BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A19

Length=461
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP07421.1|  unnamed protein product                                264   1e-83   Coffea canephora [robusta coffee]
ref|XP_011074653.1|  PREDICTED: uncharacterized protein LOC105159331    259   4e-82   Sesamum indicum [beniseed]
ref|XP_011083506.1|  PREDICTED: uncharacterized protein LOC105166016    259   6e-82   Sesamum indicum [beniseed]
gb|KDP36948.1|  hypothetical protein JCGZ_08239                         255   2e-80   Jatropha curcas
gb|AAO14627.1|AF467900_4  hypothetical protein                          254   7e-80   Prunus persica
ref|XP_008221299.1|  PREDICTED: uncharacterized protein LOC103321276    254   7e-80   Prunus mume [ume]
ref|XP_010095168.1|  putative methyltransferase PMT28                   250   4e-78   Morus notabilis
ref|XP_011045126.1|  PREDICTED: uncharacterized protein LOC105140124    249   4e-78   Populus euphratica
ref|XP_002306913.1|  hypothetical protein POPTR_0005s25790g             249   5e-78   Populus trichocarpa [western balsam poplar]
ref|XP_007017750.1|  S-adenosyl-L-methionine-dependent methyltran...    249   5e-78   
gb|EYU38830.1|  hypothetical protein MIMGU_mgv1a007054mg                248   9e-78   Erythranthe guttata [common monkey flower]
ref|XP_006473627.1|  PREDICTED: uncharacterized protein LOC102620145    248   1e-77   Citrus sinensis [apfelsine]
ref|XP_009803492.1|  PREDICTED: uncharacterized protein LOC104248856    248   2e-77   Nicotiana sylvestris
ref|XP_009598077.1|  PREDICTED: uncharacterized protein LOC104093936    248   2e-77   Nicotiana tomentosiformis
ref|XP_009337662.1|  PREDICTED: uncharacterized protein LOC103930096    247   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009335275.1|  PREDICTED: uncharacterized protein LOC103927...    247   3e-77   Pyrus x bretschneideri [bai li]
gb|KJB14424.1|  hypothetical protein B456_002G124500                    247   3e-77   Gossypium raimondii
ref|XP_009350044.1|  PREDICTED: uncharacterized protein LOC103941557    247   3e-77   Pyrus x bretschneideri [bai li]
ref|XP_009335270.1|  PREDICTED: uncharacterized protein LOC103927...    247   4e-77   
ref|XP_010061033.1|  PREDICTED: uncharacterized protein LOC104448821    246   7e-77   Eucalyptus grandis [rose gum]
ref|XP_002510507.1|  ATRAD3, putative                                   248   1e-76   Ricinus communis
ref|XP_006435145.1|  hypothetical protein CICLE_v10001297mg             244   3e-76   Citrus clementina [clementine]
ref|XP_002277626.1|  PREDICTED: uncharacterized protein LOC100259190    243   9e-76   Vitis vinifera
ref|XP_011028977.1|  PREDICTED: uncharacterized protein LOC105128842    243   1e-75   Populus euphratica
ref|XP_008357136.1|  PREDICTED: uncharacterized protein LOC103420870    243   1e-75   Malus domestica [apple tree]
gb|EPS57421.1|  hypothetical protein M569_17397                         243   1e-75   Genlisea aurea
ref|XP_002301989.1|  hypothetical protein POPTR_0002s02640g             241   7e-75   
ref|XP_008442993.1|  PREDICTED: uncharacterized protein LOC103486724    241   1e-74   Cucumis melo [Oriental melon]
ref|XP_004136545.1|  PREDICTED: uncharacterized protein LOC101215265    240   1e-74   Cucumis sativus [cucumbers]
ref|XP_008387957.1|  PREDICTED: uncharacterized protein LOC103450397    239   3e-74   Malus domestica [apple tree]
ref|XP_010692715.1|  PREDICTED: uncharacterized protein LOC104905778    238   2e-73   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006353174.1|  PREDICTED: uncharacterized protein LOC102605433    238   2e-73   Solanum tuberosum [potatoes]
ref|XP_010271414.1|  PREDICTED: uncharacterized protein LOC104607476    237   2e-73   Nelumbo nucifera [Indian lotus]
ref|XP_004499234.1|  PREDICTED: uncharacterized protein LOC101508990    237   4e-73   Cicer arietinum [garbanzo]
ref|XP_004250146.1|  PREDICTED: uncharacterized protein LOC101246201    236   5e-73   Solanum lycopersicum
ref|XP_004291387.1|  PREDICTED: uncharacterized protein LOC101314531    235   2e-72   Fragaria vesca subsp. vesca
ref|XP_003545042.1|  PREDICTED: uncharacterized protein LOC100786...    233   9e-72   Glycine max [soybeans]
ref|XP_007160685.1|  hypothetical protein PHAVU_001G008400g             230   2e-70   Phaseolus vulgaris [French bean]
gb|KEH40211.1|  ATRAD3-like protein                                     228   9e-70   Medicago truncatula
ref|XP_003550415.1|  PREDICTED: uncharacterized protein LOC100812467    228   9e-70   Glycine max [soybeans]
ref|XP_003523577.1|  PREDICTED: uncharacterized protein LOC100798510    227   1e-69   Glycine max [soybeans]
gb|AAK84481.1|  unknown                                                 222   2e-68   Solanum lycopersicum
ref|XP_006395469.1|  hypothetical protein EUTSA_v10004321mg             221   4e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010507038.1|  PREDICTED: uncharacterized protein LOC104783598    218   5e-67   
ref|XP_010425464.1|  PREDICTED: uncharacterized protein LOC104710544    220   5e-67   Camelina sativa [gold-of-pleasure]
ref|XP_010514415.1|  PREDICTED: uncharacterized protein LOC104790374    220   6e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009111558.1|  PREDICTED: uncharacterized protein LOC103836982    220   1e-66   Brassica rapa
ref|XP_007136075.1|  hypothetical protein PHAVU_009G015500g             218   2e-66   Phaseolus vulgaris [French bean]
ref|XP_007136074.1|  hypothetical protein PHAVU_009G015500g             218   4e-66   Phaseolus vulgaris [French bean]
ref|XP_002875365.1|  hypothetical protein ARALYDRAFT_904944             218   6e-66   Arabidopsis lyrata subsp. lyrata
gb|AAM63602.1|  unknown                                                 216   2e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006291222.1|  hypothetical protein CARUB_v10017354mg             216   2e-65   Capsella rubella
gb|AES71185.2|  ATRAD3-like protein                                     211   5e-65   Medicago truncatula
ref|XP_010557488.1|  PREDICTED: uncharacterized protein LOC104826476    214   2e-64   Tarenaya hassleriana [spider flower]
gb|AAL77659.1|  AT3g27230/K17E12_5                                      214   2e-64   Arabidopsis thaliana [mouse-ear cress]
ref|NP_566813.1|  S-adenosyl-L-methionine-dependent methyltransfe...    214   2e-64   Arabidopsis thaliana [mouse-ear cress]
gb|ACJ84820.1|  unknown                                                 207   3e-64   Medicago truncatula
gb|AFK44341.1|  unknown                                                 213   6e-64   Medicago truncatula
gb|KEH36237.1|  ATRAD3-like protein                                     213   6e-64   Medicago truncatula
gb|ACU21328.1|  unknown                                                 206   7e-64   Glycine max [soybeans]
emb|CBI19830.3|  unnamed protein product                                213   1e-63   Vitis vinifera
ref|XP_003600934.1|  hypothetical protein MTR_3g071050                  210   5e-63   
ref|XP_006282947.1|  hypothetical protein CARUB_v10007544mg             209   8e-63   Capsella rubella
ref|NP_198899.1|  S-adenosyl-L-methionine-dependent methyltransfe...    207   1e-61   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010450611.1|  PREDICTED: uncharacterized protein LOC104732...    206   2e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010441241.1|  PREDICTED: uncharacterized protein LOC104724...    206   3e-61   Camelina sativa [gold-of-pleasure]
ref|XP_010450612.1|  PREDICTED: uncharacterized protein LOC104732...    203   1e-60   Camelina sativa [gold-of-pleasure]
ref|XP_002868627.1|  ATRAD3                                             204   1e-60   
ref|XP_002868633.1|  ATRAD3                                             204   2e-60   Arabidopsis lyrata subsp. lyrata
ref|XP_010450613.1|  PREDICTED: uncharacterized protein LOC104732...    202   4e-60   Camelina sativa [gold-of-pleasure]
dbj|BAH57084.1|  AT5G40830                                              201   8e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010441242.1|  PREDICTED: uncharacterized protein LOC104724...    199   3e-59   Camelina sativa [gold-of-pleasure]
emb|CDY20059.1|  BnaA09g01920D                                          189   2e-55   Brassica napus [oilseed rape]
gb|KJB63557.1|  hypothetical protein B456_010G005600                    175   8e-50   Gossypium raimondii
ref|XP_006840653.1|  hypothetical protein AMTR_s00211p00024510          172   8e-50   Amborella trichopoda
gb|AFK39036.1|  unknown                                                 162   3e-47   Medicago truncatula
emb|CDY00165.1|  BnaC09g01360D                                          166   2e-46   
ref|XP_009399468.1|  PREDICTED: uncharacterized protein LOC103983867    143   1e-37   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008776887.1|  PREDICTED: uncharacterized protein LOC103696936    135   1e-34   Phoenix dactylifera
ref|XP_010934529.1|  PREDICTED: uncharacterized protein LOC105054654    135   2e-34   Elaeis guineensis
ref|XP_009411357.1|  PREDICTED: uncharacterized protein LOC103993126    134   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006854792.1|  hypothetical protein AMTR_s00063p00150900          120   1e-31   
ref|XP_002965799.1|  hypothetical protein SELMODRAFT_84529              111   2e-26   
ref|XP_002974310.1|  hypothetical protein SELMODRAFT_101023             111   3e-26   
ref|XP_002990882.1|  hypothetical protein SELMODRAFT_132356             109   1e-25   
ref|XP_002993215.1|  hypothetical protein SELMODRAFT_431315             109   3e-25   Selaginella moellendorffii
ref|XP_006360379.1|  PREDICTED: uncharacterized protein LOC102594943    109   3e-25   Solanum tuberosum [potatoes]
ref|XP_002992478.1|  hypothetical protein SELMODRAFT_135385             109   3e-25   
ref|XP_006857792.1|  hypothetical protein AMTR_s00061p00214420          102   5e-25   
ref|XP_009410726.1|  PREDICTED: uncharacterized protein LOC103992655    108   9e-25   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004240038.1|  PREDICTED: probable methyltransferase PMT19        107   1e-24   Solanum lycopersicum
ref|XP_010252251.1|  PREDICTED: uncharacterized protein LOC104593885    104   2e-23   Nelumbo nucifera [Indian lotus]
ref|XP_009382936.1|  PREDICTED: uncharacterized protein LOC103970749    103   4e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008343074.1|  PREDICTED: uncharacterized protein LOC103405840    102   6e-23   
ref|XP_001767537.1|  predicted protein                                  102   6e-23   
ref|XP_011028455.1|  PREDICTED: uncharacterized protein LOC105128...    102   1e-22   Populus euphratica
ref|XP_011028454.1|  PREDICTED: uncharacterized protein LOC105128...    102   1e-22   Populus euphratica
ref|XP_006836952.1|  hypothetical protein AMTR_s00099p00160150          101   2e-22   Amborella trichopoda
ref|XP_009619701.1|  PREDICTED: uncharacterized protein LOC104111663    101   2e-22   Nicotiana tomentosiformis
ref|XP_010032737.1|  PREDICTED: probable methyltransferase PMT19        101   2e-22   Eucalyptus grandis [rose gum]
ref|XP_009392585.1|  PREDICTED: uncharacterized protein LOC103978498    101   2e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010271214.1|  PREDICTED: uncharacterized protein LOC104607292    100   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_009762652.1|  PREDICTED: uncharacterized protein LOC104214650    100   3e-22   Nicotiana sylvestris
ref|XP_002263360.1|  PREDICTED: probable methyltransferase PMT12        100   3e-22   Vitis vinifera
gb|EYU33234.1|  hypothetical protein MIMGU_mgv1a026970mg                101   4e-22   Erythranthe guttata [common monkey flower]
ref|XP_006349637.1|  PREDICTED: probable methyltransferase PMT19-...    100   5e-22   Solanum tuberosum [potatoes]
ref|XP_002305225.1|  hypothetical protein POPTR_0004s08210g           99.8    8e-22   
ref|XP_009609578.1|  PREDICTED: uncharacterized protein LOC104103385  99.4    9e-22   Nicotiana tomentosiformis
ref|XP_004975730.1|  PREDICTED: uncharacterized protein LOC101762914    100   9e-22   Setaria italica
gb|KDP32451.1|  hypothetical protein JCGZ_13376                       97.4    1e-21   Jatropha curcas
ref|XP_004306056.1|  PREDICTED: uncharacterized protein LOC101293034    100   1e-21   Fragaria vesca subsp. vesca
ref|XP_002458886.1|  hypothetical protein SORBIDRAFT_03g042190        99.8    1e-21   Sorghum bicolor [broomcorn]
gb|KJB67513.1|  hypothetical protein B456_010G194500                  99.4    2e-21   Gossypium raimondii
ref|XP_004289582.1|  PREDICTED: probable methyltransferase PMT19      98.6    2e-21   Fragaria vesca subsp. vesca
ref|XP_008231024.1|  PREDICTED: uncharacterized protein LOC103330263  99.4    2e-21   Prunus mume [ume]
ref|XP_008674722.1|  PREDICTED: uncharacterized protein LOC103650909  99.0    2e-21   Zea mays [maize]
emb|CDO97681.1|  unnamed protein product                              98.6    3e-21   Coffea canephora [robusta coffee]
ref|XP_008789125.1|  PREDICTED: uncharacterized protein LOC103706698  98.6    3e-21   Phoenix dactylifera
ref|XP_007147539.1|  hypothetical protein PHAVU_006G133100g           98.6    3e-21   Phaseolus vulgaris [French bean]
ref|XP_004248708.1|  PREDICTED: probable methyltransferase PMT19      97.8    3e-21   Solanum lycopersicum
gb|KCW62552.1|  hypothetical protein EUGRSUZ_G00044                   98.2    3e-21   Eucalyptus grandis [rose gum]
ref|XP_010065207.1|  PREDICTED: uncharacterized protein LOC104452439  98.6    4e-21   Eucalyptus grandis [rose gum]
gb|KHN40740.1|  Putative methyltransferase PMT15                      98.2    4e-21   Glycine soja [wild soybean]
ref|XP_006586814.1|  PREDICTED: uncharacterized protein LOC102664598  98.2    4e-21   Glycine max [soybeans]
ref|XP_007217596.1|  hypothetical protein PRUPE_ppa018544mg           97.8    4e-21   Prunus persica
ref|XP_008801541.1|  PREDICTED: uncharacterized protein LOC103715629  98.2    4e-21   
ref|XP_009774313.1|  PREDICTED: probable methyltransferase PMT19      97.4    5e-21   Nicotiana sylvestris
ref|XP_011038251.1|  PREDICTED: uncharacterized protein LOC105135192  97.4    6e-21   Populus euphratica
ref|XP_002994258.1|  hypothetical protein SELMODRAFT_2228             96.7    6e-21   
ref|XP_002972857.1|  hypothetical protein SELMODRAFT_12874            96.7    6e-21   
gb|KCW62553.1|  hypothetical protein EUGRSUZ_G00045                   97.1    6e-21   Eucalyptus grandis [rose gum]
ref|XP_011087590.1|  PREDICTED: uncharacterized protein LOC105169030  97.4    7e-21   Sesamum indicum [beniseed]
ref|XP_006494666.1|  PREDICTED: probable methyltransferase PMT19-...  96.7    1e-20   Citrus sinensis [apfelsine]
ref|XP_011085904.1|  PREDICTED: probable methyltransferase PMT19      96.7    1e-20   Sesamum indicum [beniseed]
ref|XP_007216965.1|  hypothetical protein PRUPE_ppa015454mg           97.1    1e-20   Prunus persica
ref|XP_010930346.1|  PREDICTED: uncharacterized protein LOC105051545  96.7    1e-20   Elaeis guineensis
gb|ABR17484.1|  unknown                                               96.7    2e-20   Picea sitchensis
ref|XP_001754370.1|  predicted protein                                94.7    4e-20   
ref|XP_011092056.1|  PREDICTED: uncharacterized protein LOC105172364  95.9    4e-20   Sesamum indicum [beniseed]
ref|XP_011009363.1|  PREDICTED: uncharacterized protein LOC105114505  95.5    4e-20   Populus euphratica
ref|XP_006421083.1|  hypothetical protein CICLE_v10006824mg           94.7    5e-20   Citrus clementina [clementine]
ref|XP_009373793.1|  PREDICTED: uncharacterized protein LOC103962...  95.5    5e-20   Pyrus x bretschneideri [bai li]
ref|XP_008362217.1|  PREDICTED: uncharacterized protein LOC103425897  95.5    6e-20   
ref|XP_006826614.1|  hypothetical protein AMTR_s00138p00094100        95.1    6e-20   Amborella trichopoda
ref|XP_010907546.1|  PREDICTED: uncharacterized protein LOC105034191  94.7    7e-20   
gb|KDO40688.1|  hypothetical protein CISIN_1g043503mg                 94.7    7e-20   Citrus sinensis [apfelsine]
ref|XP_011043910.1|  PREDICTED: uncharacterized protein LOC105139235  94.0    8e-20   Populus euphratica
ref|XP_006470793.1|  PREDICTED: uncharacterized protein LOC102607511  94.7    8e-20   Citrus sinensis [apfelsine]
ref|XP_010062298.1|  PREDICTED: probable methyltransferase PMT19      94.0    9e-20   Eucalyptus grandis [rose gum]
gb|KCW56311.1|  hypothetical protein EUGRSUZ_I02052                   93.6    9e-20   Eucalyptus grandis [rose gum]
ref|XP_007135150.1|  hypothetical protein PHAVU_010G105300g           93.6    9e-20   Phaseolus vulgaris [French bean]
ref|XP_006431374.1|  hypothetical protein CICLE_v10003316mg           94.4    9e-20   Citrus clementina [clementine]
ref|XP_007032842.1|  S-adenosyl-L-methionine-dependent methyltran...  94.0    1e-19   
gb|KHN14379.1|  hypothetical protein glysoja_012417                   93.2    1e-19   Glycine soja [wild soybean]
ref|XP_003581273.1|  PREDICTED: uncharacterized protein LOC100830081  94.0    1e-19   Brachypodium distachyon [annual false brome]
ref|XP_003594437.1|  hypothetical protein MTR_2g028610                94.0    1e-19   Medicago truncatula
ref|XP_007135151.1|  hypothetical protein PHAVU_010G105300g           94.0    2e-19   Phaseolus vulgaris [French bean]
ref|XP_010260532.1|  PREDICTED: uncharacterized protein LOC104599618  94.0    2e-19   
ref|XP_007051690.1|  S-adenosyl-L-methionine-dependent methyltran...  94.7    2e-19   
ref|XP_003546232.1|  PREDICTED: uncharacterized protein LOC100794863  93.2    2e-19   
gb|KJB24637.1|  hypothetical protein B456_004G154700                  93.6    3e-19   Gossypium raimondii
dbj|BAJ84801.1|  predicted protein                                    92.4    3e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004964486.1|  PREDICTED: uncharacterized protein LOC101778925  91.7    5e-19   Setaria italica
gb|KJB10578.1|  hypothetical protein B456_001G208400                  92.8    5e-19   Gossypium raimondii
ref|XP_006655770.1|  PREDICTED: uncharacterized protein LOC102722126  91.7    5e-19   Oryza brachyantha
ref|XP_002872900.1|  hypothetical protein ARALYDRAFT_912109           92.8    5e-19   Arabidopsis lyrata subsp. lyrata
ref|XP_010930345.1|  PREDICTED: uncharacterized protein LOC105051544  92.4    5e-19   Elaeis guineensis
ref|XP_008233031.1|  PREDICTED: uncharacterized protein LOC103332112  92.8    6e-19   Prunus mume [ume]
gb|EPS66088.1|  hypothetical protein M569_08692                       90.9    6e-19   Genlisea aurea
ref|XP_009349328.1|  PREDICTED: uncharacterized protein LOC103940868  92.8    6e-19   Pyrus x bretschneideri [bai li]
ref|XP_010544420.1|  PREDICTED: uncharacterized protein LOC104817...  92.4    7e-19   Tarenaya hassleriana [spider flower]
ref|XP_004486558.1|  PREDICTED: uncharacterized protein LOC101503433  92.4    7e-19   
ref|XP_002305389.2|  hypothetical protein POPTR_0004s11590g           92.0    7e-19   
ref|XP_010087091.1|  hypothetical protein L484_010463                 88.6    8e-19   Morus notabilis
ref|XP_001777602.1|  predicted protein                                90.5    9e-19   
gb|KHN18827.1|  hypothetical protein glysoja_045347                   92.0    9e-19   Glycine soja [wild soybean]
ref|XP_010544422.1|  PREDICTED: uncharacterized protein LOC104817...  91.7    1e-18   Tarenaya hassleriana [spider flower]
ref|XP_002277860.1|  PREDICTED: uncharacterized protein LOC100259964  91.7    1e-18   Vitis vinifera
emb|CBI39481.3|  unnamed protein product                              91.3    1e-18   Vitis vinifera
ref|XP_009605194.1|  PREDICTED: uncharacterized protein LOC104099794  91.3    1e-18   Nicotiana tomentosiformis
ref|NP_001057631.1|  Os06g0474300                                     91.7    1e-18   
gb|EAZ00931.1|  hypothetical protein OsI_22961                        91.7    1e-18   Oryza sativa Indica Group [Indian rice]
ref|XP_002444878.1|  hypothetical protein SORBIDRAFT_07g000800        91.3    2e-18   Sorghum bicolor [broomcorn]
ref|XP_002284169.1|  PREDICTED: uncharacterized protein LOC100257940  90.9    2e-18   Vitis vinifera
emb|CAN77378.1|  hypothetical protein VITISV_043863                   90.9    2e-18   Vitis vinifera
ref|XP_010422784.1|  PREDICTED: uncharacterized protein LOC104708006  90.9    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010427634.1|  PREDICTED: uncharacterized protein LOC104712426  90.9    2e-18   Camelina sativa [gold-of-pleasure]
ref|XP_008375945.1|  PREDICTED: uncharacterized protein LOC103439174  92.0    2e-18   
ref|XP_010092875.1|  hypothetical protein L484_022470                 90.9    2e-18   
ref|XP_009338797.1|  PREDICTED: uncharacterized protein LOC103931112  92.0    2e-18   
ref|XP_011093041.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  91.7    2e-18   
ref|XP_002533472.1|  ATRAD3, putative                                 90.1    3e-18   Ricinus communis
ref|XP_007220933.1|  hypothetical protein PRUPE_ppa023757mg           90.9    3e-18   Prunus persica
ref|XP_011023653.1|  PREDICTED: uncharacterized protein LOC105125062  90.9    3e-18   Populus euphratica
gb|ABK28240.1|  unknown                                               90.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
gb|ABE65508.1|  hypothetical protein At4g01240                        90.9    3e-18   Arabidopsis thaliana [mouse-ear cress]
emb|CAN66988.1|  hypothetical protein VITISV_005164                   91.7    3e-18   Vitis vinifera
ref|XP_010464063.1|  PREDICTED: uncharacterized protein LOC104744673  90.5    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_002318999.2|  hypothetical protein POPTR_0013s02010g           90.5    3e-18   Populus trichocarpa [western balsam poplar]
dbj|BAK05115.1|  predicted protein                                    90.5    4e-18   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006290179.1|  hypothetical protein CARUB_v10003858mg           91.7    4e-18   
ref|XP_004490294.1|  PREDICTED: uncharacterized protein LOC101497349  90.1    4e-18   Cicer arietinum [garbanzo]
ref|XP_004986277.1|  PREDICTED: uncharacterized protein LOC101771363  89.7    4e-18   Setaria italica
ref|NP_187190.1|  uncharacterized protein                             90.1    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009128498.1|  PREDICTED: uncharacterized protein LOC103853324  90.1    4e-18   
gb|AAT68360.1|  hypothetical protein At3g05390                        90.1    4e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002884510.1|  hypothetical protein ARALYDRAFT_477828           90.1    4e-18   
ref|XP_006396286.1|  hypothetical protein EUTSA_v10028611mg           90.1    4e-18   
ref|XP_002511929.1|  ATRAD3, putative                                 90.9    5e-18   
ref|NP_001169099.1|  uncharacterized protein LOC100382943 precursor   90.1    5e-18   Zea mays [maize]
ref|XP_003594435.1|  hypothetical protein MTR_2g028590                90.1    5e-18   Medicago truncatula
ref|XP_009147246.1|  PREDICTED: uncharacterized protein LOC103870827  90.1    5e-18   Brassica rapa
emb|CDY27772.1|  BnaA05g31810D                                        89.7    5e-18   Brassica napus [oilseed rape]
ref|XP_011023264.1|  PREDICTED: uncharacterized protein LOC105124...  89.0    5e-18   Populus euphratica
gb|KDP28553.1|  hypothetical protein JCGZ_14324                       90.1    5e-18   Jatropha curcas
gb|AFW74244.1|  hypothetical protein ZEAMMB73_912598                  90.1    5e-18   
ref|XP_011023263.1|  PREDICTED: uncharacterized protein LOC105124...  89.0    5e-18   Populus euphratica
ref|XP_010936580.1|  PREDICTED: uncharacterized protein LOC105056176  89.7    5e-18   Elaeis guineensis
ref|XP_009383492.1|  PREDICTED: uncharacterized protein LOC103971243  89.7    6e-18   
emb|CDP15495.1|  unnamed protein product                              89.7    6e-18   Coffea canephora [robusta coffee]
gb|EEE65710.1|  hypothetical protein OsJ_21345                        89.4    6e-18   Oryza sativa Japonica Group [Japonica rice]
gb|KEH18781.1|  methyltransferase domain protein, putative            89.7    6e-18   Medicago truncatula
ref|XP_010485980.1|  PREDICTED: uncharacterized protein LOC104764193  89.4    7e-18   Camelina sativa [gold-of-pleasure]
ref|XP_003616242.1|  hypothetical protein MTR_5g077710                88.6    8e-18   Medicago truncatula
ref|NP_192033.1|  putative methyltransferase                          90.1    8e-18   Arabidopsis thaliana [mouse-ear cress]
ref|XP_008784991.1|  PREDICTED: uncharacterized protein LOC103703787  89.4    8e-18   Phoenix dactylifera
gb|AAB61017.1|  A_IG002N01.7 gene product                             89.7    9e-18   Arabidopsis thaliana [mouse-ear cress]
gb|KEH17516.1|  methyltransferase domain protein, putative            89.0    9e-18   Medicago truncatula
ref|XP_006299195.1|  hypothetical protein CARUB_v10015342mg           89.0    1e-17   Capsella rubella
ref|XP_009781541.1|  PREDICTED: uncharacterized protein LOC104230427  89.0    1e-17   Nicotiana sylvestris
ref|XP_007030960.1|  Methyltransferase, putative                      89.0    1e-17   
ref|XP_011023262.1|  PREDICTED: uncharacterized protein LOC105124...  89.0    1e-17   Populus euphratica
ref|XP_002990866.1|  hypothetical protein SELMODRAFT_44179            87.4    1e-17   
gb|KHN24594.1|  hypothetical protein glysoja_046776                   87.0    1e-17   Glycine soja [wild soybean]
ref|XP_002974326.1|  hypothetical protein SELMODRAFT_52690            87.0    1e-17   
ref|XP_010326694.1|  PREDICTED: uncharacterized protein LOC101265...  88.6    2e-17   Solanum lycopersicum
ref|XP_003563856.1|  PREDICTED: uncharacterized protein LOC100824970  88.6    2e-17   
ref|XP_008450643.1|  PREDICTED: uncharacterized protein LOC103492170  88.6    2e-17   Cucumis melo [Oriental melon]
gb|KHN23617.1|  hypothetical protein glysoja_046357                   85.9    2e-17   Glycine soja [wild soybean]
ref|XP_010426521.1|  PREDICTED: uncharacterized protein LOC104711485  88.2    2e-17   Camelina sativa [gold-of-pleasure]
gb|ABL85035.1|  expressed protein                                     87.8    2e-17   Brachypodium sylvaticum
gb|KDO56273.1|  hypothetical protein CISIN_1g012235mg                 88.2    2e-17   Citrus sinensis [apfelsine]
gb|KCW78119.1|  hypothetical protein EUGRSUZ_D02328                   88.2    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010261406.1|  PREDICTED: uncharacterized protein LOC104600251  88.2    2e-17   
ref|XP_009380402.1|  PREDICTED: uncharacterized protein LOC103968807  88.2    2e-17   
ref|XP_008644572.1|  PREDICTED: uncharacterized protein LOC103625944  87.4    2e-17   Zea mays [maize]
ref|XP_006433384.1|  hypothetical protein CICLE_v10003882mg           88.2    2e-17   Citrus clementina [clementine]
ref|XP_008805645.1|  PREDICTED: uncharacterized protein LOC103718547  88.2    2e-17   Phoenix dactylifera
ref|XP_002437791.1|  hypothetical protein SORBIDRAFT_10g002660        87.0    2e-17   
emb|CDY05163.1|  BnaC05g46400D                                        87.8    2e-17   
ref|XP_010546711.1|  PREDICTED: uncharacterized protein LOC104818707  87.8    3e-17   Tarenaya hassleriana [spider flower]
ref|XP_011468973.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  88.6    3e-17   Fragaria vesca subsp. vesca
emb|CDY53861.1|  BnaA02g36360D                                        87.8    3e-17   Brassica napus [oilseed rape]
ref|XP_010326696.1|  PREDICTED: uncharacterized protein LOC101265...  86.7    4e-17   
ref|XP_004965400.1|  PREDICTED: uncharacterized protein LOC101775804  87.4    4e-17   Setaria italica
emb|CBI40420.3|  unnamed protein product                              86.7    4e-17   Vitis vinifera
ref|XP_007205147.1|  hypothetical protein PRUPE_ppa005305mg           87.4    4e-17   Prunus persica
ref|XP_006408083.1|  hypothetical protein EUTSA_v10020681mg           87.4    4e-17   Eutrema salsugineum [saltwater cress]
ref|XP_010456225.1|  PREDICTED: uncharacterized protein LOC104737686  87.4    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_004302412.1|  PREDICTED: uncharacterized protein LOC101291062  87.0    5e-17   Fragaria vesca subsp. vesca
ref|XP_009376648.1|  PREDICTED: uncharacterized protein LOC103965332  87.0    5e-17   Pyrus x bretschneideri [bai li]
ref|XP_008246399.1|  PREDICTED: uncharacterized protein LOC103344579  87.0    5e-17   Prunus mume [ume]
ref|XP_010275732.1|  PREDICTED: uncharacterized protein LOC104610...  85.9    5e-17   Nelumbo nucifera [Indian lotus]
ref|NP_001174590.1|  Os06g0138500                                     85.9    6e-17   
gb|KJB26416.1|  hypothetical protein B456_004G240200                  86.7    6e-17   Gossypium raimondii
gb|KDP25822.1|  hypothetical protein JCGZ_22544                       85.9    7e-17   Jatropha curcas
ref|XP_010088953.1|  hypothetical protein L484_013532                 86.7    8e-17   Morus notabilis
ref|XP_010269453.1|  PREDICTED: uncharacterized protein LOC104606102  86.3    9e-17   Nelumbo nucifera [Indian lotus]
ref|XP_008370457.1|  PREDICTED: uncharacterized protein LOC103433933  86.3    9e-17   
ref|XP_003518817.1|  PREDICTED: uncharacterized protein LOC100782372  86.3    1e-16   Glycine max [soybeans]
ref|XP_006656966.1|  PREDICTED: uncharacterized protein LOC102700069  85.5    1e-16   
ref|XP_004234443.2|  PREDICTED: uncharacterized protein LOC101265707  85.9    1e-16   
ref|XP_006339639.1|  PREDICTED: uncharacterized protein LOC102587968  86.3    1e-16   Solanum tuberosum [potatoes]
ref|XP_004135617.1|  PREDICTED: uncharacterized protein LOC101207467  86.3    1e-16   
emb|CAN73279.1|  hypothetical protein VITISV_040608                   86.7    1e-16   Vitis vinifera
ref|XP_009380075.1|  PREDICTED: uncharacterized protein LOC103968547  85.1    1e-16   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010102877.1|  hypothetical protein L484_002005                 83.2    1e-16   
ref|XP_010054857.1|  PREDICTED: uncharacterized protein LOC104443218  86.7    1e-16   
gb|EYU45763.1|  hypothetical protein MIMGU_mgv1a020775mg              85.1    1e-16   Erythranthe guttata [common monkey flower]
ref|XP_009766984.1|  PREDICTED: uncharacterized protein LOC104218235  85.9    2e-16   
ref|XP_010661826.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  86.7    2e-16   
ref|XP_007153540.1|  hypothetical protein PHAVU_003G044100g           85.5    2e-16   
gb|KCW85104.1|  hypothetical protein EUGRSUZ_B01939                   84.3    2e-16   
ref|XP_009597584.1|  PREDICTED: uncharacterized protein LOC104093534  85.5    2e-16   
ref|XP_008388956.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  85.5    2e-16   
ref|XP_010915764.1|  PREDICTED: uncharacterized protein LOC105040777  85.1    2e-16   
ref|XP_006855507.1|  hypothetical protein AMTR_s00057p00202850        85.1    3e-16   
ref|XP_009799568.1|  PREDICTED: uncharacterized protein LOC104245636  84.7    3e-16   
ref|XP_010243696.1|  PREDICTED: uncharacterized protein LOC104587687  83.2    5e-16   
gb|EYU32180.1|  hypothetical protein MIMGU_mgv1a024581mg              84.3    5e-16   
ref|XP_006444936.1|  hypothetical protein CICLE_v10024550mg           84.0    7e-16   
ref|XP_010046228.1|  PREDICTED: uncharacterized protein LOC104435117  84.0    8e-16   
ref|XP_006353397.1|  PREDICTED: uncharacterized protein LOC102598299  83.6    8e-16   
ref|XP_006849633.1|  hypothetical protein AMTR_s00024p00220290        79.7    1e-15   
gb|KJB66909.1|  hypothetical protein B456_010G164500                  81.6    2e-15   
gb|EEE56914.1|  hypothetical protein OsJ_06590                        82.8    2e-15   
gb|AFW56218.1|  hypothetical protein ZEAMMB73_835727                  80.9    2e-15   
ref|XP_006344639.1|  PREDICTED: uncharacterized protein LOC102595416  82.8    2e-15   
ref|NP_001144838.1|  uncharacterized protein LOC100277923             81.6    2e-15   
gb|EPS63238.1|  hypothetical protein M569_11547                       81.6    2e-15   
gb|ACF83461.1|  unknown                                               81.6    3e-15   
ref|XP_007211455.1|  hypothetical protein PRUPE_ppa007323mg           81.3    3e-15   
emb|CDY72207.1|  BnaCnng76480D                                        82.0    3e-15   
gb|KDP23499.1|  hypothetical protein JCGZ_23332                       82.0    3e-15   
ref|XP_010056869.1|  PREDICTED: uncharacterized protein LOC104444812  80.9    4e-15   
ref|XP_009628987.1|  PREDICTED: uncharacterized protein LOC104119243  81.3    5e-15   
ref|XP_004230216.1|  PREDICTED: uncharacterized protein LOC101247261  81.3    6e-15   
ref|XP_002530998.1|  hypothetical protein RCOM_0917420                80.1    7e-15   
ref|XP_010674714.1|  PREDICTED: uncharacterized protein LOC104890814  81.3    7e-15   
ref|XP_008383518.1|  PREDICTED: uncharacterized protein LOC103446217  80.5    1e-14   
ref|XP_004504712.1|  PREDICTED: uncharacterized protein LOC101498967  79.7    1e-14   
ref|XP_009353828.1|  PREDICTED: uncharacterized protein LOC103945052  79.3    1e-14   
ref|XP_009784071.1|  PREDICTED: uncharacterized protein LOC104232543  80.1    1e-14   
ref|XP_004165527.1|  PREDICTED: uncharacterized LOC101208739 isof...  79.3    2e-14   
gb|KDP32453.1|  hypothetical protein JCGZ_13378                       79.7    2e-14   
ref|XP_004147405.1|  PREDICTED: uncharacterized protein LOC101208...  79.0    2e-14   
ref|XP_003524786.2|  PREDICTED: uncharacterized protein LOC100785300  78.6    4e-14   
ref|XP_006355600.1|  PREDICTED: uncharacterized protein LOC102592036  77.8    5e-14   
ref|XP_010099320.1|  hypothetical protein L484_018183                 77.8    6e-14   
ref|XP_001761229.1|  predicted protein                                78.2    6e-14   
ref|XP_008443998.1|  PREDICTED: uncharacterized protein LOC103487447  77.4    7e-14   
ref|XP_004233013.1|  PREDICTED: uncharacterized protein LOC101264173  77.0    8e-14   
ref|XP_009614046.1|  PREDICTED: uncharacterized protein LOC104107050  77.0    1e-13   
gb|KCW69423.1|  hypothetical protein EUGRSUZ_F02887                   75.1    2e-13   
gb|AFW85949.1|  hypothetical protein ZEAMMB73_928110                  75.9    2e-13   
gb|KDP32450.1|  hypothetical protein JCGZ_13375                       74.3    2e-13   
ref|XP_009787217.1|  PREDICTED: uncharacterized protein LOC104235198  75.9    2e-13   
gb|EMT14686.1|  hypothetical protein F775_17693                       76.3    3e-13   
ref|XP_003561200.1|  PREDICTED: uncharacterized protein LOC100825782  75.5    4e-13   
gb|KDP21207.1|  hypothetical protein JCGZ_21678                       74.7    6e-13   
ref|XP_004490854.1|  PREDICTED: probable methyltransferase PMT16-...  74.7    7e-13   
ref|XP_006372524.1|  hypothetical protein POPTR_0017s02460g           73.6    7e-13   
ref|XP_007158974.1|  hypothetical protein PHAVU_002G197700g           74.3    9e-13   
ref|XP_003572829.1|  PREDICTED: uncharacterized protein LOC100828000  74.7    9e-13   
ref|XP_002447909.1|  hypothetical protein SORBIDRAFT_06g017790        74.7    1e-12   
ref|XP_006843184.1|  hypothetical protein AMTR_s00146p00079960        72.8    1e-12   
ref|XP_007025169.1|  S-adenosyl-L-methionine-dependent methyltran...  73.6    2e-12   
gb|KEH31356.1|  S-adenosyl-L-methionine-dependent methyltransferase   73.6    2e-12   
ref|XP_004973028.1|  PREDICTED: uncharacterized protein LOC101758976  73.6    3e-12   
emb|CAN63784.1|  hypothetical protein VITISV_009253                   72.8    3e-12   
ref|XP_008669352.1|  PREDICTED: uncharacterized protein LOC103646401  73.2    3e-12   
ref|XP_002273992.1|  PREDICTED: uncharacterized protein LOC100250442  72.4    4e-12   
gb|KJB69768.1|  hypothetical protein B456_011G041200                  72.8    4e-12   
gb|AAG46168.1|AC018727_20  hypothetical protein                       72.8    4e-12   
gb|EAZ17094.1|  hypothetical protein OsJ_32593                        72.8    4e-12   
ref|XP_010538231.1|  PREDICTED: uncharacterized protein LOC104812658  72.4    4e-12   
ref|NP_001065501.1|  Os10g0578600                                     72.8    4e-12   
gb|EAY79644.1|  hypothetical protein OsI_34788                        72.8    4e-12   
gb|ABB48033.1|  expressed protein                                     72.8    4e-12   
ref|XP_010549468.1|  PREDICTED: uncharacterized protein LOC104820635  72.4    4e-12   
ref|XP_004293665.1|  PREDICTED: uncharacterized protein LOC101310870  71.6    7e-12   
emb|CAD40973.2|  OSJNBa0027P08.5                                      72.4    7e-12   
ref|NP_001052895.2|  Os04g0444700                                     71.6    1e-11   
ref|XP_006415545.1|  hypothetical protein EUTSA_v10010017mg           70.9    2e-11   
ref|XP_002890831.1|  hypothetical protein ARALYDRAFT_473184           70.5    2e-11   
ref|XP_009115215.1|  PREDICTED: uncharacterized protein LOC103840459  70.5    2e-11   
ref|XP_011096504.1|  PREDICTED: uncharacterized protein LOC105175673  70.1    3e-11   
ref|XP_006369890.1|  hypothetical protein POPTR_0001s34490g           70.1    3e-11   
ref|XP_011005850.1|  PREDICTED: uncharacterized protein LOC105112010  69.7    3e-11   
ref|XP_009595553.1|  PREDICTED: uncharacterized protein LOC104091831  68.9    4e-11   
gb|EPS68166.1|  hypothetical protein M569_06606                       69.3    5e-11   
ref|XP_011045306.1|  PREDICTED: uncharacterized protein LOC105140252  69.3    6e-11   
emb|CDP17332.1|  unnamed protein product                              68.9    6e-11   
ref|XP_002519380.1|  ATRAD3, putative                                 69.3    7e-11   
ref|XP_006305095.1|  hypothetical protein CARUB_v10009462mg           68.9    8e-11   
ref|XP_003572828.1|  PREDICTED: uncharacterized protein LOC100827692  68.9    9e-11   
ref|XP_010924091.1|  PREDICTED: uncharacterized protein LOC105047017  68.9    1e-10   
ref|XP_002316738.2|  hypothetical protein POPTR_0011s02820g           67.8    2e-10   
ref|XP_010100989.1|  hypothetical protein L484_010644                 67.8    2e-10   
ref|XP_009396835.1|  PREDICTED: uncharacterized protein LOC103981816  67.8    2e-10   
ref|XP_006585013.1|  PREDICTED: uncharacterized protein LOC100816366  66.2    2e-10   
gb|KHN07742.1|  hypothetical protein glysoja_033127                   66.2    2e-10   
ref|NP_174272.2|  putative methyltransferase domain-containing pr...  67.4    3e-10   
ref|XP_003574397.1|  PREDICTED: uncharacterized protein LOC100841753  67.4    3e-10   
ref|XP_002519740.1|  conserved hypothetical protein                   66.6    4e-10   
emb|CDX90214.1|  BnaA08g17700D                                        66.2    7e-10   
emb|CDY71411.1|  BnaC03g76030D                                        65.9    8e-10   
gb|EYU28174.1|  hypothetical protein MIMGU_mgv1a008347mg              65.9    8e-10   
ref|XP_006856423.1|  hypothetical protein AMTR_s00047p00220710        66.2    1e-09   
ref|XP_009109638.1|  PREDICTED: uncharacterized protein LOC103835255  65.9    1e-09   
gb|AFW58349.1|  hypothetical protein ZEAMMB73_340804                  65.1    2e-09   
gb|KDO78095.1|  hypothetical protein CISIN_1g0178331mg                64.3    2e-09   
ref|XP_010478350.1|  PREDICTED: uncharacterized protein LOC104757316  64.3    3e-09   
ref|XP_008664334.1|  PREDICTED: uncharacterized protein LOC103642960  63.9    4e-09   
ref|XP_006449631.1|  hypothetical protein CICLE_v10015651mg           63.9    4e-09   
ref|XP_006467523.1|  PREDICTED: uncharacterized protein LOC102629...  63.5    5e-09   
ref|XP_002467048.1|  hypothetical protein SORBIDRAFT_01g018790        64.7    5e-09   
ref|XP_010666499.1|  PREDICTED: uncharacterized protein LOC104883647  63.2    6e-09   
ref|XP_002314736.1|  hypothetical protein POPTR_0010s10760g           58.9    8e-09   
ref|XP_008225360.1|  PREDICTED: uncharacterized protein LOC103325018  63.2    8e-09   
gb|EMT18502.1|  hypothetical protein F775_00868                       60.5    4e-08   
ref|XP_002444913.1|  hypothetical protein SORBIDRAFT_07g001390        60.8    6e-08   
ref|XP_004974512.1|  PREDICTED: uncharacterized protein LOC101763033  59.7    7e-08   
ref|XP_002443752.1|  hypothetical protein SORBIDRAFT_07g001350        60.1    1e-07   
ref|XP_008648379.1|  PREDICTED: uncharacterized protein LOC103628964  60.1    1e-07   
ref|NP_001132903.1|  hypothetical protein                             58.5    3e-07   
ref|XP_008678318.1|  PREDICTED: uncharacterized protein LOC103653138  57.4    8e-07   
gb|EAY94275.1|  hypothetical protein OsI_16044                        55.5    3e-06   
ref|XP_008650544.1|  PREDICTED: uncharacterized protein LOC103631404  55.1    3e-06   
ref|XP_006850560.1|  hypothetical protein AMTR_s00191p00037430        55.1    3e-06   
gb|EEC82806.1|  hypothetical protein OsI_27582                        54.7    5e-06   
ref|NP_001060840.1|  Os08g0113400                                     54.7    6e-06   
gb|EEE67930.1|  hypothetical protein OsJ_25806                        54.3    7e-06   
ref|XP_004983526.1|  PREDICTED: uncharacterized protein LOC101758913  54.3    7e-06   
emb|CDX99854.1|  BnaC05g22760D                                        51.2    1e-05   
tpg|DAA61140.1|  TPA: hypothetical protein ZEAMMB73_444374            53.5    2e-05   
gb|AFW77098.1|  hypothetical protein ZEAMMB73_288207                  52.0    4e-05   
gb|ACR38405.1|  unknown                                               51.2    5e-05   
ref|XP_009360845.1|  PREDICTED: uncharacterized protein LOC103951245  50.4    1e-04   
gb|KDP32455.1|  hypothetical protein JCGZ_13380                       48.9    4e-04   
ref|XP_006659759.1|  PREDICTED: uncharacterized protein LOC102717363  48.5    6e-04   
ref|XP_008790999.1|  PREDICTED: uncharacterized protein LOC103708022  47.8    9e-04   



