRLRYALTNQETKAIVNQRLIKVDGKVRTDMTYPAGFMDVISIEKTGENFRLIYDVK  136

Query  393  GRFRLHSIRDEEAKFKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            GRF +H I DEEAK+KLCKVR V+ G+K IP+I T+DGRTIRYPDPL+K NDTVK+D
Sbjct  137  GRFTIHRITDEEAKYKLCKVRQVKIGQKAIPYIVTHDGRTIRYPDPLVKVNDTVKVD  193



>ref|XP_011402198.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
 gb|KFM29145.1| 40S ribosomal protein S4-3 [Auxenochlorella protothecoides]
Length=263

 Score =   258 bits (659),  Expect = 5e-83, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+KRLNAPKHWMLDKLGG FAPKPS+GPHK+RECLPL+L++RNRLKYALT RE
Sbjct  1    MVRGPKKHLKRLNAPKHWMLDKLGGIFAPKPSAGPHKTRECLPLILLLRNRLKYALTGRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V++IL  R V VDGKVRTDKTYP GFMD ++IPKT+E+FRL YD KGRF +H I  EEA 
Sbjct  61   VVAILKNRLVQVDGKVRTDKTYPVGFMDTITIPKTDEHFRLVYDAKGRFVVHRISKEEAT  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ +QFGK  IP+I T+DGRTIRYPDP I+ NDTV LD
Sbjct  121  YKLCKVKRMQFGKGAIPYIATHDGRTIRYPDPDIRENDTVLLD  163



>gb|KGG52703.1| hypothetical protein DI09_141p50 [Microsporidia sp. UGP3]
Length=261

 Score =   258 bits (659),  Expect = 6e-83, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH+KR+ APK WMLDKL G FAP+PS+GPHK RECLPL++ +RNRLKYALT +E
Sbjct  1    MARGIKKHLKRMAAPKSWMLDKLSGTFAPRPSTGPHKLRECLPLIVFLRNRLKYALTRKE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V+SILMQR V VD KVRTD TYPAGFMDV+SI KTNENFRL YDTKGRF +H I +EEAK
Sbjct  61   VMSILMQRLVKVDHKVRTDTTYPAGFMDVISIEKTNENFRLLYDTKGRFVIHRISEEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+  Q G KG+PFI T+DGRT RYPDP I+ NDTVK +
Sbjct  121  YKLCKVKKCQLGAKGVPFIVTHDGRTFRYPDPSIRVNDTVKFN  163



>ref|XP_002954897.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
 gb|EFJ44096.1| component of cytosolic 80S ribosome and 40S small subunit [Volvox 
carteri f. nagariensis]
Length=261

 Score =   258 bits (658),  Expect = 9e-83, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD TYP GFMDV+SI KT+E+FRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISIEKTDEHFRLVLDTKGRFVVHRISKEEAA  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLC+VR VQFGK G+P++ T+DGRT+RYPDP +KAND+V LD
Sbjct  121  YKLCRVRKVQFGKGGVPYVATHDGRTVRYPDPEVKANDSVMLD  163



>ref|XP_008600052.1| ribosomal family S4e [Beauveria bassiana ARSEF 2860]
 gb|EJP64351.1| ribosomal family S4e [Beauveria bassiana ARSEF 2860]
 gb|KGQ07265.1| 40S ribosomal protein S4 [Beauveria bassiana D1-5]
Length=259

 Score =   257 bits (657),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
              SILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TRSILMQRLVKVDGKVRTDMTYPAGFMDVISIEKTGENFRLIYDTKGRFTVHRIQAEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KL KV+ VQ GK GIPF+ T+D RTIRYPDPLIK NDTVK+D
Sbjct  121  YKLGKVKRVQLGKGGIPFLVTHDARTIRYPDPLIKVNDTVKID  163



>emb|CCE33652.1| probable ribosomal protein S4.e, cytosolic [Claviceps purpurea 
20.1]
Length=260

 Score =   257 bits (656),  Expect = 1e-82, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+CLPL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCLPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
              SILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKSILMQRLVKVDGKVRTDSTYPAGFMDVISIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+D
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKID  163



>ref|XP_001691218.1| ribosomal protein S4, component of cytosolic 80S ribosome and 
40S small subunit [Chlamydomonas reinhardtii]
 gb|EDP04951.1| ribosomal protein S4 [Chlamydomonas reinhardtii]
Length=261

 Score =   257 bits (656),  Expect = 2e-82, Method: Compositional matrix adjust.
 Identities = 120/163 (74%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+KRLNAP HWMLDKL G FAPKPS+GPHK RECLPL+LI+RNRLKYALT +E
Sbjct  1    MVRGPKKHLKRLNAPYHWMLDKLSGIFAPKPSAGPHKQRECLPLLLILRNRLKYALTGKE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V SILMQR V VDGKVRTD TYP GFMDV+S+ KT+ENFRL  DTKGRF +H I  EEA 
Sbjct  61   VQSILMQRLVKVDGKVRTDHTYPTGFMDVISMEKTDENFRLVLDTKGRFVVHRISKEEAA  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLC+VR V+FGK G+P++ T+DGRTIRYPDP IKAND++ LD
Sbjct  121  YKLCRVRKVEFGKGGVPYVITHDGRTIRYPDPEIKANDSIMLD  163