>emb|CDP07421.1| unnamed protein product [Coffea canephora]
Length=420

 Score =   264 bits (674),  Expect = 1e-83, Method: Compositional matrix adjust.
 Identities = 122/152 (80%), Positives = 141/152 (93%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KL +MEKE+LGYESIDLS+PN A+EL++FL  H LPLGKDSRTGIT+MVASVG
Sbjct  77   EIESSQKKLAQMEKELLGYESIDLSRPNTASELKVFLQHHLLPLGKDSRTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLLSQ+M+YKVSGPCPDDWSLGQKLIL+GCEPLPRRRCFAKTIPKVG  L PF
Sbjct  137  HSCEKSVDLLSQYMNYKVSGPCPDDWSLGQKLILRGCEPLPRRRCFAKTIPKVG--LQPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW + SEK+Y+WSG +CKNLAC+NSKKL+
Sbjct  195  PISLWKDVSEKVYSWSGFTCKNLACLNSKKLN  226



>ref|XP_011074653.1| PREDICTED: uncharacterized protein LOC105159331 [Sesamum indicum]
Length=415

 Score =   259 bits (663),  Expect = 4e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KL +MEK++LGYESIDLS+PN+A EL+ FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  73   EIESSQKKLAQMEKQILGYESIDLSRPNIANELKEFLNSHQLPLGKDSRTGITEMVASVG  132

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV+G CPDDWSLGQKLIL+GCEPLPRRRCFAKTIPK+G  L PF
Sbjct  133  HSCEKSADLLSQYMSYKVNGLCPDDWSLGQKLILQGCEPLPRRRCFAKTIPKMG--LQPF  190

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW N SEKIY+WSGL CKNLAC+NSKKL+
Sbjct  191  PVSLWKNISEKIYSWSGLGCKNLACLNSKKLN  222



>ref|XP_011083506.1| PREDICTED: uncharacterized protein LOC105166016 [Sesamum indicum]
Length=415

 Score =   259 bits (662),  Expect = 6e-82, Method: Compositional matrix adjust.
 Identities = 123/152 (81%), Positives = 139/152 (91%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            +IESSQ KL++MEKE+LGY+SIDLS PN+A EL+ FL +HQLPLGKDSRTGIT+MVASVG
Sbjct  73   QIESSQNKLSQMEKELLGYKSIDLSGPNIANELKEFLNRHQLPLGKDSRTGITEMVASVG  132

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLLSQFMSYKV+GPCPDDWSLGQKLIL+GCEPLPRRRCFAK IPKV   L PF
Sbjct  133  HSCEKSVDLLSQFMSYKVNGPCPDDWSLGQKLILQGCEPLPRRRCFAKIIPKVA--LQPF  190

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW N SEKIY+WSGL CKNLAC+NSKKL+
Sbjct  191  PVSLWKNVSEKIYSWSGLGCKNLACLNSKKLN  222



>gb|KDP36948.1| hypothetical protein JCGZ_08239 [Jatropha curcas]
Length=420

 Score =   255 bits (652),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYE+ID+S+PN+A EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIDSSQKKLAKMEKELLGYETIDISRPNIANELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+KS DLLSQFM+YKVSGPCPDDWSLGQKLIL+GCEPLPRRRCFAK +PKVG  L+PF
Sbjct  136  HSCDKSADLLSQFMTYKVSGPCPDDWSLGQKLILRGCEPLPRRRCFAKPVPKVG--LSPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CKNL C+N KKLS
Sbjct  194  PISLWKPVSDKILTWSGLGCKNLECLNKKKLS  225



>gb|AAO14627.1|AF467900_4 hypothetical protein [Prunus persica]
Length=421

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS+ NVA EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYESIDLSRSNVAHELKLFLQHHQLPLGKDSRTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAKT+PKVG  LNPF
Sbjct  137  HSCEKSADLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKTLPKVG--LNPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CK+  C+NSKKLS
Sbjct  195  PISLWKPVSDKIVTWSGLGCKSFECLNSKKLS  226



>ref|XP_008221299.1| PREDICTED: uncharacterized protein LOC103321276 [Prunus mume]
Length=421

 Score =   254 bits (648),  Expect = 7e-80, Method: Compositional matrix adjust.
 Identities = 120/152 (79%), Positives = 136/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS+ NVA EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYESIDLSRSNVAHELKLFLQHHQLPLGKDSRTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAKT+PKVG  LNPF
Sbjct  137  HSCEKSADLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKTLPKVG--LNPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CK+  C+NSKKLS
Sbjct  195  PISLWKPVSDKIVTWSGLGCKSFECLNSKKLS  226



>ref|XP_010095168.1| putative methyltransferase PMT28 [Morus notabilis]
 gb|EXB58398.1| putative methyltransferase PMT28 [Morus notabilis]
Length=456

 Score =   250 bits (639),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 135/152 (89%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL  MEKE+LGYES DLS+PN+AAEL++FL  HQLPLGKDSRTGIT+MV+SVG
Sbjct  111  EIDSSQKKLALMEKELLGYESFDLSRPNMAAELKLFLYHHQLPLGKDSRTGITEMVSSVG  170

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CEKS DLLSQ+MSYKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAK++ KVG  L+PF
Sbjct  171  HTCEKSADLLSQYMSYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKSVSKVGF-LSPF  229

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CK+  C+NSKKLS
Sbjct  230  PVSLWKPVSDKIVTWSGLGCKSFTCLNSKKLS  261



>ref|XP_011045126.1| PREDICTED: uncharacterized protein LOC105140124 [Populus euphratica]
Length=420

 Score =   249 bits (636),  Expect = 4e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI SSQ+KL RMEKE+LGYE++D+S+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIASSQKKLARMEKELLGYETMDISRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M YK+SGPCPDDWSLGQKLIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  136  HSCEKSPDLLSQYMVYKISGPCPDDWSLGQKLILRGCEPLPRRRCFAKSVPKVG--LYRF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   SEKI TWSGL CKN  C+N KKLS
Sbjct  194  PVSLWKPVSEKILTWSGLGCKNFECLNKKKLS  225



>ref|XP_002306913.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
 gb|EEE93909.1| hypothetical protein POPTR_0005s25790g [Populus trichocarpa]
Length=420

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI SSQ+KL RMEKE+LGYE++D+S+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIASSQKKLARMEKELLGYETMDISRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M YK+SGPCPDDWSLGQKLIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  136  HSCEKSPDLLSQYMVYKISGPCPDDWSLGQKLILRGCEPLPRRRCFAKSVPKVG--LYRF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   SEKI TWSGL CKN  C+N KKLS
Sbjct  194  PVSLWKPVSEKILTWSGLGCKNFECLNKKKLS  225



>ref|XP_007017750.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY14975.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=420

 Score =   249 bits (636),  Expect = 5e-78, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEKE+LGY+++DLS+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIDSSQRKLAQMEKELLGYDTLDLSRPNLASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV GPCPDDWSL QKLI+KGCEPLPRRRCFAKT+PKVG  L+  
Sbjct  136  HSCEKSADLLSQYMSYKVYGPCPDDWSLAQKLIVKGCEPLPRRRCFAKTVPKVG--LSSL  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            PLSLW   SEKI TWSGL CKN  C+N+KKLS
Sbjct  194  PLSLWKPVSEKIVTWSGLGCKNFDCLNTKKLS  225



>gb|EYU38830.1| hypothetical protein MIMGU_mgv1a007054mg [Erythranthe guttata]
Length=421

 Score =   248 bits (634),  Expect = 9e-78, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KLT+MEK++LGYESIDLS+PN+A EL+ FL  H LPLGKDSRTGIT+MVASVG
Sbjct  77   EIESSQKKLTQMEKQLLGYESIDLSRPNIAIELKQFLNHHLLPLGKDSRTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLLS+FM+YKV+G CPDDWSLGQKLIL+GCEPLPRRRCFAK IPK+G     F
Sbjct  137  HSCEKSVDLLSEFMNYKVNGLCPDDWSLGQKLILRGCEPLPRRRCFAKAIPKLG--FQSF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW N SEK ++WSGL CKNLAC+N KKL+
Sbjct  195  PISLWKNVSEKSFSWSGLGCKNLACLNIKKLN  226



>ref|XP_006473627.1| PREDICTED: uncharacterized protein LOC102620145 [Citrus sinensis]
 gb|KDO84792.1| hypothetical protein CISIN_1g037675mg [Citrus sinensis]
Length=418

 Score =   248 bits (634),  Expect = 1e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 137/152 (90%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLS+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIDSSQKKLAKMEKELLGYQSIDLSRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLL+Q+M+YK+SGPCPDDWSL QKLIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  136  HSCEKSADLLTQYMTYKLSGPCPDDWSLAQKLILRGCEPLPRRRCFAKSVPKVG--LQSF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CKNL+C+ SKKLS
Sbjct  194  PVSLWKPVSDKIVTWSGLGCKNLSCLISKKLS  225



>ref|XP_009803492.1| PREDICTED: uncharacterized protein LOC104248856 [Nicotiana sylvestris]
Length=420

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS   +A ELR FL  H LPLGKDSRTGIT+MVASVG
Sbjct  78   EIDSSQKKLAQMEKELLGYESIDLSNSKIATELRTFLQHHLLPLGKDSRTGITEMVASVG  137

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KS+DLLSQFM+YKVSGPCPDDWSLGQKLIL GCEPLPRRRCFAK IPKVG  L  F
Sbjct  138  HSCVKSMDLLSQFMNYKVSGPCPDDWSLGQKLILSGCEPLPRRRCFAKIIPKVG--LQSF  195

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SL+ N S+KIY+WSGL CKNLAC+N+KKL+
Sbjct  196  PDSLYKNYSDKIYSWSGLGCKNLACLNAKKLN  227



>ref|XP_009598077.1| PREDICTED: uncharacterized protein LOC104093936 [Nicotiana tomentosiformis]
Length=420

 Score =   248 bits (632),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 118/152 (78%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS   +A ELR FL  H LPLGKDSRTGIT+MVASVG
Sbjct  78   EIDSSQKKLAQMEKELLGYESIDLSNSKIATELRTFLQHHLLPLGKDSRTGITEMVASVG  137

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC  S+DLLSQFM+YKVSGPCPDDWSLGQKLIL GCEPLPRRRCFAKTIPKVG  L  F
Sbjct  138  HSCVNSMDLLSQFMNYKVSGPCPDDWSLGQKLILSGCEPLPRRRCFAKTIPKVG--LQSF  195

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SL+ N S+KIY+WSGL CKNLAC+N+KKL+
Sbjct  196  PDSLYKNYSDKIYSWSGLGCKNLACLNAKKLN  227



>ref|XP_009337662.1| PREDICTED: uncharacterized protein LOC103930096 [Pyrus x bretschneideri]
Length=421

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 134/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS PN+A EL++FL  HQLPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYESIDLSNPNIANELKVFLQHHQLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS  LLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAKT+PKVG  L+PF
Sbjct  137  HSCEKSAGLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKTVPKVG--LDPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N+KKLS
Sbjct  195  PISLWKPVSDKIVSWSGLGCKKFECLNAKKLS  226



>ref|XP_009335275.1| PREDICTED: uncharacterized protein LOC103927992 isoform X2 [Pyrus 
x bretschneideri]
Length=421

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLSKPNVA EL++FL  HQLPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDW+L QKLIL+GCEPLPRRRCFAKT+PKVG  LNP 
Sbjct  137  HSCEKSADLLSQYMNYKVSGPCPDDWNLAQKLILRGCEPLPRRRCFAKTVPKVG--LNPL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N+KKL+
Sbjct  195  PISLWKPVSDKIVSWSGLGCKKFECLNAKKLN  226



>gb|KJB14424.1| hypothetical protein B456_002G124500 [Gossypium raimondii]
Length=420

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 117/152 (77%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEKE+LGY+++DLS+PN+A EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIDSSQRKLAQMEKELLGYDTLDLSRPNLATELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKVSGPCPDDWSL QKLILKGCEPLPRRRCFAKT+PK G  L   
Sbjct  136  HSCEKSADLLSQYMSYKVSGPCPDDWSLAQKLILKGCEPLPRRRCFAKTVPKPG--LTSL  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI TWSGL CKN  C+NSKKLS
Sbjct  194  PVSLWKPVSDKIVTWSGLGCKNFNCLNSKKLS  225



>ref|XP_009350044.1| PREDICTED: uncharacterized protein LOC103941557 [Pyrus x bretschneideri]
Length=421

 Score =   247 bits (631),  Expect = 3e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLSKPNVA EL++FL  HQLPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDW+L QKLIL+GCEPLPRRRCFAKT+PKVG  LNP 
Sbjct  137  HSCEKSADLLSQYMNYKVSGPCPDDWNLAQKLILRGCEPLPRRRCFAKTVPKVG--LNPL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N+KKL+
Sbjct  195  PISLWKPVSDKIVSWSGLGCKKFECLNAKKLN  226



>ref|XP_009335270.1| PREDICTED: uncharacterized protein LOC103927992 isoform X1 [Pyrus 
x bretschneideri]
Length=421

 Score =   247 bits (630),  Expect = 4e-77, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLSKPNVA EL++FL  HQLPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYKSIDLSKPNVANELKVFLQHHQLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDW+L QKLIL+GCEPLPRRRCFAKT+PKVG  LNP 
Sbjct  137  HSCEKSADLLSQYMNYKVSGPCPDDWNLAQKLILRGCEPLPRRRCFAKTVPKVG--LNPL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N+KKL+
Sbjct  195  PISLWKPVSDKIVSWSGLGCKKFECLNAKKLN  226



>ref|XP_010061033.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 ref|XP_010061034.1| PREDICTED: uncharacterized protein LOC104448821 [Eucalyptus grandis]
 gb|KCW67935.1| hypothetical protein EUGRSUZ_F01633 [Eucalyptus grandis]
Length=421

 Score =   246 bits (628),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 113/150 (75%), Positives = 133/150 (89%), Gaps = 2/150 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI SSQ+KL +MEKE+LGY+SIDLS+PN+AAEL+ FL  H LPLGKDSRTGIT+MVASVG
Sbjct  77   EIASSQKKLAKMEKELLGYDSIDLSRPNIAAELKTFLRPHSLPLGKDSRTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLL+Q+MSYKV+GPCPDDWSL QKLIL+GCEPLPRRRCFA++IPKVG  L PF
Sbjct  137  HSCEKSVDLLTQYMSYKVTGPCPDDWSLAQKLILRGCEPLPRRRCFARSIPKVG--LRPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            P+SLW   SEK+ +WSGL CK+  CVN+KK
Sbjct  195  PVSLWKPISEKVVSWSGLGCKSFECVNTKK  224



>ref|XP_002510507.1| ATRAD3, putative [Ricinus communis]
 gb|EEF52694.1| ATRAD3, putative [Ricinus communis]
Length=490

 Score =   248 bits (632),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 113/151 (75%), Positives = 135/151 (89%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYE+ID+S+PN+A EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  146  EIDSSQKKLAKMEKELLGYETIDISRPNIANELKLFLQHHQLPLGKDSRTGITEMVASVG  205

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAK++PKVG  L+PF
Sbjct  206  HSCEKSADLLSQYMTYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKSVPKVG--LSPF  263

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            P+SLW   S+KI TWSGL CK++ C+N KK 
Sbjct  264  PISLWKPVSDKILTWSGLGCKSIDCLNKKKF  294



>ref|XP_006435145.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
 gb|ESR48385.1| hypothetical protein CICLE_v10001297mg [Citrus clementina]
Length=418

 Score =   244 bits (624),  Expect = 3e-76, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 135/152 (89%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLS+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIDSSQKKLAKMEKELLGYQSIDLSRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLL+Q+M+YK+SGPCPDDWSL QKLIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  136  HSCEKSADLLTQYMTYKLSGPCPDDWSLAQKLILRGCEPLPRRRCFAKSLPKVG--LQSF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+K  TWSGL CKNL C+ SKKLS
Sbjct  194  PVSLWKPVSDKTVTWSGLGCKNLNCLISKKLS  225



>ref|XP_002277626.1| PREDICTED: uncharacterized protein LOC100259190 [Vitis vinifera]
Length=419

 Score =   243 bits (621),  Expect = 9e-76, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 135/151 (89%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KL +MEKE+LGYESIDLS+PN A+EL++FL +HQLPLGKDS+TGIT+MVASVG
Sbjct  75   EIESSQKKLAQMEKELLGYESIDLSRPNTASELKLFLQRHQLPLGKDSKTGITEMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+KS+DLLSQ+M+YKVSG CPDDWSL Q+LIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  135  HSCDKSVDLLSQYMTYKVSGACPDDWSLAQRLILRGCEPLPRRRCFAKSVPKVG--LYSF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            P+SLW   S+KI +WSGL CKN  C+N+KKL
Sbjct  193  PISLWKPVSDKIVSWSGLGCKNFECLNNKKL  223



>ref|XP_011028977.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028978.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028979.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
 ref|XP_011028980.1| PREDICTED: uncharacterized protein LOC105128842 [Populus euphratica]
Length=420

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 114/152 (75%), Positives = 133/152 (88%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI +SQ+KL  MEKE+LGYE++D+S+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIAASQKKLAGMEKELLGYETMDISRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKVSGPCP DWSLGQKLIL+GCEPLPRRRCFAK++ KVG  L  F
Sbjct  136  HSCEKSADLLSQYMAYKVSGPCPGDWSLGQKLILRGCEPLPRRRCFAKSVQKVG--LYRF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   SEKI TWSGL CKNL C+N KKLS
Sbjct  194  PVSLWKPVSEKILTWSGLGCKNLECLNRKKLS  225



>ref|XP_008357136.1| PREDICTED: uncharacterized protein LOC103420870 [Malus domestica]
Length=421

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYESIDLS PN+A EL++FL  H LPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYESIDLSNPNIANELKVFLQHHSLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS  LLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAK +PKVG  L+PF
Sbjct  137  HSCEKSAGLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKAVPKVG--LDPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N+KKLS
Sbjct  195  PISLWKPVSDKIVSWSGLGCKKFECLNAKKLS  226



>gb|EPS57421.1| hypothetical protein M569_17397 [Genlisea aurea]
Length=422

 Score =   243 bits (620),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KL ++EKEVLGYE IDLS PN+AAELR FL    LPLG+DS+TGIT+MV+SVG
Sbjct  73   EIESSQKKLNQIEKEVLGYEVIDLSSPNIAAELREFLKPQTLPLGRDSKTGITEMVSSVG  132

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KS+DLLSQFMSY+V+ PCPDDWSL QKLIL GCEPLPRRRCFA+T+PK G  + PF
Sbjct  133  HSCRKSMDLLSQFMSYRVNAPCPDDWSLAQKLILHGCEPLPRRRCFARTMPKSG--IKPF  190

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLWSN SEKIYTWSGL CK ++C+N KKL+
Sbjct  191  PASLWSNVSEKIYTWSGLGCKTISCLNGKKLN  222



>ref|XP_002301989.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
 gb|EEE81262.1| hypothetical protein POPTR_0002s02640g [Populus trichocarpa]
Length=420

 Score =   241 bits (615),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI +SQ+KL  MEKE+LGYE++D+S+PN+A+EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  76   EIAASQKKLAGMEKELLGYETMDISRPNIASELKLFLQHHQLPLGKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLL Q+M+YKVSGPCP DWSLGQKLIL+GCEPLPRRRCFAK++ KVG  L  F
Sbjct  136  HSCEKSADLLYQYMAYKVSGPCPGDWSLGQKLILRGCEPLPRRRCFAKSVQKVG--LYRF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   SEKI TWSGL CKNL C+N KKLS
Sbjct  194  PVSLWKPVSEKILTWSGLGCKNLECLNRKKLS  225



>ref|XP_008442993.1| PREDICTED: uncharacterized protein LOC103486724 [Cucumis melo]
Length=417

 Score =   241 bits (614),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+ NVA EL++FL +H LPLGKDS++GIT+MVASVG
Sbjct  76   EIDVSQKKLAQMEKEILGYESIDLSRSNVANELKLFLQRHPLPLGKDSKSGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRC AK++PKVG  L PF
Sbjct  136  HSCEKSMDLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCLAKSVPKVG--LQPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            P+SLW   S+KI  WSGL CKN  C+NSKKL
Sbjct  194  PISLWKPVSDKIVMWSGLGCKNFQCLNSKKL  224



>ref|XP_004136545.1| PREDICTED: uncharacterized protein LOC101215265 [Cucumis sativus]
 ref|XP_004161281.1| PREDICTED: uncharacterized LOC101215265 [Cucumis sativus]
 gb|KGN59257.1| hypothetical protein Csa_3G791480 [Cucumis sativus]
Length=417

 Score =   240 bits (613),  Expect = 1e-74, Method: Compositional matrix adjust.
 Identities = 112/151 (74%), Positives = 132/151 (87%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+ NVA EL++FL +H LPLGKDS++GIT+MVASVG
Sbjct  76   EIDVSQKKLAQMEKEILGYESIDLSRSNVANELKLFLQRHPLPLGKDSKSGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+DLLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRC AK++PKVG  L PF
Sbjct  136  HSCEKSMDLLSQYMNYKVSGPCPDDWSLAQKLILRGCEPLPRRRCLAKSVPKVG--LQPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            P+SLW   S+KI  WSGL CKN  C+NSKKL
Sbjct  194  PISLWKPVSDKIVMWSGLGCKNFQCLNSKKL  224



>ref|XP_008387957.1| PREDICTED: uncharacterized protein LOC103450397 [Malus domestica]
Length=421

 Score =   239 bits (611),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 113/152 (74%), Positives = 132/152 (87%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGY+SIDLSK NVA EL++FL  HQLPLGKDS+TGIT+MVASVG
Sbjct  77   EIDSSQKKLAQMEKELLGYKSIDLSKRNVANELKVFLQHHQLPLGKDSKTGITEMVASVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+Y+VSGPCPDDWSL QKLIL+GCEPLPRRRCFAKT+ KVG  L+P 
Sbjct  137  HSCEKSADLLSQYMNYRVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKTVTKVG--LHPL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW   S+KI +WSGL CK   C+N KKLS
Sbjct  195  PISLWKPVSDKIVSWSGLECKKFECLNVKKLS  226



>ref|XP_010692715.1| PREDICTED: uncharacterized protein LOC104905778 [Beta vulgaris 
subsp. vulgaris]
Length=421

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 111/152 (73%), Positives = 130/152 (86%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KLT+MEKE+LGYE+ID+SKPN   EL++FL +H LPLGKDS+TGIT+MVASVG
Sbjct  79   EIESSQKKLTQMEKELLGYETIDVSKPNTPNELKLFLQRHSLPLGKDSKTGITQMVASVG  138

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+C KS+D+LSQFM+YKV+G CPDD S+ QKLI KGCEPLPRRRCFAKTIPKVG NL PF
Sbjct  139  HTCSKSMDMLSQFMNYKVNGQCPDDVSVAQKLISKGCEPLPRRRCFAKTIPKVG-NLYPF  197

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S+KI +WSGL CKN  C+N KKL 
Sbjct  198  PASLWKTVSDKIVSWSGLGCKNFTCLNGKKLG  229



>ref|XP_006353174.1| PREDICTED: uncharacterized protein LOC102605433 [Solanum tuberosum]
Length=423

 Score =   238 bits (606),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 116/152 (76%), Positives = 130/152 (86%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEKE+LGYES DLS P V  E+R FL  H LPLGKDSRTGIT+MVAS+G
Sbjct  77   EIDSSQKKLAQMEKELLGYESFDLSSPKVPNEVRNFLQPHLLPLGKDSRTGITEMVASIG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KSLDLLSQFM+YKV+G CPDDWS+GQKLIL GCEPLPRRRCFAKTIPKVG  L   
Sbjct  137  HSCVKSLDLLSQFMNYKVNGLCPDDWSVGQKLILSGCEPLPRRRCFAKTIPKVG--LLKL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW N SEKIY+WSGLSCKN+AC+N KKL+
Sbjct  195  PDSLWGNYSEKIYSWSGLSCKNVACLNVKKLN  226



>ref|XP_010271414.1| PREDICTED: uncharacterized protein LOC104607476 [Nelumbo nucifera]
Length=417

 Score =   237 bits (604),  Expect = 2e-73, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 131/152 (86%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEKE+LGYE+ID+S+PN+A EL++FL  H LPLGKDSRTGIT+MVASVG
Sbjct  73   EIDSSQRKLAQMEKELLGYENIDISRPNIANELKLFLQHHSLPLGKDSRTGITEMVASVG  132

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS+D+LSQ+MSYK+ G CPDDWSL QKLIL+GCEPLPRRRC AK++ KVG  L PF
Sbjct  133  HSCEKSIDVLSQYMSYKLGGACPDDWSLAQKLILRGCEPLPRRRCLAKSVSKVG--LFPF  190

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            PLSLW   S+KI +WSGL CK+  C+NSKK+ 
Sbjct  191  PLSLWKPFSDKIVSWSGLGCKSFDCLNSKKIG  222



>ref|XP_004499234.1| PREDICTED: uncharacterized protein LOC101508990 [Cicer arietinum]
Length=423