>gb|EQL02576.1| Ribosomal protein S4e [Ophiocordyceps sinensis CO18]
Length=258

 Score =   255 bits (652),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 139/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGVYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
              +ILMQR V VDGKVRTD TYPAGFMDV++I KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDMTYPAGFMDVITIDKTGENFRLIYDTKGRFTVHRIQTEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLCKV+ VQ G+ GIPF+ T+D RTIRYPDP+IK NDTVK++
Sbjct  121  YKLCKVKRVQLGRGGIPFLVTHDARTIRYPDPMIKVNDTVKIE  163



>gb|KID72648.1| Ribosomal protein S4e, partial [Metarhizium brunneum ARSEF 3297]
Length=261

 Score =   256 bits (653),  Expect = 5e-82, Method: Compositional matrix adjust.
 Identities = 119/163 (73%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+CLPL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCLPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
              +ILMQR V VDGKVRTD TYPAGFMDV+SI KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDMTYPAGFMDVISIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+D
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKID  163



>gb|EPZ32691.1| 40S ribosomal protein S4 [Rozella allomycis CSF55]
Length=261

 Score =   255 bits (652),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            M RG KKH+KRLNAPKHWMLDKL G +AP+PSSGPHK RE LPL++ +RNRLKYALT  E
Sbjct  1    MTRGPKKHLKRLNAPKHWMLDKLSGVWAPRPSSGPHKLRESLPLIVFLRNRLKYALTGHE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V +I+MQR + VD K+RTD TYPAGFMDV+SI KTNENFRL YD KGRF +H I DEEAK
Sbjct  61   VTAIMMQRLIKVDHKIRTDSTYPAGFMDVISIEKTNENFRLIYDVKGRFTIHRISDEEAK  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KLC+V+ +  G KGIP+I T+DGRTIRYPDPLI+ANDTVKL+
Sbjct  121  YKLCRVKKLAIGAKGIPYIVTHDGRTIRYPDPLIRANDTVKLN  163



>ref|XP_009259092.1| hypothetical protein FPSE_07699 [Fusarium pseudograminearum CS3096]
 ref|XP_011320018.1| 40S ribosomal protein S4 [Fusarium graminearum PH-1]
 gb|EKJ72074.1| hypothetical protein FPSE_07699 [Fusarium pseudograminearum CS3096]
 gb|ESU14593.1| 40S ribosomal protein S4 [Fusarium graminearum PH-1]
 gb|EYB29880.1| hypothetical protein FG05_08714 [Fusarium graminearum]
 emb|CEF77124.1| unnamed protein product [Fusarium graminearum]
Length=261

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 116/163 (71%), Positives = 140/163 (86%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+C+PL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCMPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
            V +ILMQR V VDGKVRTD T+P+GFMDV++I KT ENFRL YDTKGRF +H I++EEA+
Sbjct  61   VKAILMQRLVKVDGKVRTDSTFPSGFMDVITIEKTGENFRLVYDTKGRFTVHRIQNEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+D
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKID  163



>ref|XP_007807221.1| ribosomal protein S4 [Metarhizium acridum CQMa 102]
 gb|EFY93098.1| ribosomal protein S4 [Metarhizium acridum CQMa 102]
Length=261

 Score =   254 bits (650),  Expect = 1e-81, Method: Compositional matrix adjust.
 Identities = 118/163 (72%), Positives = 138/163 (85%), Gaps = 0/163 (0%)
 Frame = +3

Query  75   MARGLKKHMKRLNAPKHWMLDKLGGAFAPKPSSGPHKSRECLPLVLIIRNRLKYALTYRE  254
            MARG+KKH KRL+AP HW+LDKL G +APKPS+GPHK R+CLPL++ IRNRLKYAL YRE
Sbjct  1    MARGIKKHQKRLSAPSHWLLDKLSGTYAPKPSAGPHKLRDCLPLIVFIRNRLKYALNYRE  60

Query  255  VISILMQRHVLVDGKVRTDKTYPAGFMDVVSIPKTNENFRLFYDTKGRFRLHSIRDEEAK  434
              +ILMQR V VDGKVRTD TYPAGFMDV++I KT ENFRL YDTKGRF +H I+ EEA+
Sbjct  61   TKAILMQRLVKVDGKVRTDMTYPAGFMDVITIEKTGENFRLVYDTKGRFTVHRIQAEEAE  120

Query  435  FKLCKVRSVQFGKKGIPFINTYDGRTIRYPDPLIKANDTVKLD  563
            +KL KV+ VQ G+ GIPF+ T+D RTIRYPDPLIK NDTVK+D
Sbjct  121  YKLGKVKRVQLGRGGIPFLVTHDARTIRYPDPLIKVNDTVKID  163



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 658693633920