 Score =   237 bits (604),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 114/154 (74%), Positives = 133/154 (86%), Gaps = 4/154 (3%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+PN+A EL++FLL+HQLPL KDSRTGIT+MVASVG
Sbjct  76   EIDLSQKKLAQMEKEILGYESIDLSRPNIANELKIFLLRHQLPLWKDSRTGITEMVASVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+K+ DLLSQFMSYKVSG CPDDWSL QKLILKGCEPLPRRRCFAKT+PKVG  L PF
Sbjct  136  HSCDKASDLLSQFMSYKVSGNCPDDWSLAQKLILKGCEPLPRRRCFAKTVPKVG--LFPF  193

Query  362  PLSLWSN--NSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW +  N+ K   WSGL+CK+  C+  KKLS
Sbjct  194  PISLWKSVGNNNKSVNWSGLNCKSFECLKGKKLS  227



>ref|XP_004250146.1| PREDICTED: uncharacterized protein LOC101246201 [Solanum lycopersicum]
Length=423

 Score =   236 bits (603),  Expect = 5e-73, Method: Compositional matrix adjust.
 Identities = 115/152 (76%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            +I+SSQ+KL +MEKE+LGYES DLS P V  E+R FL  H LPLGKDSRTGIT+MVAS+G
Sbjct  77   QIDSSQKKLAQMEKELLGYESFDLSSPKVPNEVRNFLQPHLLPLGKDSRTGITEMVASIG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KSLDLLSQFMSYKV+G CPDDWSLGQKLIL GCEPLPRRRCFAKTIPKVG  L   
Sbjct  137  HSCVKSLDLLSQFMSYKVNGLCPDDWSLGQKLILSGCEPLPRRRCFAKTIPKVG--LLKL  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P S W N SEKIY+WSGL CKN+AC+N KKL+
Sbjct  195  PDSFWGNYSEKIYSWSGLGCKNVACLNVKKLN  226



>ref|XP_004291387.1| PREDICTED: uncharacterized protein LOC101314531 [Fragaria vesca 
subsp. vesca]
Length=418

 Score =   235 bits (599),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 129/152 (85%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQ+KL +MEK++LGY+SIDL++PN   EL+ FL  H LPLGKDSRTGIT+M+ASVG
Sbjct  79   EIDSSQKKLAQMEKDLLGYDSIDLTRPNTPTELKAFLNHHTLPLGKDSRTGITEMLASVG  138

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS +LLSQ+MSYK SGPCPDDWSL Q+LIL+GCEPLPRRRCFAKT+PKVG  L+ F
Sbjct  139  HSCEKSAELLSQYMSYKPSGPCPDDWSLAQRLILRGCEPLPRRRCFAKTVPKVG--LSSF  196

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW N S K  TWSGL CKN  C++SKKLS
Sbjct  197  PFSLWKNVSAKSVTWSGLGCKNFECLSSKKLS  228



>ref|XP_003545042.1| PREDICTED: uncharacterized protein LOC100786204 isoform 1 [Glycine 
max]
 gb|KHN39440.1| Putative methyltransferase PMT16 [Glycine soja]
Length=421

 Score =   233 bits (594),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 110/152 (72%), Positives = 128/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+PN+A+EL++FL +HQLPLGKDSRTGIT+MV SVG
Sbjct  77   EIDLSQKKLAQMEKELLGYESIDLSRPNIASELKLFLQRHQLPLGKDSRTGITEMVPSVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CEK+ DLLSQFM+YKV G CPDDWS+ QKLILKGCEPLPRRRCFAKT+ KVG  L PF
Sbjct  137  HTCEKNSDLLSQFMNYKVFGACPDDWSVAQKLILKGCEPLPRRRCFAKTVSKVG--LYPF  194

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW     K   WSGL+CKN  C+N KKLS
Sbjct  195  PDSLWKPVGNKTVNWSGLNCKNFECLNGKKLS  226



>ref|XP_007160685.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
 gb|ESW32679.1| hypothetical protein PHAVU_001G008400g [Phaseolus vulgaris]
Length=420

 Score =   230 bits (586),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 109/152 (72%), Positives = 127/152 (84%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+PN+A+EL++FL + +LPLGKDSRTGIT+MV SVG
Sbjct  76   EIDLSQKKLAQMEKELLGYESIDLSRPNIASELKVFLQRQELPLGKDSRTGITEMVPSVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CEK+ DLLSQFMSYKV G CPDDWS+ QKLILKGCEPLPRRRCFAKT+ KVG  L PF
Sbjct  136  HTCEKNSDLLSQFMSYKVFGACPDDWSVAQKLILKGCEPLPRRRCFAKTVSKVG--LYPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW     K   WSGL CKN  C+NSK+LS
Sbjct  194  PDSLWKPVGNKTVNWSGLGCKNFECLNSKRLS  225



>gb|KEH40211.1| ATRAD3-like protein [Medicago truncatula]
Length=426

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEK++LGYESIDLS+PN+A EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  81   EIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRHQLPLGKDSRTGITEMVSSVG  140

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQFMSYK SG CPDDWS+ QKLILKGCEPLPRRRCF+KT+ K G    PF
Sbjct  141  HSCEKSADLLSQFMSYKASGACPDDWSVAQKLILKGCEPLPRRRCFSKTVSKSG--FFPF  198

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P+SLW       + WSGL+CK+  C+  KKLS
Sbjct  199  PVSLWKPLGNNTFNWSGLNCKSFECLKGKKLS  230



>ref|XP_003550415.1| PREDICTED: uncharacterized protein LOC100812467 [Glycine max]
 gb|KHN12655.1| hypothetical protein glysoja_008618 [Glycine soja]
Length=422

 Score =   228 bits (581),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 107/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEKE+LGYESIDLS+PN+A+EL++FL +HQLPLGKDSRTGIT+MV SVG
Sbjct  78   EIDLSQKKLAQMEKELLGYESIDLSRPNIASELKLFLQRHQLPLGKDSRTGITEMVPSVG  137

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CEK+ D LSQFM+YKV G CPDDWS+ QKLILKGCEPLPRRRCFAKT+ K G    PF
Sbjct  138  HTCEKNSDFLSQFMNYKVFGACPDDWSVAQKLILKGCEPLPRRRCFAKTVSKAG--WYPF  195

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW     K   WSGL+CKN  C+N KKLS
Sbjct  196  PDSLWKPVGNKTVNWSGLNCKNFECLNGKKLS  227



>ref|XP_003523577.1| PREDICTED: uncharacterized protein LOC100798510 [Glycine max]
 gb|KHN45912.1| hypothetical protein glysoja_023135 [Glycine soja]
Length=420

 Score =   227 bits (579),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 126/152 (83%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL ++EK++LGYES+DLS+PN+A EL++FL  HQLPLGKDS++GIT+MV+SVG
Sbjct  75   EIDMSQKKLAQIEKDLLGYESLDLSRPNIANELKLFLHHHQLPLGKDSKSGITEMVSSVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYK  GPCP+DWS+ QKLILKGCEPLPRRRCFAKTI KVGL L+PF
Sbjct  135  HSCEKSSDLLSQYMSYKAFGPCPNDWSVAQKLILKGCEPLPRRRCFAKTISKVGL-LHPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW         WSGL CKN  C+  KKLS
Sbjct  194  PTSLWKAPVNNTVNWSGLGCKNFECLKGKKLS  225



>gb|AAK84481.1| unknown [Solanum lycopersicum]
Length=340

 Score =   222 bits (565),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 109/141 (77%), Positives = 118/141 (84%), Gaps = 2/141 (1%)
 Frame = +2

Query  35   MEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLS  214
            MEKE+LGYES DLS P V  E+R FL  H LPLGKDSRTGIT+MVAS+GHSC KSLDLLS
Sbjct  1    MEKELLGYESFDLSSPKVPNEVRNFLQPHLLPLGKDSRTGITEMVASIGHSCVKSLDLLS  60

Query  215  QFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEK  394
            QFMSYKV+G CPDDWSLGQKLIL GCEPLPRRRCFAKTIPKVG  L   P S W N SEK
Sbjct  61   QFMSYKVNGLCPDDWSLGQKLILSGCEPLPRRRCFAKTIPKVG--LLKLPDSFWGNYSEK  118

Query  395  IYTWSGLSCKNLACVNSKKLS  457
            IY+WSGL CKN+AC+N KKL+
Sbjct  119  IYSWSGLGCKNVACLNVKKLN  139



>ref|XP_006395469.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 ref|XP_006395470.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32755.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
 gb|ESQ32756.1| hypothetical protein EUTSA_v10004321mg [Eutrema salsugineum]
Length=409

 Score =   221 bits (562),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  73   EIDSSQRKLAQMEKQILGYESIDLSRPNIGPELKLFLQRHQLPLGKDSRTGITEMVSSVG  132

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+PK   +L   
Sbjct  133  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVPKQ--DLKQS  190

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSGL CK+  C+  KKLS
Sbjct  191  PNSLWGTVSNKSVNWSGLGCKSFDCLKGKKLS  222



>ref|XP_010507038.1| PREDICTED: uncharacterized protein LOC104783598 [Camelina sativa]
Length=336

 Score =   218 bits (556),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+ F
Sbjct  134  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSRF  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
              SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  TDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>ref|XP_010425464.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
 ref|XP_010425466.1| PREDICTED: uncharacterized protein LOC104710544 [Camelina sativa]
Length=410

 Score =   220 bits (561),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+ F
Sbjct  134  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSRF  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>ref|XP_010514415.1| PREDICTED: uncharacterized protein LOC104790374 [Camelina sativa]
Length=410

 Score =   220 bits (561),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 106/152 (70%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+ F
Sbjct  134  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSRF  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>ref|XP_009111558.1| PREDICTED: uncharacterized protein LOC103836982 [Brassica rapa]
Length=412

 Score =   220 bits (560),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV++VG
Sbjct  76   EIDSSQRKLAQMEKQILGYESIDLSRPNIVPELKLFLHRHQLPLGKDSRTGITEMVSAVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE+S DLLSQ+MSYKV   CPDDWSLGQKLIL+GCEPLPRRRC AKT+ K   +L PF
Sbjct  136  HSCERSPDLLSQYMSYKVFDRCPDDWSLGQKLILRGCEPLPRRRCLAKTVAKQ--DLKPF  193

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSGL CK   C+  KK+ 
Sbjct  194  PDSLWRPVSNKSVNWSGLGCKGFDCLKGKKIG  225



>ref|XP_007136075.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08069.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=396

 Score =   218 bits (556),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL ++EK++LGYESIDLS+ N A EL++FL +H LPLGKDS+TGIT+MV+SVG
Sbjct  74   EIDLSQKKLAQIEKDLLGYESIDLSRNNTANELKLFLHRHHLPLGKDSKTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+KS DLLSQ+MSYKVSGPC +DWS+ QKL+LKGCEPLPRRRCFAKTI KVGL L+PF
Sbjct  134  HSCDKSSDLLSQYMSYKVSGPCLNDWSVAQKLVLKGCEPLPRRRCFAKTISKVGL-LHPF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW         WSGL CK+  C+  KKLS
Sbjct  193  PTSLWEPPVNNTVNWSGLGCKSFECLKGKKLS  224



>ref|XP_007136074.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
 gb|ESW08068.1| hypothetical protein PHAVU_009G015500g [Phaseolus vulgaris]
Length=419

 Score =   218 bits (556),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 125/152 (82%), Gaps = 1/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL ++EK++LGYESIDLS+ N A EL++FL +H LPLGKDS+TGIT+MV+SVG
Sbjct  74   EIDLSQKKLAQIEKDLLGYESIDLSRNNTANELKLFLHRHHLPLGKDSKTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+KS DLLSQ+MSYKVSGPC +DWS+ QKL+LKGCEPLPRRRCFAKTI KVGL L+PF
Sbjct  134  HSCDKSSDLLSQYMSYKVSGPCLNDWSVAQKLVLKGCEPLPRRRCFAKTISKVGL-LHPF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW         WSGL CK+  C+  KKLS
Sbjct  193  PTSLWEPPVNNTVNWSGLGCKSFECLKGKKLS  224



>ref|XP_002875365.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH51624.1| hypothetical protein ARALYDRAFT_904944 [Arabidopsis lyrata subsp. 
lyrata]
Length=410

 Score =   218 bits (554),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 125/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+ +
Sbjct  134  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSRW  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>gb|AAM63602.1| unknown [Arabidopsis thaliana]
Length=410

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 104/152 (68%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESID+S+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+  
Sbjct  134  HSCEKSTDLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSKS  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>ref|XP_006291222.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
 gb|EOA24120.1| hypothetical protein CARUB_v10017354mg [Capsella rubella]
Length=410

 Score =   216 bits (551),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 105/152 (69%), Positives = 124/152 (82%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDLSRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K  L+ +  
Sbjct  134  HSCEKSADLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQDLSRS--  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>gb|AES71185.2| ATRAD3-like protein [Medicago truncatula]
Length=278

 Score =   211 bits (538),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL ++EK++LGYES DLS+PN+A EL++FL  H+LPLGKDS+TG+T+MV+S+G
Sbjct  48   EIDQSQKKLAQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSMG  107

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            +SCEKS DL+SQ+M+YKV G C DDWS  QKLILKGCEPLPRRRCFAK++      L+PF
Sbjct  108  YSCEKSSDLMSQYMNYKVFGNCQDDWSYAQKLILKGCEPLPRRRCFAKSVSSKVNYLHPF  167

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSG SCKN  C+N KKL+
Sbjct  168  PTSLWKPVSNKTVNWSGFSCKNFECLNGKKLN  199



>ref|XP_010557488.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557489.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
 ref|XP_010557490.1| PREDICTED: uncharacterized protein LOC104826476 [Tarenaya hassleriana]
Length=419

 Score =   214 bits (545),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/151 (68%), Positives = 121/151 (80%), Gaps = 2/151 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+A EL++FL  HQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSQRKLAQMEKQLLGYESIDLSRPNIAQELKLFLQHHQLPLGKDSRTGITEMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KS DLLSQ+M+YKV   CPDDWSL +KLIL+GCEPLPRRRC AKT+ K   +L  F
Sbjct  135  HSCLKSSDLLSQYMAYKVFDRCPDDWSLAEKLILRGCEPLPRRRCLAKTVHKS--DLRHF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            P SLW   S K   WSG+ CK+  C+  KKL
Sbjct  193  PDSLWRPVSNKSVNWSGIGCKSFDCLKGKKL  223



>gb|AAL77659.1| AT3g27230/K17E12_5 [Arabidopsis thaliana]
Length=410

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESID+S+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+  
Sbjct  134  HSCGKSTDLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSKS  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>ref|NP_566813.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
 dbj|BAB02118.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAW39023.1| At3g27230 [Arabidopsis thaliana]
 gb|AAY25408.1| At3g27230 [Arabidopsis thaliana]
 gb|AEE77281.1| S-adenosyl-L-methionine-dependent methyltransferase-like protein 
[Arabidopsis thaliana]
Length=410

 Score =   214 bits (544),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 103/152 (68%), Positives = 123/152 (81%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESID+S+PN+  EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDSSQRKLAQMEKQMLGYESIDISRPNIVPELKLFLQRHQLPLGKDSRTGITEMVSSVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC KS DLLSQ+MSYKV   CPDDWSLGQKLIL+ CEPLPRRRC AKT+ K   +L+  
Sbjct  134  HSCGKSTDLLSQYMSYKVFDRCPDDWSLGQKLILRACEPLPRRRCLAKTVQKQ--DLSKS  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW + S K   WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRSVSNKSVNWSGLGCKSFDCLKGKKLS  223



>gb|ACJ84820.1| unknown [Medicago truncatula]
Length=218

 Score =   207 bits (527),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 96/135 (71%), Positives = 113/135 (84%), Gaps = 2/135 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEK++LGYESIDLS+PN+A EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  81   EIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRHQLPLGKDSRTGITEMVSSVG  140

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQFMSYK SG CPDDWS+ QKLILKGCEPLPRRRCF+KT+ K G    PF
Sbjct  141  HSCEKSADLLSQFMSYKASGACPDDWSVAQKLILKGCEPLPRRRCFSKTVSKSG--FFPF  198

Query  362  PLSLWSNNSEKIYTW  406
            P+SLW       + W
Sbjct  199  PVSLWKPLGNNTFNW  213



>gb|AFK44341.1| unknown [Medicago truncatula]
Length=421

 Score =   213 bits (542),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KLT++EK++LGYES DLS+PN+A EL++FL  H+LPLGKDS+TG+T+MV+SVG
Sbjct  76   EIDQSQKKLTQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKV G C DDWS  QKLI K CEPLPRRRCFAK++      L+PF
Sbjct  136  HSCEKSSDLLSQYMNYKVFGNCQDDWSFAQKLISKRCEPLPRRRCFAKSVSSKVNYLHPF  195

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSG SCKN  C+N KKL+
Sbjct  196  PTSLWKPVSNKTVNWSGFSCKNFECLNGKKLN  227



>gb|KEH36237.1| ATRAD3-like protein [Medicago truncatula]
Length=421

 Score =   213 bits (541),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 121/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KLT++EK++LGYES DLS+PN+A EL++FL  H+LPLGKDS+TG+T+MV+SVG
Sbjct  76   EIDQSQKKLTQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS DLLSQ+M+YKV G C DDWS  QKLI K CEPLPRRRCFAK++      L+PF
Sbjct  136  HSCEKSSDLLSQYMNYKVFGNCQDDWSFAQKLISKRCEPLPRRRCFAKSVSSKVNYLHPF  195

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSG SCKN  C+N KKL+
Sbjct  196  PTSLWKPVSNKTVNWSGFSCKNFECLNGKKLN  227



>gb|ACU21328.1| unknown [Glycine max]
Length=215

 Score =   206 bits (525),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 100/144 (69%), Positives = 120/144 (83%), Gaps = 9/144 (6%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +ME+E+LGYESIDLS+PN+A+EL++FL +HQLPLGKDSRTGIT+MV SVG
Sbjct  77   EIDLSQKKLAQMERELLGYESIDLSRPNIASELKLFLQRHQLPLGKDSRTGITEMVPSVG  136

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CEK+ DLLSQFM+YKV G CPDDWS+ QKLILKGCEPLPRRRCFAKT+ KVG  L PF
Sbjct  137  HTCEKNSDLLSQFMNYKVFGACPDDWSVAQKLILKGCEPLPRRRCFAKTVSKVG--LYPF  194

Query  362  PLSL---WSNNSEKIYTWSGLSCK  424
             +SL   W     K   WSGL+C+
Sbjct  195  QISLEACW----YKTVNWSGLNCR  214



>emb|CBI19830.3| unnamed protein product [Vitis vinifera]
Length=446

 Score =   213 bits (541),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 116/125 (93%), Gaps = 2/125 (2%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIESSQ+KL +MEKE+LGYESIDLS+PN A+EL++FL +HQLPLGKDS+TGIT+MVASVG
Sbjct  113  EIESSQKKLAQMEKELLGYESIDLSRPNTASELKLFLQRHQLPLGKDSKTGITEMVASVG  172

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSC+KS+DLLSQ+M+YKVSG CPDDWSL Q+LIL+GCEPLPRRRCFAK++PKVG  L  F
Sbjct  173  HSCDKSVDLLSQYMTYKVSGACPDDWSLAQRLILRGCEPLPRRRCFAKSVPKVG--LYSF  230

Query  362  PLSLW  376
            P+SLW
Sbjct  231  PISLW  235



>ref|XP_003600934.1| hypothetical protein MTR_3g071050 [Medicago truncatula]
Length=418

 Score =   210 bits (535),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 97/152 (64%), Positives = 122/152 (80%), Gaps = 0/152 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL ++EK++LGYES DLS+PN+A EL++FL  H+LPLGKDS+TG+T+MV+S+G
Sbjct  145  EIDQSQKKLAQIEKQLLGYESFDLSRPNIAKELKLFLNPHKLPLGKDSKTGMTEMVSSMG  204

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            +SCEKS DL+SQ+M+YKV G C DDWS  QKLILKGCEPLPRRRCFAK++      L+PF
Sbjct  205  YSCEKSSDLMSQYMNYKVFGNCQDDWSYAQKLILKGCEPLPRRRCFAKSVSSKVNYLHPF  264

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S K   WSG SCKN  C+N KKL+
Sbjct  265  PTSLWKPVSNKTVNWSGFSCKNFECLNGKKLN  296



>ref|XP_006282947.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
 gb|EOA15845.1| hypothetical protein CARUB_v10007544mg [Capsella rubella]
Length=414

 Score =   209 bits (533),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 102/152 (67%), Positives = 118/152 (78%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++MEK+++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  74   EIDSSHRTLSQMEKQMVGYESLDLSHPEVPEELKLFLQQHQLPLGKDSRTGITQMVASVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+CE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K GL L  F
Sbjct  134  HTCELSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPGLAL--F  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S     WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRPVSNNSVNWSGLGCKSFECLKGKKLS  223



>ref|NP_198899.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 ref|NP_001031989.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 dbj|BAB11345.1| unnamed protein product [Arabidopsis thaliana]
 gb|AAO00836.1| putative protein [Arabidopsis thaliana]
 gb|AAP37857.1| At5g40830 [Arabidopsis thaliana]
 gb|AED94600.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
 gb|AED94601.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Arabidopsis thaliana]
Length=414

 Score =   207 bits (526),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 101/152 (66%), Positives = 116/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS   LT+MEK+++GYES+DLS+  V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  74   EIDSSHHTLTQMEKQIIGYESLDLSQQEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K GL L  F
Sbjct  134  HSCEMSLDLLSQYMSYNVFEKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPGLAL--F  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW         WSGL CK+  C+  KKLS
Sbjct  192  PDSLWRPVGNSSVNWSGLGCKSFECLKGKKLS  223



>ref|XP_010450611.1| PREDICTED: uncharacterized protein LOC104732730 isoform X1 [Camelina 
sativa]
Length=418

 Score =   206 bits (525),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 117/152 (77%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++ME +++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K G  L  F
Sbjct  135  HSCETSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPG--LATF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S +   WSGL CK+  C+  KKL+
Sbjct  193  PDSLWRPVSNESVNWSGLGCKSFDCLRGKKLN  224



>ref|XP_010441241.1| PREDICTED: uncharacterized protein LOC104724452 isoform X1 [Camelina 
sativa]
Length=417

 Score =   206 bits (523),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++ME +++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K G  L  F
Sbjct  135  HSCETSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPG--LATF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW         WSGL CK+  C+  KKLS
Sbjct  193  PDSLWRPVGNDSVNWSGLGCKSFDCLKGKKLS  224



>ref|XP_010450612.1| PREDICTED: uncharacterized protein LOC104732730 isoform X2 [Camelina 
sativa]
Length=383

 Score =   203 bits (517),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 99/152 (65%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++ME +++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K G  L  F
Sbjct  135  HSCETSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPG--LATF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S +   WSGL CK+  C+    LS
Sbjct  193  PDSLWRPVSNESVNWSGLGCKSFDCLRDDVLS  224



>ref|XP_002868627.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44886.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   204 bits (518),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L+ MEK+++G+ES+DLS   V  EL++FL QHQLPLGKDSRTGIT MVASVG
Sbjct  74   EIDSSHRTLSLMEKQMIGFESLDLSHQEVPQELKLFLQQHQLPLGKDSRTGITHMVASVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K GL    F
Sbjct  134  HSCEMSLDLLSQYMSYNVFEKCPDDWSLAQKLILRACEPLPRRRCLAKTVQKTGLAW--F  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S     WSGL CK+  C+ +KKLS
Sbjct  192  PDSLWRPVSNSSVNWSGLGCKSFECLKAKKLS  223



>ref|XP_002868633.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44892.1| ATRAD3 [Arabidopsis lyrata subsp. lyrata]
Length=414

 Score =   204 bits (518),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 100/152 (66%), Positives = 115/152 (76%), Gaps = 2/152 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L+ MEK+++G+ES+DLS   V  EL++FL QHQLPLGKDSRTGIT MVASVG
Sbjct  74   EIDSSHRTLSLMEKQMIGFESLDLSHQEVPQELKLFLQQHQLPLGKDSRTGITHMVASVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K GL    F
Sbjct  134  HSCEMSLDLLSQYMSYNVFEKCPDDWSLAQKLILRACEPLPRRRCLAKTVQKTGLAW--F  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            P SLW   S     WSGL CK+  C+ +KKLS
Sbjct  192  PDSLWRPVSNSSVNWSGLGCKSFECLKAKKLS  223



>ref|XP_010450613.1| PREDICTED: uncharacterized protein LOC104732730 isoform X3 [Camelina 
sativa]
Length=377

 Score =   202 bits (513),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 113/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++ME +++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K G  L  F
Sbjct  135  HSCETSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPG--LATF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACV  439
            P SLW   S +   WSGL CK+  C+
Sbjct  193  PDSLWRPVSNESVNWSGLGCKSFDCL  218



>dbj|BAH57084.1| AT5G40830 [Arabidopsis thaliana]
Length=374

 Score =   201 bits (511),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 97/146 (66%), Positives = 112/146 (77%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS   LT+MEK+++GYES+DLS+  V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  74   EIDSSHHTLTQMEKQIIGYESLDLSQQEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K GL L  F
Sbjct  134  HSCEMSLDLLSQYMSYNVFEKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPGLAL--F  191

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACV  439
            P SLW         WSGL CK+  C+
Sbjct  192  PDSLWRPVGNSSVNWSGLGCKSFECL  217



>ref|XP_010441242.1| PREDICTED: uncharacterized protein LOC104724452 isoform X2 [Camelina 
sativa]
Length=376

 Score =   199 bits (507),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/146 (66%), Positives = 111/146 (76%), Gaps = 2/146 (1%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SS R L++ME +++GYES+DLS P V  EL++FL QHQLPLGKDSRTGIT+MVASVG
Sbjct  75   EIDSSHRTLSQMETKMVGYESLDLSHPEVPQELKLFLQQHQLPLGKDSRTGITQMVASVG  134

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCE SLDLLSQ+MSY V   CPDDWSL QKLIL+ CEPLPRRRC AKT+ K G  L  F
Sbjct  135  HSCETSLDLLSQYMSYNVFDKCPDDWSLAQKLILRACEPLPRRRCLAKTVHKPG--LATF  192

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACV  439
            P SLW         WSGL CK+  C+
Sbjct  193  PDSLWRPVGNDSVNWSGLGCKSFDCL  218



>emb|CDY20059.1| BnaA09g01920D [Brassica napus]
Length=371

 Score =   189 bits (480),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 86/110 (78%), Positives = 101/110 (92%), Gaps = 0/110 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+SSQRKL +MEK++LGYESIDLS+PN+  EL++FL +HQLPLGKDSRTGIT+MV++VG
Sbjct  74   EIDSSQRKLAQMEKQILGYESIDLSRPNIVPELKLFLHRHQLPLGKDSRTGITEMVSAVG  133

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTI  331
            HSCE+S DLLSQ+MSYKV   CPDDWSLGQKLIL+GCEPLPRRRC AKTI
Sbjct  134  HSCERSPDLLSQYMSYKVFDRCPDDWSLGQKLILRGCEPLPRRRCLAKTI  183



>gb|KJB63557.1| hypothetical protein B456_010G005600 [Gossypium raimondii]
Length=382

 Score =   175 bits (443),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 84/149 (56%), Positives = 107/149 (72%), Gaps = 31/149 (21%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            +I+SSQ+KL R+E ++LGY+++++S+PN+A EL++              TGIT+MVASVG
Sbjct  74   QIDSSQKKLARIENQLLGYQTLNVSRPNLANELKL--------------TGITEMVASVG  119

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            HSCEKS  LLSQ+M+YKVSGPCPDDWSL QKLIL+GCEPLPRRRCFAKT+ KVGL+    
Sbjct  120  HSCEKSAGLLSQYMTYKVSGPCPDDWSLAQKLILRGCEPLPRRRCFAKTVSKVGLS----  175

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSK  448
                         TWSG  CKN+ C+N K
Sbjct  176  -------------TWSGFGCKNINCLNKK  191



>ref|XP_006840653.1| hypothetical protein AMTR_s00211p00024510 [Amborella trichopoda]
 gb|ERN02328.1| hypothetical protein AMTR_s00211p00024510 [Amborella trichopoda]
Length=276

 Score =   172 bits (436),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 81/148 (55%), Positives = 110/148 (74%), Gaps = 6/148 (4%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI SSQ KL +M+KE++G+E++DLS P + +EL++++    LPLGKDSR GIT+MV++VG
Sbjct  76   EINSSQHKLAQMQKELIGFETLDLSVPGLPSELKLYMEAQPLPLGKDSRMGITEMVSAVG  135

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
            H+C  S+DLLS +M+YK    CPDDW L QKL+L+GCEPLPRRRCF+++IPK+GL    F
Sbjct  136  HACVNSIDLLSLYMNYKPGHQCPDDWDLAQKLMLRGCEPLPRRRCFSRSIPKLGL----F  191

Query  362  PL--SLWSNNSEKIYTWSGLSCKNLACV  439
            P   SLW    E   +WS  +CKN  C+
Sbjct  192  PSLKSLWKMVPESSISWSRFACKNFDCL  219



>gb|AFK39036.1| unknown [Medicago truncatula]
Length=177

 Score =   162 bits (410),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 74/95 (78%), Positives = 87/95 (92%), Gaps = 0/95 (0%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI+ SQ+KL +MEK++LGYESIDLS+PN+A EL++FL +HQLPLGKDSRTGIT+MV+SVG
Sbjct  81   EIDLSQKKLAQMEKQLLGYESIDLSRPNIANELKIFLQRHQLPLGKDSRTGITEMVSSVG  140

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILK  286
            HSCEKS DLLSQFMSYK SG CPDDWS+ QKLILK
Sbjct  141  HSCEKSADLLSQFMSYKASGACPDDWSVAQKLILK  175



>emb|CDY00165.1| BnaC09g01360D [Brassica napus]
Length=359

 Score =   166 bits (419),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 79/110 (72%), Positives = 92/110 (84%), Gaps = 12/110 (11%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EI++SQRKL +MEK++LGYESIDLS+PN+            LPLGKDSRTGIT+MV+SVG
Sbjct  74   EIDTSQRKLAQMEKQILGYESIDLSRPNI------------LPLGKDSRTGITEMVSSVG  121

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTI  331
            HSCE+S DLLSQ+MSYKV   CPDDWSLGQKLIL+GCEPLPRRRC AKT+
Sbjct  122  HSCERSPDLLSQYMSYKVFDRCPDDWSLGQKLILRGCEPLPRRRCLAKTL  171



>ref|XP_009399468.1| PREDICTED: uncharacterized protein LOC103983867 [Musa acuminata 
subsp. malaccensis]
Length=420

 Score =   143 bits (361),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 71/131 (54%), Positives = 97/131 (74%), Gaps = 5/131 (4%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIE+S+R+L ++E+E+ GY+++D +KP++  ELR+FL  H+LPLG+D+R+GIT+MVASV 
Sbjct  86   EIEASERRLHQIERELAGYDTLDPAKPSLPPELRLFLAHHRLPLGRDARSGITEMVASVA  145

Query  182  HSCEKS--LDLLSQFMSYKVSGPCP-DDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNL  352
            HSC +S   DLL+++MSYK +  CP DD SL QKLI K CEPLPRRRC ++         
Sbjct  146  HSCSRSPAADLLARYMSYKPAALCPADDPSLPQKLIAKACEPLPRRRCLSRPTAPAATAA  205

Query  353  N--PFPLSLWS  379
               PFP SLWS
Sbjct  206  PRLPFPRSLWS  216



>ref|XP_008776887.1| PREDICTED: uncharacterized protein LOC103696936 [Phoenix dactylifera]
Length=403

 Score =   135 bits (339),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 96/133 (72%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIE+S+R+L ++E+E+ GY+++D +KP + +EL++FL +H LPLG+D+R+GIT MV+SV 
Sbjct  73   EIEASERRLHQIERELAGYDTLDPAKPGLPSELKLFLGRHPLPLGRDARSGITAMVSSVA  132

Query  182  HSCEK--SLDLLSQFMSYKVSGPCPD-DWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNL  352
            HSC +  +  LLS FMSY+ + PCP  D  L  KLI K CEPLPRRRC ++  P  G   
Sbjct  133  HSCARPAAAALLSDFMSYRPAAPCPTADPLLPSKLISKACEPLPRRRCLSR--PPAGSPR  190

Query  353  NPFPLSLWSNNSE  391
             P P SLW+ N++
Sbjct  191  LPLPRSLWNPNTK  203



>ref|XP_010934529.1| PREDICTED: uncharacterized protein LOC105054654 [Elaeis guineensis]
Length=502

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/133 (50%), Positives = 97/133 (73%), Gaps = 5/133 (4%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIE+S+R+L ++E+E+ GY++++ +KP + +EL++FL +H LPLG+DSR+GIT MV+SV 
Sbjct  172  EIEASERRLHQIERELAGYDTLNPAKPGLPSELKLFLARHPLPLGRDSRSGITAMVSSVS  231

Query  182  HSCEK--SLDLLSQFMSYKVSGPCPD-DWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNL  352
            HSC +  +  LLS+FM+Y  + PCP  D  L  KLI K CEPLPRRRC ++  P VG   
Sbjct  232  HSCARPAATALLSEFMNYHPAAPCPTADPLLPSKLISKACEPLPRRRCLSR--PPVGAPR  289

Query  353  NPFPLSLWSNNSE  391
             P P SLW+ N++
Sbjct  290  LPLPRSLWNPNAK  302



>ref|XP_009411357.1| PREDICTED: uncharacterized protein LOC103993126 [Musa acuminata 
subsp. malaccensis]
Length=426

 Score =   134 bits (336),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 66/135 (49%), Positives = 97/135 (72%), Gaps = 14/135 (10%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            EIE+S+R+L  +E+E+ GY+ +D SK ++ +EL++FL  H LPLG+D+R+GIT+MVASV 
Sbjct  83   EIEASERRLHMIERELAGYDILDTSKHSLPSELKLFLAHHPLPLGRDARSGITEMVASVA  142

Query  182  HSCEKS--LDLLSQFMSYKVSGPCP-DDWSLGQKLILKGCEPLPRRRCFAK------TIP  334
            HSC +S   +LL+++MSY+ + PCP DD+ L QKL+ K CEPLPRRRC ++       IP
Sbjct  143  HSCARSPAAELLARYMSYRPAAPCPTDDYLLPQKLVAKACEPLPRRRCLSRPAASSAAIP  202

Query  335  KVGLNLNPFPLSLWS  379
            ++      F  SLW+
Sbjct  203  RLS-----FAQSLWN  212



>ref|XP_006854792.1| hypothetical protein AMTR_s00063p00150900 [Amborella trichopoda]
 gb|ERN16259.1| hypothetical protein AMTR_s00063p00150900 [Amborella trichopoda]
Length=95

 Score =   120 bits (300),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 51/95 (54%), Positives = 74/95 (78%), Gaps = 0/95 (0%)
 Frame = +2

Query  35   MEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLS  214
            M+KE++G+E++DLS P +  +L++++    L LGKDSR GI +MV++VGH+C  S+DLLS
Sbjct  1    MQKELIGFETLDLSAPGLPPKLKLYMEAEPLLLGKDSRMGIREMVSAVGHACVNSIDLLS  60

Query  215  QFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCF  319
            Q+++YK    CPDDW + QKL+L+GCEPLP RRC 
Sbjct  61   QYINYKPGHQCPDDWDIAQKLMLRGCEPLPSRRCL  95



>ref|XP_002965799.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
 gb|EFJ33219.1| hypothetical protein SELMODRAFT_84529 [Selaginella moellendorffii]
Length=331

 Score =   111 bits (278),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 79/130 (61%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSC--EKSLDLLSQFMSYK  232
            ++++L  P  ++EL+ F+    LPLGK     I+++ + VGH+C    S DLL  FM Y 
Sbjct  8    DNLNLLDPIPSSELQEFIALRDLPLGKHKLFQISRVASPVGHACAGSSSKDLLQTFMDYP  67

Query  233  VSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSG  412
            V G CPDD  L Q L+L+GCEPLPRRRCFA++ P    +  PFP  LWS   +    W+ 
Sbjct  68   VGGLCPDDSDLAQTLMLQGCEPLPRRRCFARS-PNSSSDPLPFPACLWSLPPDNAILWTH  126

Query  413  LSCKNLACVN  442
             +CKN +C+ 
Sbjct  127  YACKNFSCLG  136



>ref|XP_002974310.1| hypothetical protein SELMODRAFT_101023 [Selaginella moellendorffii]
 gb|EFJ24532.1| hypothetical protein SELMODRAFT_101023 [Selaginella moellendorffii]
Length=315

 Score =   111 bits (277),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            ++ EL  F  + +LPLG++   G+  M + +GH C    +LL +FM Y     CPDDW +
Sbjct  1    MSKELVEFTAERKLPLGRNPNYGLETMTSPIGHRCYAQRELLDRFMGYTPGEICPDDWWI  60

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
            GQ L+L+GCEPLPRRRCFA+T P      +  P SLW   S+K   WS  SCK+  C+ +
Sbjct  61   GQSLMLRGCEPLPRRRCFART-PAAIFPPHSLPGSLWEIPSDKSVLWSHYSCKSFECLKN  119

Query  446  K  448
            +
Sbjct  120  R  120



>ref|XP_002990882.1| hypothetical protein SELMODRAFT_132356 [Selaginella moellendorffii]
 gb|EFJ08155.1| hypothetical protein SELMODRAFT_132356 [Selaginella moellendorffii]
Length=315

 Score =   109 bits (273),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 52/121 (43%), Positives = 73/121 (60%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            ++ EL  F  + +LPLG++   G+  M + +GH C    +LL +FM Y     CPDDW +
Sbjct  1    MSKELVEFTAERKLPLGRNPNYGLETMTSPIGHQCYAQRELLDRFMGYTPGEICPDDWWI  60

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
            GQ L+L+GCEPLPRRRCFA+T P      +  P SLW   S+K   WS  SCK+  C+ +
Sbjct  61   GQSLMLRGCEPLPRRRCFART-PAAISPPHSLPGSLWEIPSDKSVLWSHYSCKSFDCLKN  119

Query  446  K  448
            +
Sbjct  120  R  120



>ref|XP_002993215.1| hypothetical protein SELMODRAFT_431315 [Selaginella moellendorffii]
 gb|EFJ05735.1| hypothetical protein SELMODRAFT_431315 [Selaginella moellendorffii]
Length=458

 Score =   109 bits (273),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 56/130 (43%), Positives = 78/130 (60%), Gaps = 3/130 (2%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSC--EKSLDLLSQFMSYK  232
            ++++L  P  ++EL+ F+    LPLGK     I+++ + VGH+C    S DLL  FM Y 
Sbjct  135  DNLNLLDPIPSSELQEFIALRDLPLGKHKLFQISRVASPVGHACAGSSSKDLLQTFMDYP  194

Query  233  VSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSG  412
            V G CPDD  L Q L+L+GCEPLPRRRCFA + P    +  PFP  LWS   +    W+ 
Sbjct  195  VGGLCPDDSDLAQTLMLQGCEPLPRRRCFAIS-PNSSSDPLPFPACLWSLPPDNSILWTH  253

Query  413  LSCKNLACVN  442
             +CKN +C+ 
Sbjct  254  YACKNFSCLG  263



>ref|XP_006360379.1| PREDICTED: uncharacterized protein LOC102594943 [Solanum tuberosum]
Length=403

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 53/127 (42%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            + I  S  ++ +ELR F   H+LP G  +      ++  VGH C +  DLL ++MSY+V+
Sbjct  71   DDIQASDLDLPSELRAFASPHKLPFGFSTNFDSDSIIPPVGHPCTRFPDLLRRYMSYRVN  130

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
            G CPDD  LGQKL+LKGCEPLPRRRC      +  +   P P SLW+  S+    W+  +
Sbjct  131  GSCPDDEILGQKLLLKGCEPLPRRRC-RPAAQQEYVEPYPLPESLWTTPSDSSVVWTAYT  189

Query  419  CKNLACV  439
            CK   C+
Sbjct  190  CKTYECL  196



>ref|XP_002992478.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
 gb|EFJ06416.1| hypothetical protein SELMODRAFT_135385 [Selaginella moellendorffii]
Length=401

 Score =   109 bits (272),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 74/121 (61%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +++EL  +  +  LPLG++   G   MV+ +GH+C + + LL  +M+Y V   CPDDW++
Sbjct  75   MSSELLEYTEERSLPLGRNPTHGGETMVSPIGHACFQHMALLDTYMNYTVGSLCPDDWNI  134

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             Q L+++GCEPLPRRRCFA++ P     L P P   WS   +    WS  +CK+  C+N 
Sbjct  135  AQALMVRGCEPLPRRRCFARSPPSYSTPL-PLPGCRWSTPPDDTIRWSHYTCKSFDCLNR  193

Query  446  K  448
            +
Sbjct  194  R  194



>ref|XP_006857792.1| hypothetical protein AMTR_s00061p00214420 [Amborella trichopoda]
 gb|ERN19259.1| hypothetical protein AMTR_s00061p00214420 [Amborella trichopoda]
Length=76

 Score =   102 bits (254),  Expect = 5e-25, Method: Compositional matrix adjust.
 Identities = 45/75 (60%), Positives = 58/75 (77%), Gaps = 2/75 (3%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL++++     PLGKD R GI +MV++VGH+C  S+DLLSQ+M+YK    CPDDW L QK
Sbjct  4    ELKLYM--EAQPLGKDLRIGIIEMVSAVGHACVNSIDLLSQYMNYKAGHQCPDDWDLAQK  61

Query  275  LILKGCEPLPRRRCF  319
            L+L+GCE LPRRRCF
Sbjct  62   LMLRGCEQLPRRRCF  76



>ref|XP_009410726.1| PREDICTED: uncharacterized protein LOC103992655 [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   108 bits (269),  Expect = 9e-25, Method: Compositional matrix adjust.
 Identities = 51/124 (41%), Positives = 75/124 (60%), Gaps = 1/124 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
             +  EL++ +  H+LPLG     G  ++  ++G +C +  + L+Q+MSY V G CP D +
Sbjct  119  QLTGELKLAVGPHKLPLGYTPNLGSDELYPTLGTACRRYQEELTQYMSYAVGGECPSDEA  178

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              Q+L+LKGCEPLPRRRC  K+ P   +   PFP SLWS   +   TW   +CKN AC+ 
Sbjct  179  FAQRLMLKGCEPLPRRRCHPKS-PVGYVEPTPFPESLWSIPPDASITWDAYTCKNYACLV  237

Query  443  SKKL  454
             +K+
Sbjct  238  HRKM  241



>ref|XP_004240038.1| PREDICTED: probable methyltransferase PMT19 [Solanum lycopersicum]
Length=403

 Score =   107 bits (268),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 52/127 (41%), Positives = 73/127 (57%), Gaps = 1/127 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            + I  S  ++ +E R F   H+LP G  +      ++  VGH C +  DLL ++MSY+V+
Sbjct  71   DDIQESDLDLPSEFRAFASPHKLPFGFSTNFDSDNIIPPVGHPCTRFPDLLRRYMSYRVN  130

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
            G CPDD  LGQKL+LKGCEPLPRRRC      +  +   P P SLW+  S+    W+  +
Sbjct  131  GSCPDDEILGQKLLLKGCEPLPRRRC-RPAAQQEYVEPYPLPESLWTTPSDSSVVWTAYT  189

Query  419  CKNLACV  439
            CK   C+
Sbjct  190  CKTYECL  196



>ref|XP_010252251.1| PREDICTED: uncharacterized protein LOC104593885 [Nelumbo nucifera]
Length=445

 Score =   104 bits (260),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/135 (41%), Positives = 78/135 (58%), Gaps = 6/135 (4%)
 Frame = +2

Query  53   GYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYK  232
            G+ S+ LS      EL++ +  H+LPLG   R G  ++   VG +C + LD L Q+M+Y 
Sbjct  121  GFSSVQLS-----GELKLAISPHKLPLGYAPRVGSDEVFPPVGAACLQFLDELKQYMTYD  175

Query  233  VSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSG  412
            V G CP D    Q+L+LKGCEPLPRRRC  K+ P   ++  P P SLW+  ++    W  
Sbjct  176  VGGECPVDDVFAQRLMLKGCEPLPRRRCHPKS-PVGYVDPTPHPESLWATPADTSIIWDP  234

Query  413  LSCKNLACVNSKKLS  457
             SCK+  C+  +K S
Sbjct  235  YSCKSYKCLIDRKRS  249



>ref|XP_009382936.1| PREDICTED: uncharacterized protein LOC103970749 [Musa acuminata 
subsp. malaccensis]
Length=437

 Score =   103 bits (257),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 53/124 (43%), Positives = 70/124 (56%), Gaps = 2/124 (2%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
             +  EL++ +  H+LPLG     G  +M  ++G +C +  + L QFMSY V G CP D  
Sbjct  119  QLGGELKLAVGPHKLPLGYTPNLGSHEMYPTLGTACRRFQEELVQFMSYDVGGECPSDEV  178

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLAC-V  439
              Q+L+LKGCEPLPRRRC  K+ P   +   PFP SLWS   +    W   +CKN  C V
Sbjct  179  FAQRLMLKGCEPLPRRRCHPKS-PAGYVEPTPFPESLWSIPPDTSIAWDAYTCKNYTCLV  237

Query  440  NSKK  451
            N  K
Sbjct  238  NRSK  241



>ref|XP_008343074.1| PREDICTED: uncharacterized protein LOC103405840 [Malus domestica]
Length=399

 Score =   102 bits (255),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 52/123 (42%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            N+ AE   F     LP G ++      +   VG +C    DLL +FMSYKV+G CPDD  
Sbjct  75   NLPAEFLAFASGQLLPFGYNANFDSNTIYPPVGQACTLFPDLLRRFMSYKVNGSCPDDEF  134

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L Q+L+LKGCEPLPRRRC   + P   +   P P S WS  S+    W+   CKN  C+ 
Sbjct  135  LAQRLLLKGCEPLPRRRCRPASNPNY-VEXYPLPKSYWSTPSDNSVVWTAYKCKNYDCLI  193

Query  443  SKK  451
            ++K
Sbjct  194  NRK  196



>ref|XP_001767537.1| predicted protein [Physcomitrella patens]
 gb|EDQ67672.1| predicted protein [Physcomitrella patens]
Length=330

 Score =   102 bits (254),  Expect = 6e-23, Method: Compositional matrix adjust.
 Identities = 51/118 (43%), Positives = 70/118 (59%), Gaps = 1/118 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E R ++   +L  G +       M A+VG +C  +LD L QFM+Y+V   CPDD +L QK
Sbjct  11   EFREYVATRKLVFGWNPALSTDMMTATVGQACVANLDDLKQFMNYEVGKVCPDDDNLAQK  70

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L+L GCEPLPRRRC A+   K    L PFP SLW+   ++   WS   CK+  C+N++
Sbjct  71   LLLNGCEPLPRRRCLARGPIKPTEPL-PFPDSLWTEPPDENIRWSAYDCKSFECLNTR  127



>ref|XP_011028455.1| PREDICTED: uncharacterized protein LOC105128463 isoform X2 [Populus 
euphratica]
Length=425

 Score =   102 bits (254),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            E+ S    LT  EK   G + + L    ++ E+ + +  H+LPLG   R G  ++   VG
Sbjct  82   ELRSRHEGLTEKEK---GSDPMKLLNVAMSDEVMLVIGPHKLPLGYSPRMGSDEVYPPVG  138

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
             +C +  + L+Q+M+Y+V G CP D    Q+L+LKGCEPLPRRRC  K+ P   +   PF
Sbjct  139  GACLRYQEELAQYMTYEVGGECPVDDVFAQRLMLKGCEPLPRRRCHPKS-PANYVEPTPF  197

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            P SLW+   +    W   +CK+  C+  ++
Sbjct  198  PKSLWTTPPDTSIIWDPYTCKSYKCLIERR  227



>ref|XP_011028454.1| PREDICTED: uncharacterized protein LOC105128463 isoform X1 [Populus 
euphratica]
Length=450

 Score =   102 bits (253),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 54/150 (36%), Positives = 83/150 (55%), Gaps = 4/150 (3%)
 Frame = +2

Query  2    EIESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVG  181
            E+ S    LT  EK   G + + L    ++ E+ + +  H+LPLG   R G  ++   VG
Sbjct  107  ELRSRHEGLTEKEK---GSDPMKLLNVAMSDEVMLVIGPHKLPLGYSPRMGSDEVYPPVG  163

Query  182  HSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPF  361
             +C +  + L+Q+M+Y+V G CP D    Q+L+LKGCEPLPRRRC  K+ P   +   PF
Sbjct  164  GACLRYQEELAQYMTYEVGGECPVDDVFAQRLMLKGCEPLPRRRCHPKS-PANYVEPTPF  222

Query  362  PLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            P SLW+   +    W   +CK+  C+  ++
Sbjct  223  PKSLWTTPPDTSIIWDPYTCKSYKCLIERR  252



>ref|XP_006836952.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
 gb|ERM99805.1| hypothetical protein AMTR_s00099p00160150 [Amborella trichopoda]
Length=453

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 70/119 (59%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+++ +  H+LPLG     G  ++V  +GH+C      L Q+MSYKV G CP D +L Q+
Sbjct  137  EMKVVVAPHKLPLGYSHAFGTDEIVPPIGHACRLFKSELRQYMSYKVGGECPSDDALAQQ  196

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEPLPRRRC  K+ P   +  + FP S+W+   +    W    CK+  C+  +K
Sbjct  197  LMLKGCEPLPRRRCHPKS-PSNYVEPHAFPQSMWTTPPDTSIVWDPYRCKSYGCLIDRK  254



>ref|XP_009619701.1| PREDICTED: uncharacterized protein LOC104111663 [Nicotiana tomentosiformis]
Length=396

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 55/133 (41%), Positives = 74/133 (56%), Gaps = 6/133 (5%)
 Frame = +2

Query  56   YESIDLSK-----PNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQF  220
            YE++ +S       N+ +E   F    +LPLG        +++  VG  C    DLL+++
Sbjct  58   YEAVQVSDNTQSDQNLPSEFLTFTSPQKLPLGFSKNFDSNEIMPPVGSPCTLFRDLLNRY  117

Query  221  MSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIY  400
            MSY V+G CPDD  L QKL+LKGCEPLPRRRC A    +  +   P P SLW   S+   
Sbjct  118  MSYNVNGSCPDDEFLAQKLLLKGCEPLPRRRCRAAAQQEY-VEPYPIPESLWKTPSDSSV  176

Query  401  TWSGLSCKNLACV  439
             WSG +CKN  C+
Sbjct  177  VWSGYTCKNYDCL  189



>ref|XP_010032737.1| PREDICTED: probable methyltransferase PMT19 [Eucalyptus grandis]
Length=397

 Score =   101 bits (251),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 52/126 (41%), Positives = 69/126 (55%), Gaps = 1/126 (1%)
 Frame = +2

Query  74   SKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPD  253
            S  ++A E + F     L  G +       M   VG  C    DLL +FM+YKV+G CPD
Sbjct  69   SDDDLAPEFKAFTSGQLLAFGVNPNFDSDTMYPPVGRPCTMFPDLLRRFMTYKVNGSCPD  128

Query  254  DWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLA  433
            D  L QKL+LKGCEPLPRRRC     P+  +   P P SLW+  S+    W+  +CKN  
Sbjct  129  DELLAQKLLLKGCEPLPRRRC-RHASPRDYVEPYPLPTSLWTTPSDSSVVWTAYTCKNYD  187

Query  434  CVNSKK  451
            C+ ++K
Sbjct  188  CLINRK  193



>ref|XP_009392585.1| PREDICTED: uncharacterized protein LOC103978498 [Musa acuminata 
subsp. malaccensis]
Length=441

 Score =   101 bits (252),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/139 (38%), Positives = 78/139 (56%), Gaps = 2/139 (1%)
 Frame = +2

Query  38   EKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQ  217
            E  V   + +  S+  +  EL++ +  H++PLG  S  G  ++  ++G +C      L +
Sbjct  107  EDMVAAADGVGGSRDEIPEELKLAMGPHKMPLGFTSNLGTDELYPALGSACFNFQKELVE  166

Query  218  FMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKI  397
            +MSY+V   CP D    Q+L+LKGCEPLPRRRC  K+ PK  +   PFP SLW+   +  
Sbjct  167  YMSYEVGKECPMDEVFAQRLMLKGCEPLPRRRCHPKS-PKGYVEPVPFPASLWTIPPDTS  225

Query  398  YTWSGLSCKNLAC-VNSKK  451
             TW   +CKN  C VN +K
Sbjct  226  ITWDAYTCKNYTCLVNRRK  244



>ref|XP_010271214.1| PREDICTED: uncharacterized protein LOC104607292 [Nelumbo nucifera]
Length=390

 Score =   100 bits (250),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 53/125 (42%), Positives = 65/125 (52%), Gaps = 1/125 (1%)
 Frame = +2

Query  65   IDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGP  244
            +D     +  E   F+   +LP G         +   VG SC    D L  +MSYKV+G 
Sbjct  59   VDDESQRLPPEFIAFISPEELPFGYTKNFDSDTIYPPVGQSCTLFADELRHYMSYKVNGS  118

Query  245  CPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCK  424
            CPDD  L QKL+LKGCEPLPRRRC      K    L P P SLWS  S+    W+  +CK
Sbjct  119  CPDDELLAQKLLLKGCEPLPRRRCRPSAPAKYAEPL-PLPTSLWSTPSDASVVWTAYTCK  177

Query  425  NLACV  439
            N AC+
Sbjct  178  NYACL  182



>ref|XP_009762652.1| PREDICTED: uncharacterized protein LOC104214650 [Nicotiana sylvestris]
Length=405

 Score =   100 bits (250),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 56/141 (40%), Positives = 75/141 (53%), Gaps = 4/141 (3%)
 Frame = +2

Query  29   TRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDL  208
            TR    V    + DL  P   +E   F   HQLP G +      K++  VG  C    DL
Sbjct  66   TRDVVHVSDKPAADLDLP---SEFLAFTSPHQLPFGVNPSFNSDKLIPPVGRPCTMFPDL  122

Query  209  LSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNS  388
            L ++MSYK++G CPDD  L QKL+LKGCEPLPRRRC      +  +   P P SLW   S
Sbjct  123  LRRYMSYKINGSCPDDELLAQKLLLKGCEPLPRRRC-RPAAQQEYVEPYPLPESLWITPS  181

Query  389  EKIYTWSGLSCKNLACVNSKK  451
            +    W+  +CK+  C+ ++K
Sbjct  182  DSSVVWTAYTCKSYECLINRK  202



>ref|XP_002263360.1| PREDICTED: probable methyltransferase PMT12 [Vitis vinifera]
 emb|CAN83179.1| hypothetical protein VITISV_013308 [Vitis vinifera]
Length=392

 Score =   100 bits (249),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E   F     LP G  +      ++A VGH C    + LS++MSY+V+G CPDD  
Sbjct  66   DLPTEFISFTSPQLLPFGFTTNFDSDSIIAPVGHPCTFFANDLSRYMSYRVNGSCPDDEL  125

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              QKL+LKGCEPLPRRRC   T P       P P SLWS   +    W+  +CKN +C+ 
Sbjct  126  FAQKLLLKGCEPLPRRRC-RPTTPNEYQEPYPLPASLWSTPPDSSVVWTAYTCKNYSCLI  184

Query  443  SKK  451
            ++K
Sbjct  185  NRK  187



>gb|EYU33234.1| hypothetical protein MIMGU_mgv1a026970mg [Erythranthe guttata]
Length=458

 Score =   101 bits (251),  Expect = 4e-22, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +V+ E +  +  H+LPLG + R G  ++  SVG  C    + L ++MSY+V G CP D S
Sbjct  139  DVSDEAKFAVGPHKLPLGYNPRMGSDEIYFSVGGGCLNHKEDLEKYMSYQVGGECPVDDS  198

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L Q L+L GCEPLPRRRC  K+ P   +  NP P SLW+   +    W   +CKN  C+ 
Sbjct  199  LSQTLMLMGCEPLPRRRCHPKS-PANYVEPNPLPKSLWATPPDTSIIWDPYTCKNYTCLT  257

Query  443  SKK  451
            +++
Sbjct  258  NRR  260



>ref|XP_006349637.1| PREDICTED: probable methyltransferase PMT19-like [Solanum tuberosum]
Length=396

 Score =   100 bits (248),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 58/147 (39%), Positives = 77/147 (52%), Gaps = 7/147 (5%)
 Frame = +2

Query  29   TRMEKEVLGYESIDLSKP-----NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCE  193
            T + K    YE+I  S       N+ +E   F    +LP G +      +++  +G  C 
Sbjct  49   TVLTKPTPKYEAIQESDTTQTDQNLPSEFLAFTSPQKLPRGFNKNFDSDEIMPPIGRPCT  108

Query  194  KSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSL  373
               DLL ++MSY V+G CPDD  L QKL+LKGCEPLPRRRC     P+  +   PFP SL
Sbjct  109  LFQDLLHRYMSYNVNGSCPDDELLAQKLLLKGCEPLPRRRC-HPVAPQEYVEPYPFPESL  167

Query  374  WSNNSEKIYTWSGLSCKNLAC-VNSKK  451
            W   S+    W+  +CKN  C VN  K
Sbjct  168  WRTPSDFSVVWTAFTCKNYDCLVNRAK  194



>ref|XP_002305225.1| hypothetical protein POPTR_0004s08210g [Populus trichocarpa]
 gb|EEE85736.1| hypothetical protein POPTR_0004s08210g [Populus trichocarpa]
Length=399

 Score = 99.8 bits (247),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++ +E   F     LP G ++          VG +C +  D LS+FMSYKV+G CPDD  
Sbjct  73   DLPSEFLAFTSGQALPYGFNTNFDSDTFYPPVGQACTRFPDELSRFMSYKVNGSCPDDEL  132

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            L QKL+LKGCEPLPRRRC   T P   ++  P P SLW+        W+  +CK+  C+
Sbjct  133  LAQKLLLKGCEPLPRRRCRPATQPDY-VDPYPLPTSLWTTPPNSSVVWTAYTCKDYTCL  190



>ref|XP_009609578.1| PREDICTED: uncharacterized protein LOC104103385 [Nicotiana tomentosiformis]
Length=406

 Score = 99.4 bits (246),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 70/123 (57%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++ +E   F    QLP G +      K++  VG  C    DLL ++MSYK++G CPDD  
Sbjct  82   DLPSEFLAFTSPQQLPFGVNPNFNSDKLIPPVGRPCTMFPDLLRRYMSYKINGSCPDDEL  141

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L QKL+LKGCEPLPRRRC      +  +   P P SLW+  S+    W+  +CK+  C+ 
Sbjct  142  LAQKLLLKGCEPLPRRRC-RPAAQQEYVEPYPLPESLWTTPSDSSVVWTAYTCKSYECLI  200

Query  443  SKK  451
            ++K
Sbjct  201  NRK  203



>ref|XP_004975730.1| PREDICTED: uncharacterized protein LOC101762914 [Setaria italica]
Length=463

 Score =   100 bits (248),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 47/117 (40%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A EL++ +  H+LPLG     G  ++   +G +C    D L+++M+Y   G CPDD +L 
Sbjct  144  AGELKLAIEPHRLPLGFHPNFGTDELFPGLGFACRNFQDELARYMAYDAGGECPDDDALA  203

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
             +L LKGCEPLPRRRC A++ P   +   P P SLWS   +    W+  +CKN  C+
Sbjct  204  LQLALKGCEPLPRRRCRARS-PVGYVEPAPLPRSLWSVPPDTTVRWAPYTCKNYTCL  259



>gb|KDP32451.1| hypothetical protein JCGZ_13376 [Jatropha curcas]
Length=223

 Score = 97.4 bits (241),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/116 (40%), Positives = 68/116 (59%), Gaps = 1/116 (1%)
 Frame = +2

Query  104  MFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLIL  283
            + +  H+LPLG   RTG  ++   +G  C +  + L+++MSY++ G CP D    Q+L+L
Sbjct  2    LAIAPHKLPLGYSPRTGSDEIYPPLGAGCLRYQEELTKYMSYEIGGECPVDDVFAQRLML  61

Query  284  KGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            +GCEPLPRRRC  K+ P   +  NP P SLWS   +    W   +CKN  C+  +K
Sbjct  62   RGCEPLPRRRCRVKS-PANYVEPNPLPESLWSTPPDNSIIWDPYTCKNYKCLIDRK  116



>ref|XP_004306056.1| PREDICTED: uncharacterized protein LOC101293034 [Fragaria vesca 
subsp. vesca]
Length=469

 Score =   100 bits (248),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 47/107 (44%), Positives = 66/107 (62%), Gaps = 1/107 (1%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            +GK +  G+  +  S+G SC K    L +FMSYKV   CPDDW + QKLI+ GC+PLPRR
Sbjct  167  VGKKNFLGVEALAPSIGLSCAKMASNLDRFMSYKVHSTCPDDWQVAQKLIVNGCDPLPRR  226

Query  311  RCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            RCF K+ P     + P  +SLW+  S+    W+   CK+ +C+ SK+
Sbjct  227  RCFTKSPPHYTKPV-PANVSLWTQPSDANILWNNYKCKDYSCLVSKE  272



>ref|XP_002458886.1| hypothetical protein SORBIDRAFT_03g042190 [Sorghum bicolor]
 gb|EES04006.1| hypothetical protein SORBIDRAFT_03g042190 [Sorghum bicolor]
Length=465

 Score = 99.8 bits (247),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 48/115 (42%), Positives = 67/115 (58%), Gaps = 1/115 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL + L  H LP G        K+  +VG +C +  D L ++M Y VSG CP D +  ++
Sbjct  144  ELTVALGPHTLPFGYTRNLDSDKLYPAVGAACHRHRDELKKYMRYNVSGDCPSDAAFAER  203

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            L+LKGCEPLPRRRC A+  P    +  PFP SLW    +K  +W+  +CKN +C+
Sbjct  204  LMLKGCEPLPRRRCRARG-PAGFPDPTPFPESLWLIPPDKSVSWAPYACKNYSCL  257



>gb|KJB67513.1| hypothetical protein B456_010G194500 [Gossypium raimondii]
Length=449

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 48/123 (39%), Positives = 72/123 (59%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +++ EL++ +L H+LPLG   R    ++   VG +C +    L+Q+M+Y + G CP D  
Sbjct  131  SLSDELKLAILPHKLPLGYSPRMASDEIYPPVGAACLRFQKELAQYMTYDIGGECPMDDV  190

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              QKL+LKGCEPLPRRRC  K+ P   +   PFP SLW+   +    W   +CK+  C+ 
Sbjct  191  FAQKLLLKGCEPLPRRRCHPKS-PIGYVEPTPFPDSLWATPPDTSIIWDTYTCKSYQCLI  249

Query  443  SKK  451
             +K
Sbjct  250  DRK  252



>ref|XP_004289582.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469425.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469430.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469437.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
 ref|XP_011469439.1| PREDICTED: probable methyltransferase PMT19 [Fragaria vesca subsp. 
vesca]
Length=380

 Score = 98.6 bits (244),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E   F   H LP G ++      +    G +C    D L ++MSYKV+G CPDD  
Sbjct  56   DLPPEFLAFASGHALPFGYNANFDSDTIYPPAGKACTLFPDELRRYMSYKVNGSCPDDEL  115

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L QKL+LKGCEPLPRRRC   + P+   +  P P SLW+  S+    W+   CKN  C+ 
Sbjct  116  LAQKLLLKGCEPLPRRRCRPASQPEY-TDPYPLPTSLWTTPSDSSVVWTAYRCKNYNCLV  174

Query  443  SKK  451
            ++K
Sbjct  175  NRK  177



>ref|XP_008231024.1| PREDICTED: uncharacterized protein LOC103330263 [Prunus mume]
Length=465

 Score = 99.4 bits (246),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 47/109 (43%), Positives = 65/109 (60%), Gaps = 5/109 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            +GK +  G+  +  S+G +C      L +FMSYKV   CPDDW + QKLI+ GC+PLPRR
Sbjct  163  IGKKNFLGVEAVTPSIGLACANMATNLDRFMSYKVHSTCPDDWEIAQKLIVHGCDPLPRR  222

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            RCF K+ P       PFP+  SLW+  S     W+   CK+ +C+ SK+
Sbjct  223  RCFTKSPPHYT---KPFPINSSLWTQPSGANILWNNYKCKDYSCLVSKE  268



>ref|XP_008674722.1| PREDICTED: uncharacterized protein LOC103650909 [Zea mays]
 tpg|DAA56453.1| TPA: hypothetical protein ZEAMMB73_137539 [Zea mays]
Length=465

 Score = 99.0 bits (245),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 69/115 (60%), Gaps = 1/115 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL + L  H LP G        K+  ++G +C +  D L+++M Y V+G CP D +L ++
Sbjct  143  ELTVALGPHTLPFGYTPNLDSDKLYPAIGAACHRHRDELNKYMRYNVTGDCPPDAALAER  202

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            L+L+GCEPLPRRRC A+  P    +  PFP SLW    +K  +W+  +CKN +C+
Sbjct  203  LMLRGCEPLPRRRCRARG-PAGFPDPTPFPESLWVVPPDKSVSWAPYACKNYSCL  256



>emb|CDO97681.1| unnamed protein product [Coffea canephora]
Length=436

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 51/137 (37%), Positives = 77/137 (56%), Gaps = 1/137 (1%)
 Frame = +2

Query  41   KEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQF  220
            KEV    S D    +++ E ++ +   +LPLG   R+G  ++  SVG  C +  + L+Q+
Sbjct  115  KEVSSIFSFDDLLSDLSTEAKLGMGPQKLPLGYSPRSGTDELYPSVGGGCLRYEEELAQY  174

Query  221  MSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIY  400
            M+YK+ G CP D    Q+L+LKGCEPLPRRRC  K+ P      +P P SLW+   +   
Sbjct  175  MTYKIGGECPADDVFAQRLMLKGCEPLPRRRCHPKS-PAGYKEPSPLPKSLWTMPPDTSI  233

Query  401  TWSGLSCKNLACVNSKK  451
             W   +CK+  C+  +K
Sbjct  234  VWDPYTCKSYGCLVERK  250



>ref|XP_008789125.1| PREDICTED: uncharacterized protein LOC103706698 [Phoenix dactylifera]
 ref|XP_008778151.1| PREDICTED: uncharacterized protein LOC103697983 [Phoenix dactylifera]
Length=440

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/131 (37%), Positives = 76/131 (58%), Gaps = 1/131 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            E +D     +  EL++ +  H+LPLG+ +     ++  ++G +C +  D L ++MSY+V 
Sbjct  113  EDLDGWLKELTGELKLAVGPHKLPLGESANIRSDELYPTLGTACRRFQDELIRYMSYEVG  172

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
            G CP D +L Q+L+LKGCEPLPRRRC  K+ P        FP SLW+   +    W   +
Sbjct  173  GECPSDDNLAQRLLLKGCEPLPRRRCHPKS-PVGYAEPTTFPASLWTIPPDTSVVWDPYT  231

Query  419  CKNLACVNSKK  451
            CKN AC+  ++
Sbjct  232  CKNYACLVHRR  242



>ref|XP_007147539.1| hypothetical protein PHAVU_006G133100g [Phaseolus vulgaris]
 gb|ESW19533.1| hypothetical protein PHAVU_006G133100g [Phaseolus vulgaris]
Length=440

 Score = 98.6 bits (244),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL   L  H+LP G     G  ++   VG SC    D L+++M+YK+ G CP D+ L Q+
Sbjct  125  ELTFALGPHKLPFGYSPMIGSDEIHTPVGASCMSLHDELNRYMTYKIGGECPMDYVLAQR  184

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEPLPRRRC  K+ P   +   P P SLWS   +    W   +CK+  C+  +K
Sbjct  185  LMLKGCEPLPRRRCHPKS-PANYVEPTPLPESLWSTPPDTSIVWEAYACKSYQCLVDRK  242



>ref|XP_004248708.1| PREDICTED: probable methyltransferase PMT19 [Solanum lycopersicum]
Length=397

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 54/143 (38%), Positives = 74/143 (52%), Gaps = 7/143 (5%)
 Frame = +2

Query  29   TRMEKEVLGYESIDLS------KPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSC  190
            T + K    YE+I  S        N+ +E   F    +LP G +      +++  +G  C
Sbjct  49   TVLAKPTPKYEAIQESSDNTQTDENLPSEFLAFTSPQKLPRGFNKNFNSDEIMPPIGRPC  108

Query  191  EKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLS  370
                DLL ++MSY V+G CPDD  L QKL+LKGCEPLPRRRC     P+  +   PFP S
Sbjct  109  TLFRDLLDRYMSYNVNGSCPDDELLAQKLLLKGCEPLPRRRCHPAA-PQEYVEPYPFPES  167

Query  371  LWSNNSEKIYTWSGLSCKNLACV  439
             W   S+    W+  +CKN  C+
Sbjct  168  QWRTPSDFSVVWTAFTCKNYDCL  190



>gb|KCW62552.1| hypothetical protein EUGRSUZ_G00044, partial [Eucalyptus grandis]
Length=441

 Score = 98.2 bits (243),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 82/155 (53%), Gaps = 7/155 (5%)
 Frame = +2

Query  5    IESSQRKLTRMEK------EVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKM  166
            IES   +LTR+ +      +   Y +   S  N+  ELR+ +   +LPLG   R G   +
Sbjct  104  IESLLTQLTRLNERERSPSDQTNYRADLFSATNLPEELRLAIGPQKLPLGNSPRVGSDVV  163

Query  167  VASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGL  346
            +  VG +C    + L+++MSY+V   CP D +L QKL++KGCE LPRRRC  KT P    
Sbjct  164  LPPVGAACLMFREELAEYMSYQVGAECPVDDALSQKLMVKGCESLPRRRCHPKT-PANSA  222

Query  347  NLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
               PFP +LW+   +    W    CK+  C+  ++
Sbjct  223  EPIPFPQALWTTPPDNSIAWDAYQCKSYQCLIDRR  257



>ref|XP_010065207.1| PREDICTED: uncharacterized protein LOC104452439 [Eucalyptus grandis]
Length=453

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/155 (35%), Positives = 82/155 (53%), Gaps = 7/155 (5%)
 Frame = +2

Query  5    IESSQRKLTRMEK------EVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKM  166
            IES   +LTR+ +      +   Y +   S  N+  ELR+ +   +LPLG   R G   +
Sbjct  104  IESLLTQLTRLNERERSPSDQTNYRADLFSATNLPEELRLAIGPQKLPLGNSPRVGSDVV  163

Query  167  VASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGL  346
            +  VG +C    + L+++MSY+V   CP D +L QKL++KGCE LPRRRC  KT P    
Sbjct  164  LPPVGAACLMFREELAEYMSYQVGAECPVDDALSQKLMVKGCESLPRRRCHPKT-PANSA  222

Query  347  NLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
               PFP +LW+   +    W    CK+  C+  ++
Sbjct  223  EPIPFPQALWTTPPDNSIAWDAYQCKSYQCLIDRR  257



>gb|KHN40740.1| Putative methyltransferase PMT15 [Glycine soja]
Length=441

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 2/143 (1%)
 Frame = +2

Query  26   LTRM-EKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSL  202
            LTR  EK+  G +   +S    + +L   L  H+LP G   R G  ++   VG SC +  
Sbjct  102  LTRQQEKQSNGADQNQMSLKVGSDDLSFALGPHKLPFGYSPRIGSDEIHTPVGASCMRLH  161

Query  203  DLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSN  382
            + L+Q+MSY++ G CP D  L Q+L+LKGCEPLPRRRC  K+ P   +   P P SLW+ 
Sbjct  162  EELNQYMSYEIGGECPMDDVLAQRLMLKGCEPLPRRRCRPKS-PTNYVEPTPLPESLWTT  220

Query  383  NSEKIYTWSGLSCKNLACVNSKK  451
              +    W   +CK+  C+  +K
Sbjct  221  PPDTSIVWDAYACKSYQCLIDRK  243



>ref|XP_006586814.1| PREDICTED: uncharacterized protein LOC102664598 [Glycine max]
Length=441

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 79/143 (55%), Gaps = 2/143 (1%)
 Frame = +2

Query  26   LTRM-EKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSL  202
            LTR  EK+  G +   +S    + +L   L  H+LP G   R G  ++   VG SC +  
Sbjct  102  LTRQQEKQSNGADQNQMSLKVGSDDLSFALGPHKLPFGYSPRIGSDEIHTPVGASCMRLH  161

Query  203  DLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSN  382
            + L+Q+MSY++ G CP D  L Q+L+LKGCEPLPRRRC  K+ P   +   P P SLW+ 
Sbjct  162  EELNQYMSYEIGGECPMDDVLAQRLMLKGCEPLPRRRCRPKS-PTNYVEPTPLPESLWTT  220

Query  383  NSEKIYTWSGLSCKNLACVNSKK  451
              +    W   +CK+  C+  +K
Sbjct  221  PPDTSIVWDAYACKSYQCLIDRK  243



>ref|XP_007217596.1| hypothetical protein PRUPE_ppa018544mg [Prunus persica]
 gb|EMJ18795.1| hypothetical protein PRUPE_ppa018544mg [Prunus persica]
Length=396

 Score = 97.8 bits (242),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 56/127 (44%), Positives = 70/127 (55%), Gaps = 8/127 (6%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E   F     LP G +       +  +VG +C    DLLS+FMSYKV+G CPDD  
Sbjct  72   DLPPEFLAFASGQLLPFGYNINFDSNTIYPAVGQACTLFPDLLSRFMSYKVNGSCPDDEF  131

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLN-LNPFPL--SLWSNNSEKIYTWSGLSCKNLA  433
            L Q+L+LKGCEPLPRRRC     P    N + P+PL  S WS  S+    W+   CKN  
Sbjct  132  LAQRLLLKGCEPLPRRRC----RPASNANYVEPYPLPKSFWSTPSDSSVVWTAYKCKNYN  187

Query  434  C-VNSKK  451
            C VN KK
Sbjct  188  CLVNRKK  194



>ref|XP_008801541.1| PREDICTED: uncharacterized protein LOC103715629 [Phoenix dactylifera]
Length=433

 Score = 98.2 bits (243),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 48/127 (38%), Positives = 74/127 (58%), Gaps = 1/127 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            E +D  +  ++ EL++ +  H+LPLG  +  G  ++  ++G  C +    L+++MSY+V 
Sbjct  106  EDLDGWQNVLSGELKLAVGPHKLPLGFTANLGTDELYPALGSPCRRFQAELTEYMSYEVG  165

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
              CP D    Q+L+LKGCEPLPRRRC  K+ P   +   PFP SLW+   +    W   S
Sbjct  166  KDCPSDDIFAQRLMLKGCEPLPRRRCHPKS-PDGYVEPAPFPASLWTIPPDTSIVWDAYS  224

Query  419  CKNLACV  439
            CKN +C+
Sbjct  225  CKNYSCL  231



>ref|XP_009774313.1| PREDICTED: probable methyltransferase PMT19 [Nicotiana sylvestris]
Length=396

 Score = 97.4 bits (241),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 53/133 (40%), Positives = 73/133 (55%), Gaps = 6/133 (5%)
 Frame = +2

Query  56   YESIDLSK-----PNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQF  220
            YE++ +S       N+ +E        +LPLG        +++  VG  C    DLL+++
Sbjct  58   YEAVQVSDNTQSDQNLPSEFLSLTSPQKLPLGFSKNFDSNEIMPPVGSPCTLFRDLLNRY  117

Query  221  MSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIY  400
            MSY V+G CPDD  L QKL+LKGCEPLPRRRC A    +  +   P P S W+  S+   
Sbjct  118  MSYNVNGSCPDDDFLAQKLLLKGCEPLPRRRCRAAAQQEY-VEPYPIPESFWNTPSDSSV  176

Query  401  TWSGLSCKNLACV  439
             WSG +CKN  C+
Sbjct  177  VWSGYTCKNYDCL  189



>ref|XP_011038251.1| PREDICTED: uncharacterized protein LOC105135192 [Populus euphratica]
Length=402

 Score = 97.4 bits (241),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 65/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++ +E   F     LPLG +++         VG +C +  D LS+FMSYKV+G CPDD  
Sbjct  76   DLPSEFLAFSSGQVLPLGFNTKFDSDTFYPPVGQACTRFPDELSRFMSYKVNGSCPDDEL  135

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
              QKL+LKGCEPLPRRRC     P   +   P P SLW+        W+  +CK+  C+
Sbjct  136  FAQKLLLKGCEPLPRRRCRPAAQPDY-VEPYPLPTSLWTTPPNSSVVWTAYTCKDYTCL  193



>ref|XP_002994258.1| hypothetical protein SELMODRAFT_2228, partial [Selaginella moellendorffii]
 gb|EFJ04670.1| hypothetical protein SELMODRAFT_2228, partial [Selaginella moellendorffii]
Length=320

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E +  +    LPLG  S+     + + VGH+C    + L ++M YK    CPDD SL 
Sbjct  1    ADEFQKLVTPQMLPLGFSSQLKTDALTSPVGHACLMHKEDLEEYMQYKAGELCPDDESLT  60

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSK  448
            QKL+  GCEPLPRRRCFA+ +P       P P S W++  ++   W+  +CK+  C+N++
Sbjct  61   QKLLTGGCEPLPRRRCFAR-LPAGYKEPFPVPKSFWTSPPDENIIWTAYTCKSFECLNAR  119

Query  449  K  451
            K
Sbjct  120  K  120



>ref|XP_002972857.1| hypothetical protein SELMODRAFT_12874, partial [Selaginella moellendorffii]
 gb|EFJ26078.1| hypothetical protein SELMODRAFT_12874, partial [Selaginella moellendorffii]
Length=320

 Score = 96.7 bits (239),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 69/121 (57%), Gaps = 1/121 (1%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E +  +    LPLG  S+     + + VGH+C    + L ++M YK    CPDD SL 
Sbjct  1    ADEFQKLVTPQMLPLGFSSQLKTDALTSPVGHACLMHKEDLEEYMQYKAGELCPDDESLT  60

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSK  448
            QKL+  GCEPLPRRRCFA+ +P       P P S W++  ++   W+  +CK+  C+N++
Sbjct  61   QKLLTGGCEPLPRRRCFAR-LPAGYKEPFPVPKSFWTSPPDENIIWTAYTCKSFECLNAR  119

Query  449  K  451
            K
Sbjct  120  K  120



>gb|KCW62553.1| hypothetical protein EUGRSUZ_G00045 [Eucalyptus grandis]
Length=393

 Score = 97.1 bits (240),  Expect = 6e-21, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 69/119 (58%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E+++ +  H+LPLG   R G   +   VG +C +  + L+Q+MSY+V G CP D  
Sbjct  89   DLPDEVKLAVAPHKLPLGYSPRMGSDMLHPPVGVACLRFKEELAQYMSYEVGGECPVDDV  148

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
              Q+ +LKGCEPLPRRRC  K+  K  +   PFP SLW+   +    W   +CK+  C+
Sbjct  149  FAQRFLLKGCEPLPRRRCHPKSRAKY-VEPTPFPQSLWTTPHDSSVVWDAYTCKSYKCL  206



>ref|XP_011087590.1| PREDICTED: uncharacterized protein LOC105169030 [Sesamum indicum]
Length=449

 Score = 97.4 bits (241),  Expect = 7e-21, Method: Compositional matrix adjust.
 Identities = 50/123 (41%), Positives = 71/123 (58%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +V+ E ++ +  H+LPLG   R G  ++ +SVG  C K  + L ++MSY+V G CP D  
Sbjct  130  DVSDEAKLAIGPHKLPLGYTPRMGSDEVYSSVGGGCLKHKEDLRKYMSYQVGGECPVDDV  189

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              Q L+LKGCEPLPRRRC  K+ P   +   P P SLWS   +    W   +CKN  C+ 
Sbjct  190  FVQTLMLKGCEPLPRRRCHPKS-PANYVEPTPLPESLWSIPPDSSLIWDPYTCKNYTCLV  248

Query  443  SKK  451
             ++
Sbjct  249  ERR  251



>ref|XP_006494666.1| PREDICTED: probable methyltransferase PMT19-like [Citrus sinensis]
Length=392

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +V +E   F     LP G ++   +  +   VG +C    D L ++MSYKV+  CPDD  
Sbjct  68   SVPSEFLAFTSGQNLPFGFNTNFDLDTIYPPVGRACTLFPDELRRYMSYKVNASCPDDEL  127

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L QKL+LKGCEPLPRRRC A   P   +   P P SLW+   +    W+  +CKN  C+ 
Sbjct  128  LAQKLLLKGCEPLPRRRCRAVG-PSHYIEPYPLPKSLWTTPPDSSLVWTAYTCKNYTCLI  186

Query  443  SKK  451
            ++K
Sbjct  187  NRK  189



>ref|XP_011085904.1| PREDICTED: probable methyltransferase PMT19 [Sesamum indicum]
Length=405

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/119 (41%), Positives = 65/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E   F    +LPLG +      ++   VG  C    D L  FMSYKV+G CPDD  
Sbjct  79   DLPPEFIAFTSPQELPLGFNKNFDSDQIFPPVGSPCTLFTDELRSFMSYKVNGSCPDDEL  138

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            L QKL+L+GCEPLPRRRC     PK  +   P P SLW+   +    W+  +CKN +C+
Sbjct  139  LSQKLLLRGCEPLPRRRC-RPAAPKEYVEPYPLPDSLWTTPPDSSVVWTAYTCKNYSCL  196



>ref|XP_007216965.1| hypothetical protein PRUPE_ppa015454mg [Prunus persica]
 gb|EMJ18164.1| hypothetical protein PRUPE_ppa015454mg [Prunus persica]
Length=465

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 46/109 (42%), Positives = 65/109 (60%), Gaps = 5/109 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            +GK +  G+  +  S+G +C   +  L +FMSYKV   CPDDW + QKLI+ GC+PLPRR
Sbjct  163  IGKKNFLGVEAVTPSIGLACANMVTNLDRFMSYKVHSTCPDDWEIAQKLIVHGCDPLPRR  222

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            RCF K+ P       PF +  SLW+  S     W+   CK+ +C+ SK+
Sbjct  223  RCFTKSPPHYT---KPFSINSSLWTQPSGANILWNNYKCKDYSCLVSKE  268



>ref|XP_010930346.1| PREDICTED: uncharacterized protein LOC105051545 [Elaeis guineensis]
Length=438

 Score = 96.7 bits (239),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 49/148 (33%), Positives = 82/148 (55%), Gaps = 1/148 (1%)
 Frame = +2

Query  5    IESSQRKLTRMEKEVLGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGH  184
            +E+   +L +   +    + +D  +  ++ EL++ +  ++LPLG     G  K+  ++G 
Sbjct  93   LETLLNELGKAHGDKTPSDELDGWQKELSGELKLAVGPYKLPLGSTPNLGTDKLYPTLGS  152

Query  185  SCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFP  364
             C +    L+++MSY+V   CP D    Q+L+LKGCEPLPRRRC  K+ P   +   PFP
Sbjct  153  PCRRFQVDLTEYMSYEVGKECPSDDIFAQRLMLKGCEPLPRRRCHPKS-PSGYVEPTPFP  211

Query  365  LSLWSNNSEKIYTWSGLSCKNLACVNSK  448
             SLW+   +    W   SCKN +C+ ++
Sbjct  212  ASLWTIPPDTSIVWDAYSCKNYSCLVNR  239



>gb|ABR17484.1| unknown [Picea sitchensis]
Length=448

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 67/119 (56%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL+ F    +LPLG++   G   +   VGH+C    + L+++M YK    CP+D  L QK
Sbjct  132  ELKDFTAAKKLPLGRNPSFGSDTIYPPVGHACAVFKEDLNKYMDYKPGHRCPEDEILAQK  191

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+L+GCEPLPRRRC   T P       PFP S+W    +    W+  SCKN +C+  +K
Sbjct  192  LLLRGCEPLPRRRCHPAT-PSNYTEPFPFPESMWRTPPDSSVVWTAYSCKNYSCLIQRK  249



>ref|XP_001754370.1| predicted protein [Physcomitrella patens]
 gb|EDQ80820.1| predicted protein [Physcomitrella patens]
Length=376

 Score = 94.7 bits (234),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/119 (36%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +   G  +  G+     ++GH+C  +  LL ++M YKV G C DDW + Q+
Sbjct  60   EIRTYIKVMENRGGLRNFMGVNSTYGAIGHACVTNKPLLEKYMDYKVGGDCRDDWLIAQQ  119

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            LI++GCEPLPRRRC A+  P++     P  +SLW+  ++  + W    CKN  C+   K
Sbjct  120  LIIRGCEPLPRRRCRARG-PQMLRARRPTNVSLWTIPADDDFRWDSYYCKNFTCLADYK  177



>ref|XP_011092056.1| PREDICTED: uncharacterized protein LOC105172364 [Sesamum indicum]
Length=465

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/123 (37%), Positives = 70/123 (57%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L
Sbjct  152  VVEEIRKYITPKENRVGKINIYGTERVYNTIGHACVVMKKELEEYMDYDVGSYCKDDWNL  211

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            GQKL+++GC+PLPRRRC  +      L L P+P+  SLW     +   WS   C+N  C+
Sbjct  212  GQKLMMRGCDPLPRRRCLTRA---SKLYLRPYPINESLWRMPEGRNVRWSNYQCRNFECL  268

Query  440  NSK  448
            +SK
Sbjct  269  SSK  271



>ref|XP_011009363.1| PREDICTED: uncharacterized protein LOC105114505 [Populus euphratica]
Length=478

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 46/110 (42%), Positives = 62/110 (56%), Gaps = 5/110 (5%)
 Frame = +2

Query  128  PLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPR  307
            P GK +  G+  +  S+G +C      + +FMSYKV G CPDDW L QKLI  GC+PLPR
Sbjct  175  PSGKKNFLGVEAISPSIGLTCAHMATTIKRFMSYKVYGMCPDDWDLAQKLITSGCDPLPR  234

Query  308  RRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            RRC ++  P       PFP+  SLW+   +    WS   CK  +C+ S +
Sbjct  235  RRCLSRASPNYN---KPFPVNSSLWTQPRDDNILWSHYKCKGYSCLVSNE  281



>ref|XP_006421083.1| hypothetical protein CICLE_v10006824mg [Citrus clementina]
 gb|ESR34323.1| hypothetical protein CICLE_v10006824mg [Citrus clementina]
 gb|KDO41055.1| hypothetical protein CISIN_1g047630mg [Citrus sinensis]
Length=392

 Score = 94.7 bits (234),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 49/123 (40%), Positives = 67/123 (54%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +V +E   F     LP G ++      +   VG +C    D L ++MSYKV+  CPDD  
Sbjct  68   SVPSEFLAFTSGQNLPFGFNTNFDSDTIYPPVGRACTLFPDELRRYMSYKVNASCPDDEL  127

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L QKL+LKGCEPLPRRRC A   P   +   P P SLW+   +    W+  +CKN  C+ 
Sbjct  128  LAQKLLLKGCEPLPRRRCRAVG-PSHYIEPYPLPKSLWTTPPDSSLVWTAYTCKNYTCLI  186

Query  443  SKK  451
            ++K
Sbjct  187  NRK  189



>ref|XP_009373793.1| PREDICTED: uncharacterized protein LOC103962750 isoform X1 [Pyrus 
x bretschneideri]
 ref|XP_009373794.1| PREDICTED: uncharacterized protein LOC103962750 isoform X2 [Pyrus 
x bretschneideri]
Length=483

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 72/123 (59%), Gaps = 2/123 (2%)
 Frame = +2

Query  86   VAAELRMFLLQHQ-LPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
             + E+R+++   Q   +GK +  G+  +  S+G +C +    L +FMSYK+ G CPDD  
Sbjct  165  TSGEIRIYISPKQNRQIGKKNFLGVEAITPSIGLACARMATNLDRFMSYKIHGTCPDDSE  224

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            + QKL++ GC+PLPRRRCF K+ P     L P   SLW+  S     W+   CK+ +C+ 
Sbjct  225  IAQKLLVCGCDPLPRRRCFTKSPPHYTKPL-PINFSLWTQPSNANILWNSYKCKDYSCLV  283

Query  443  SKK  451
            SK+
Sbjct  284  SKE  286



>ref|XP_008362217.1| PREDICTED: uncharacterized protein LOC103425897 [Malus domestica]
Length=487

 Score = 95.5 bits (236),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 71/123 (58%), Gaps = 2/123 (2%)
 Frame = +2

Query  86   VAAELRMFLLQHQ-LPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
             + E+R+++   Q   +GK +  G+  +  S+G +C +    L +FMSYK+ G CPDD  
Sbjct  169  TSGEIRIYISPKQNRQIGKKNFLGVEAITPSIGLACARMATNLDRFMSYKIHGXCPDDSE  228

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              QKL++ GC+PLPRRRCF K+ P     L P   SLW+  S     W+   CK+ +C+ 
Sbjct  229  XAQKLLVHGCDPLPRRRCFTKSPPHYTKPL-PINFSLWTQPSNXNILWNSYKCKDYSCLV  287

Query  443  SKK  451
            SK+
Sbjct  288  SKE  290



>ref|XP_006826614.1| hypothetical protein AMTR_s00138p00094100 [Amborella trichopoda]
 gb|ERM93851.1| hypothetical protein AMTR_s00138p00094100 [Amborella trichopoda]
Length=455

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/124 (40%), Positives = 68/124 (55%), Gaps = 1/124 (1%)
 Frame = +2

Query  80   PNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDW  259
            P++  E R       LPLG +   G  K+   VG +C   +D L Q+M Y V G CPDD 
Sbjct  127  PDLPQEFRESASAKPLPLGFNPNFGSDKIYPPVGAACSLFMDELFQYMQYSVGGDCPDDE  186

Query  260  SLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
             L Q+L+LKGCEPLPRRRC ++   +  +     P SLWS   +    W+  SCKN  C+
Sbjct  187  LLAQRLMLKGCEPLPRRRCRSQA-QRNYVEPASLPESLWSIPHDTSVVWTAYSCKNYTCL  245

Query  440  NSKK  451
             ++K
Sbjct  246  VNRK  249



>ref|XP_010907546.1| PREDICTED: uncharacterized protein LOC105034191 [Elaeis guineensis]
Length=440

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 47/131 (36%), Positives = 73/131 (56%), Gaps = 1/131 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            E +D     +  EL++    H+LPLG  +     ++  S+G +C +  + L ++M+Y V 
Sbjct  113  EDLDGWLNELTGELKLAAGPHKLPLGHSANIRSDELYPSLGTACRRFQEDLVRYMTYDVG  172

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
              CP D +L Q+L+LKGCEPLPRRRC  K+ P   +   PFP SLW+   +    W   +
Sbjct  173  SECPSDDNLAQRLLLKGCEPLPRRRCHPKS-PVGYVEPTPFPASLWTIPPDTSVVWDPYT  231

Query  419  CKNLACVNSKK  451
            CKN  C+  ++
Sbjct  232  CKNYTCLVHRR  242



>gb|KDO40688.1| hypothetical protein CISIN_1g043503mg [Citrus sinensis]
Length=430

 Score = 94.7 bits (234),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+++ +  H+LPLG   R G  +++A VG  C K  D L ++M+Y + G CP D    Q+
Sbjct  115  EVKLAVGPHKLPLGYSPRMGSDEVIAPVGAGCSKFHDELLKYMTYDIGGECPVDDVFAQR  174

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEPLPRRRC  K+ P   +     P SLW   +E    W   SCK+  C+  +K
Sbjct  175  LMLKGCEPLPRRRCKPKS-PVNYVEPTAVPDSLWEKPAETSIIWDPYSCKSYQCLIDRK  232



>ref|XP_011043910.1| PREDICTED: uncharacterized protein LOC105139235 [Populus euphratica]
Length=394

 Score = 94.0 bits (232),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 47/119 (39%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++ +E   F     LP G ++          VG +C +  D LS+FMSYKV+G CPDD  
Sbjct  68   DLRSEFIAFTSGQALPYGFNTNFDSDTFYPPVGQACIRFPDELSRFMSYKVNGSCPDDEL  127

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
              QKL+LKGCEPLPRRRC     P   +   P P SLW+        W+  +CK+  C+
Sbjct  128  FAQKLLLKGCEPLPRRRCRPVAQPDY-VEPYPLPTSLWTTPPNSSVVWTAYTCKDYTCL  185



>ref|XP_006470793.1| PREDICTED: uncharacterized protein LOC102607511 [Citrus sinensis]
Length=451

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+++ +  H+LP G   R G  +++A VG  C K  D L ++M+Y   G CP D    Q+
Sbjct  136  EVKLAVGPHKLPFGYSPRMGSDELIAPVGAGCLKFHDELVKYMTYDTGGECPVDDVFAQR  195

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEPLPRRRC  K+ P   +   P P SLW+  +E    W   SCK+  C+  +K
Sbjct  196  LMLKGCEPLPRRRCKPKS-PVNYVEPIPVPDSLWAKPAETSIIWDPYSCKSYQCLIDRK  253



>ref|XP_010062298.1| PREDICTED: probable methyltransferase PMT19 [Eucalyptus grandis]
Length=401

 Score = 94.0 bits (232),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 66/123 (54%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++  E   F     LP G +S      +   VG+ C +  D L +FM+Y V+G CPDD  
Sbjct  76   DLPPEFLAFTSGQSLPFGFNSNFDSDTIFPPVGNGCTRFPDDLRRFMTYAVNGSCPDDEH  135

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L QKL+L+GCE LPRRRC     P   +   P P+ LW+  S+    W+  +CKN  C+ 
Sbjct  136  LAQKLLLRGCEALPRRRCRPAASPDY-VEPFPHPMCLWTTPSDNSVVWTAYTCKNYDCLI  194

Query  443  SKK  451
            ++K
Sbjct  195  NRK  197



>gb|KCW56311.1| hypothetical protein EUGRSUZ_I02052 [Eucalyptus grandis]
Length=371

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 50/128 (39%), Positives = 69/128 (54%), Gaps = 6/128 (5%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLP-----LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPC  247
            N    LR  L  + LP      GK +  G+  +  S+G +C      L +FMSYK+ G C
Sbjct  59   NFWTSLRRELKNYTLPKPNRVAGKKTFLGVEAINPSIGMTCVAMASSLDRFMSYKLFGTC  118

Query  248  PDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKN  427
            PDDW L QKL++ GC+PLPRRRCF++T P     + P   SLW+   +    WS   CK+
Sbjct  119  PDDWILAQKLMISGCDPLPRRRCFSRTPPNYTKPM-PSSKSLWTQPGDVNLLWSHYKCKD  177

Query  428  LACVNSKK  451
              C+ S +
Sbjct  178  YQCLFSNQ  185



>ref|XP_007135150.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
 gb|ESW07144.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
Length=392

 Score = 93.6 bits (231),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/118 (41%), Positives = 68/118 (58%), Gaps = 5/118 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G     AS+GH+C    + L ++M Y V   C DDW L Q+
Sbjct  74   EIRKYVRIKPNRLGKQNFMGANASFASIGHACFAMKEELEEYMDYDVGEICNDDWKLAQR  133

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVN  442
            L++ GC+PLPRRRCF++  PK  L   PFP+  SLW    ++   WS   CKN AC++
Sbjct  134  LMVHGCDPLPRRRCFSRA-PK--LYNQPFPITESLWKLPDDRNVRWSQYRCKNFACLS  188



>ref|XP_006431374.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
 gb|ESR44614.1| hypothetical protein CICLE_v10003316mg [Citrus clementina]
Length=451

 Score = 94.4 bits (233),  Expect = 9e-20, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 68/119 (57%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+++ +  H+LPLG   R G  +++A VG  C K  D L ++M+Y + G CP D    Q+
Sbjct  136  EVKLAVGPHKLPLGYSPRMGSDEVIAPVGAGCSKFHDELLKYMTYDIGGECPVDDVFAQR  195

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEPLPRRRC  K+ P   +     P SLW   +E    W   SCK+  C+  +K
Sbjct  196  LMLKGCEPLPRRRCKPKS-PVNYVEPTAVPDSLWEKPAETSIIWDPYSCKSYQCLIDRK  253



>ref|XP_007032842.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOY03768.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=445

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            GK +  G+  +  SV  +C      + +FMSYK+   CPDDW + QKLI  GC+PLPRRR
Sbjct  144  GKRNFLGVEAISPSVALACANMAPNVDRFMSYKIYETCPDDWDIAQKLIADGCDPLPRRR  203

Query  314  CFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            CF+KT P+    L P   SLWS  S+    WS   CK+  C+ S +
Sbjct  204  CFSKTPPRYSKPL-PINASLWSQPSDTNILWSHYKCKDYTCLVSNE  248



>gb|KHN14379.1| hypothetical protein glysoja_012417 [Glycine soja]
Length=374

 Score = 93.2 bits (230),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL   L  H+LP G   R G  ++    G SC +  + L+Q+M+Y++ G CP D  L Q+
Sbjct  62   ELSFALGPHKLPFGYSPRIGSDEIHLPAGASCMRLHEELTQYMAYEIGGECPMDDVLAQR  121

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEP PRRRC  K+ P   +   P P SLW+   +    W   +CK+  C+  +K
Sbjct  122  LMLKGCEPFPRRRCRPKS-PTNYVEPTPLPESLWTTPPDTSIVWDAYACKSYQCLIDRK  179



>ref|XP_003581273.1| PREDICTED: uncharacterized protein LOC100830081 [Brachypodium 
distachyon]
Length=462

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 67/117 (57%), Gaps = 1/117 (1%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            + EL++ +  H+LP G     G  ++   +G +C    + L+++M+Y  S  CPDD +L 
Sbjct  144  SGELKLAIEPHRLPHGFSVNFGTDELFPGLGFACRNFQEDLTKYMTYNASAACPDDEALA  203

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
             +L LKGCEPLPRRRC  ++ P   +   P P SLWS  ++    W+  +CKN  C+
Sbjct  204  LQLTLKGCEPLPRRRCKPRS-PARYVEPKPLPESLWSIPADTTVNWTPYTCKNYTCL  259



>ref|XP_003594437.1| hypothetical protein MTR_2g028610 [Medicago truncatula]
 gb|AES64688.1| ATRAD3, putative [Medicago truncatula]
Length=459

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 49/134 (37%), Positives = 74/134 (55%), Gaps = 1/134 (1%)
 Frame = +2

Query  50   LGYESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSY  229
            LG +    +  +++ EL + L  H+LP G   + G  ++  ++G +C +  + L Q+M+Y
Sbjct  128  LGKDDSTTAAGSLSDELSIALGPHKLPYGYSPKIGSDEIHMTIGEACLRLNEELKQYMTY  187

Query  230  KVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWS  409
             + G CP D  L Q LILKGCEPLPRRRC  K+ P   +   P P SLW+   +    W 
Sbjct  188  DIGGECPVDEVLSQGLILKGCEPLPRRRCHPKS-PMNYVEPTPLPDSLWTTPPDTSIIWE  246

Query  410  GLSCKNLACVNSKK  451
              SCK+  C+  +K
Sbjct  247  PYSCKSYQCLVDRK  260



>ref|XP_007135151.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
 gb|ESW07145.1| hypothetical protein PHAVU_010G105300g [Phaseolus vulgaris]
Length=484

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 67/117 (57%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G     AS+GH+C    + L ++M Y V   C DDW L Q+
Sbjct  166  EIRKYVRIKPNRLGKQNFMGANASFASIGHACFAMKEELEEYMDYDVGEICNDDWKLAQR  225

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCF++  PK  L   PFP+  SLW    ++   WS   CKN AC+
Sbjct  226  LMVHGCDPLPRRRCFSRA-PK--LYNQPFPITESLWKLPDDRNVRWSQYRCKNFACL  279



>ref|XP_010260532.1| PREDICTED: uncharacterized protein LOC104599618 [Nelumbo nucifera]
Length=491

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/106 (43%), Positives = 62/106 (58%), Gaps = 5/106 (5%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            GK +  G+  +  SVG +C      + +FM+YK    CPDDW + QKL + GCEPLPRRR
Sbjct  190  GKKNFLGVEAVYPSVGLACAGVASNIDRFMTYKAFSMCPDDWVVAQKLTVAGCEPLPRRR  249

Query  314  CFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            CF K+ P  G    PFPL  SLW+  S+    W+   CK+ +C+ S
Sbjct  250  CFTKSPPGYG---KPFPLNSSLWTLPSDSNILWTHYKCKDYSCLVS  292



>ref|XP_007051690.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
 gb|EOX95847.1| S-adenosyl-L-methionine-dependent methyltransferases superfamily 
protein [Theobroma cacao]
Length=680

 Score = 94.7 bits (234),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 66/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y V   C DDW L QK
Sbjct  359  EIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKRELEEYMDYDVGEICNDDWKLAQK  418

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCFA+  P+  L + PFP+  SLW    ++   WSG  CKN  C+
Sbjct  419  LMVHGCDPLPRRRCFARA-PQ--LYIQPFPITESLWKLPDDRNVRWSGYRCKNFTCL  472



>ref|XP_003546232.1| PREDICTED: uncharacterized protein LOC100794863 [Glycine max]
Length=437

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 66/119 (55%), Gaps = 1/119 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            EL   L  H+LP G   R G  ++    G SC +  + L+Q+M+Y++ G CP D  L Q+
Sbjct  125  ELSFALGPHKLPFGYSPRIGSDEIHLPAGASCMRLHEELTQYMAYEIGGECPMDDVLAQR  184

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            L+LKGCEP PRRRC  K+ P   +   P P SLW+   +    W   +CK+  C+  +K
Sbjct  185  LMLKGCEPFPRRRCRPKS-PTNYVEPTPLPESLWTTPPDTSIVWDAYACKSYQCLIDRK  242



>gb|KJB24637.1| hypothetical protein B456_004G154700 [Gossypium raimondii]
Length=466

 Score = 93.6 bits (231),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 65/117 (56%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C    + L ++M Y V   C DDW L QK
Sbjct  145  EIRKYVRVKPNRLGKQNFMGANGTFTSIGHACFAMKEELEEYMDYDVGEICNDDWKLAQK  204

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRC A+  P+  L   PFP+  S+W    ++   WSG  CKN  C+
Sbjct  205  LMVHGCDPLPRRRCLARA-PR--LYTQPFPINESIWKLPDDRNVRWSGYWCKNFTCL  258



>dbj|BAJ84801.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=379

 Score = 92.4 bits (228),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 47/94 (50%), Positives = 62/94 (66%), Gaps = 7/94 (7%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKS---LDLLSQFMSYKVSGPCPDDWSL  265
            EL +FL  H LPLG+D+RTG+T M ASV  SC +S   L LLS FMSY     CP + +L
Sbjct  97   ELLLFLTPHALPLGRDARTGLTHMPASVAASCLRSPSALALLSAFMSYAPHSACPRNATL  156

Query  266  GQKLILKGCEPLPRRRCFAK----TIPKVGLNLN  355
             ++L+ KGCEPLPRRRC ++     +P  G+ L+
Sbjct  157  PRRLVSKGCEPLPRRRCLSRGPRAPLPASGMGLD  190



>ref|XP_004964486.1| PREDICTED: uncharacterized protein LOC101778925 [Setaria italica]
Length=385

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/80 (55%), Positives = 57/80 (71%), Gaps = 3/80 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKS---LDLLSQFMSYKVSGPCPDDWSL  265
            EL +FL  H LPLG+D+RTG+T M ASV H+C +S   L LLS F SY+  G CP + +L
Sbjct  99   ELLLFLSPHALPLGRDARTGLTHMPASVAHACFRSPSTLALLSAFASYEPRGVCPRNATL  158

Query  266  GQKLILKGCEPLPRRRCFAK  325
              +L+ KGCEPLPRRRC ++
Sbjct  159  PHRLLSKGCEPLPRRRCLSR  178



>gb|KJB10578.1| hypothetical protein B456_001G208400 [Gossypium raimondii]
Length=472

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            +GK +  G+  +  SVG  C      + +FM YK+   CPDDW + QKL++ GC+PLPRR
Sbjct  170  IGKKNFLGVEAISPSVGLLCANMASNVDRFMGYKIYRMCPDDWDIAQKLMISGCDPLPRR  229

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF+KT P+      P P+  SLWS  ++    WS   CK+ +C+ S
Sbjct  230  RCFSKTPPRYS---EPLPINSSLWSQPADTNIMWSHYKCKDYSCLVS  273



>ref|XP_006655770.1| PREDICTED: uncharacterized protein LOC102722126 [Oryza brachyantha]
Length=387

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 43/80 (54%), Positives = 56/80 (70%), Gaps = 3/80 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKS---LDLLSQFMSYKVSGPCPDDWSL  265
            EL +FL  H LPLG+D+RTG+T M ASV HSC +S   L LL+ FMSY+    CP + +L
Sbjct  104  ELLLFLSPHALPLGRDARTGLTHMPASVAHSCFRSPSTLALLAAFMSYEPHAACPRNATL  163

Query  266  GQKLILKGCEPLPRRRCFAK  325
              +L+ K CEPLPRRRC ++
Sbjct  164  PHRLVSKACEPLPRRRCLSR  183



>ref|XP_002872900.1| hypothetical protein ARALYDRAFT_912109 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH49159.1| hypothetical protein ARALYDRAFT_912109 [Arabidopsis lyrata subsp. 
lyrata]
Length=479

 Score = 92.8 bits (229),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 45/111 (41%), Positives = 62/111 (56%), Gaps = 5/111 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C    + L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  169  LGKQNFMGANGTFTSIGHACFAMKEDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  228

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKKLS  457
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S  ++
Sbjct  229  RCFSRG-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLASNTIA  276



>ref|XP_010930345.1| PREDICTED: uncharacterized protein LOC105051544 [Elaeis guineensis]
Length=438

 Score = 92.4 bits (228),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 46/130 (35%), Positives = 73/130 (56%), Gaps = 1/130 (1%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            +++D  +  ++ EL++ +  H+LP G     G  ++  ++G  C +    L+ +MSY+V 
Sbjct  111  QNLDGWQNELSRELKLAVGPHKLPRGFTPLLGTRELYPTLGSPCRRFQADLTDYMSYEVG  170

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLS  418
              CP D    Q+L+LKGCEPLPRRRC  K+ P   +   PFP SLW+   +    W   S
Sbjct  171  KECPSDDIFAQRLMLKGCEPLPRRRCHPKS-PAGYVEPTPFPTSLWTIPPDTSIVWDAYS  229

Query  419  CKNLACVNSK  448
            CKN  C+ ++
Sbjct  230  CKNYTCLVNR  239



>ref|XP_008233031.1| PREDICTED: uncharacterized protein LOC103332112 [Prunus mume]
Length=477

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 66/121 (55%), Gaps = 5/121 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y +   C DDW L QK
Sbjct  156  EIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDIGEICNDDWRLAQK  215

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L++ GC+PLPRRRCF++  PK  L   PFP+  S+W     +   WS   CKN  C+ SK
Sbjct  216  LMVHGCDPLPRRRCFSRA-PK--LYSKPFPIHESMWKLPDNRNVRWSNYRCKNFTCLASK  272

Query  449  K  451
            K
Sbjct  273  K  273



>gb|EPS66088.1| hypothetical protein M569_08692, partial [Genlisea aurea]
Length=318

 Score = 90.9 bits (224),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 51/125 (41%), Positives = 72/125 (58%), Gaps = 3/125 (2%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSC--EKSLDLLSQFMSYKVSGPCPDD  256
            ++  E ++ L  H+LPLG     G  K++ S G  C    + D L ++MSY+V G CP D
Sbjct  1    DLIDEAKVSLGFHELPLGPRDIMGGDKIMFSYGAGCLNPAAKDELQKYMSYEVGGVCPVD  60

Query  257  WSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLAC  436
                QKL+L GCEPLPRRRC  KT PK   + +P P SLW+  S+    W   +CKN +C
Sbjct  61   EVKSQKLMLIGCEPLPRRRCHPKT-PKNYSDPSPLPRSLWATPSDASIVWDPYTCKNYSC  119

Query  437  VNSKK  451
            +  ++
Sbjct  120  LVERE  124



>ref|XP_009349328.1| PREDICTED: uncharacterized protein LOC103940868 [Pyrus x bretschneideri]
Length=479

 Score = 92.8 bits (229),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++      LGK +  G      S+GH+C      L ++M Y +   C DDW L
Sbjct  153  LTEEIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDIGDICNDDWRL  212

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRCF++  PK  L   PFP+  S+W    ++   WS   CKN  C+
Sbjct  213  AQKLMIHGCDPLPRRRCFSRA-PK--LYSTPFPIRESMWKLPDDRNVRWSNYICKNFTCL  269

Query  440  NSKK  451
             S K
Sbjct  270  ASNK  273



>ref|XP_010544420.1| PREDICTED: uncharacterized protein LOC104817043 isoform X1 [Tarenaya 
hassleriana]
 ref|XP_010544421.1| PREDICTED: uncharacterized protein LOC104817043 isoform X2 [Tarenaya 
hassleriana]
Length=478

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 5/126 (4%)
 Frame = +2

Query  68   DLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPC  247
            D S+  +  E+R ++      LGK +  G      S+GH+C    + L ++M Y V   C
Sbjct  147  DPSEYFLREEIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKEDLEEYMDYDVGEIC  206

Query  248  PDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSC  421
             DDW L QKL++ GC+PLPRRRCFA+  P+  L   PFP+  SLW     +   WS   C
Sbjct  207  NDDWKLAQKLMVHGCDPLPRRRCFARA-PQ--LYYKPFPINDSLWKLPDNRNVRWSQYRC  263

Query  422  KNLACV  439
            K  +C+
Sbjct  264  KTFSCL  269



>ref|XP_004486558.1| PREDICTED: uncharacterized protein LOC101503433 [Cicer arietinum]
Length=462

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 48/123 (39%), Positives = 67/123 (54%), Gaps = 2/123 (2%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEK-SLDLLSQFMSYKVSGPCPDDWS  262
            ++ EL + L  H+LP G   + G  ++   +G +C +   + L QFM+Y + G CP D  
Sbjct  143  ISDELSIALGPHKLPFGYSPKIGSGQIHMPIGEACLRLHHEELKQFMTYDIGGECPVDDV  202

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
            L Q LILKGCEPLPRRRC  K+ P   +   PFP SLW    +    W    CK+  C+ 
Sbjct  203  LSQGLILKGCEPLPRRRCHPKS-PMNYVEPAPFPDSLWKIPPDTSINWDSYICKSYQCLV  261

Query  443  SKK  451
             +K
Sbjct  262  DRK  264



>ref|XP_002305389.2| hypothetical protein POPTR_0004s11590g [Populus trichocarpa]
 gb|EEE85900.2| hypothetical protein POPTR_0004s11590g [Populus trichocarpa]
Length=450

 Score = 92.0 bits (227),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 43/102 (42%), Positives = 59/102 (58%), Gaps = 5/102 (5%)
 Frame = +2

Query  152  GITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTI  331
            G+  +  S+G +C      + +FMSYK+ G CPDDW L QKLI  GC+PLPRRRC ++  
Sbjct  155  GVKAISPSIGLTCAHMATTIKRFMSYKMYGMCPDDWDLAQKLITSGCDPLPRRRCLSRAS  214

Query  332  PKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            P       PFP+  SLW+  S+    WS   CK  +C+ S +
Sbjct  215  PNYN---KPFPVNSSLWTQPSDANILWSHYKCKGYSCLVSNE  253



>ref|XP_010087091.1| hypothetical protein L484_010463 [Morus notabilis]
 gb|EXB26146.1| hypothetical protein L484_010463 [Morus notabilis]
Length=164

 Score = 88.6 bits (218),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 46/111 (41%), Positives = 60/111 (54%), Gaps = 1/111 (1%)
 Frame = +2

Query  119  HQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEP  298
            H+LPLG     G   ++ S G  C +  + L+Q M+Y + G CP D    QKL LKGCEP
Sbjct  4    HKLPLGIFPPIGSDSLLPSFGAGCLRLQEELAQHMTYDIGGECPVDDVFAQKLTLKGCEP  63

Query  299  LPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            LPRRRC  K+ P       PFP +LWS   +    W   +CKN  C+  +K
Sbjct  64   LPRRRCHPKS-PSGYKEPTPFPDNLWSTPPDSSIIWEPYTCKNYKCLIDRK  113



>ref|XP_001777602.1| predicted protein [Physcomitrella patens]
 gb|EDQ57645.1| predicted protein [Physcomitrella patens]
Length=348

 Score = 90.5 bits (223),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 1/115 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            ELR +L   +   G  +  G++    ++GH+C  S  LL ++M Y +   C DDW + Q+
Sbjct  34   ELRKYLSVRENRRGAKNFMGVSATYGTIGHACVSSKGLLEKYMDYDIGEVCRDDWVIAQQ  93

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            LIL+GCEPLPRRRC A+  PKV     P   SLW+  + +   W    CKN +C+
Sbjct  94   LILRGCEPLPRRRCRAQG-PKVYKPPPPANESLWAIPANENIRWDNYFCKNFSCL  147



>gb|KHN18827.1| hypothetical protein glysoja_045347 [Glycine soja]
Length=473

 Score = 92.0 bits (227),  Expect = 9e-19, Method: Compositional matrix adjust.
 Identities = 48/119 (40%), Positives = 66/119 (55%), Gaps = 5/119 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C    + L ++M Y V   C DDW L QK
Sbjct  155  EIRKYVRIKPNRLGKQNFMGTNASFTSIGHACFAMKEELEEYMDYDVGEICNDDWKLAQK  214

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            L++ GC+PLPRRRCF++  PK  L   PFP+  SLW    ++   WS   CKN  C+ S
Sbjct  215  LMVHGCDPLPRRRCFSRA-PK--LYNQPFPINESLWKLPDDRNVRWSQYRCKNFLCLAS  270



>ref|XP_010544422.1| PREDICTED: uncharacterized protein LOC104817043 isoform X3 [Tarenaya 
hassleriana]
 ref|XP_010544423.1| PREDICTED: uncharacterized protein LOC104817043 isoform X4 [Tarenaya 
hassleriana]
Length=464

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 48/126 (38%), Positives = 68/126 (54%), Gaps = 5/126 (4%)
 Frame = +2

Query  68   DLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPC  247
            D S+  +  E+R ++      LGK +  G      S+GH+C    + L ++M Y V   C
Sbjct  133  DPSEYFLREEIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKEDLEEYMDYDVGEIC  192

Query  248  PDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSC  421
             DDW L QKL++ GC+PLPRRRCFA+  P+  L   PFP+  SLW     +   WS   C
Sbjct  193  NDDWKLAQKLMVHGCDPLPRRRCFARA-PQ--LYYKPFPINDSLWKLPDNRNVRWSQYRC  249

Query  422  KNLACV  439
            K  +C+
Sbjct  250  KTFSCL  255



>ref|XP_002277860.1| PREDICTED: uncharacterized protein LOC100259964 [Vitis vinifera]
Length=471

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 43/108 (40%), Positives = 62/108 (57%), Gaps = 5/108 (5%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            GK +   +  +  S+G +C      + QFM+YK+ G CPDDW + QKLI  GC+PLPRRR
Sbjct  170  GKKNFLNVEAVNPSIGSACAHMAWNIDQFMTYKIYGTCPDDWDMAQKLIASGCDPLPRRR  229

Query  314  CFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            CFA++ P       P P+  SLW+  S+    W    CK+ +C+ S +
Sbjct  230  CFARSPPHYS---KPLPINSSLWTQPSDVNILWKHYKCKDYSCLVSNE  274



>emb|CBI39481.3| unnamed protein product [Vitis vinifera]
Length=437

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  LGK +  G  K+  ++GH+C      L ++M Y +   C DDW+ 
Sbjct  154  VVEEIRKYITPKENRLGKINFYGTGKVYNTIGHACVLMKKELEEYMDYDIGSYCKDDWNQ  213

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      L L P+P+  SLW     +   WS   C+N  C+
Sbjct  214  AQKLMINGCDPLPRRRCLTRA---SKLYLGPYPINESLWRIPDGRNVRWSNYQCRNFECL  270

Query  440  NSK  448
            +SK
Sbjct  271  SSK  273



>ref|XP_009605194.1| PREDICTED: uncharacterized protein LOC104099794 [Nicotiana tomentosiformis]
Length=452

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 47/123 (38%), Positives = 69/123 (56%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +++ E ++ L  H+LPLG   R+G  ++  SVG  C    + L+Q+M+Y V   CP D  
Sbjct  133  DLSNEAKLGLGPHKLPLGLSPRSGTDEVYPSVGGGCLMYKEDLAQYMTYNVGNECPVDDV  192

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              Q+L+LKGCEPLP RRC  K  P   +   P P SLWS   +    W   +CKN +C+ 
Sbjct  193  FAQRLMLKGCEPLPIRRCHPKA-PCGYVEPTPLPKSLWSTPPDTSIIWDPYTCKNYSCLI  251

Query  443  SKK  451
             ++
Sbjct  252  DRR  254



>ref|NP_001057631.1| Os06g0474300 [Oryza sativa Japonica Group]
 dbj|BAD35350.1| unknown protein [Oryza sativa Japonica Group]
 dbj|BAF19545.1| Os06g0474300 [Oryza sativa Japonica Group]
 dbj|BAG96061.1| unnamed protein product [Oryza sativa Japonica Group]
Length=480

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E R ++   +   G+    G  +   S+GH+C      L ++MSY V   CPDDW LG
Sbjct  167  AEETRKYVTAKRNREGRPGAYGANRTYGSIGHACVVMRRELDEYMSYDVGALCPDDWDLG  226

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVN  442
            Q+L+L GC+PLPRRRC A+      L   P P+  SLW+   +    WS   C+   C++
Sbjct  227  QRLMLGGCDPLPRRRCLARA---SKLFRRPLPINESLWALPDDGNVRWSRYHCRGYRCLS  283

Query  443  SK  448
            ++
Sbjct  284  AR  285



>gb|EAZ00931.1| hypothetical protein OsI_22961 [Oryza sativa Indica Group]
Length=480

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E R ++   +   G+    G  +   S+GH+C      L ++MSY V   CPDDW LG
Sbjct  167  AEETRKYVTAKRNREGRPGAYGANRTYGSIGHACVVMRRELDEYMSYDVGALCPDDWDLG  226

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVN  442
            Q+L+L GC+PLPRRRC A+      L   P P+  SLW+   +    WS   C+   C++
Sbjct  227  QRLMLGGCDPLPRRRCLARA---SKLFRRPLPINESLWALPDDGNVRWSRYHCRGYRCLS  283

Query  443  SK  448
            ++
Sbjct  284  AR  285



>ref|XP_002444878.1| hypothetical protein SORBIDRAFT_07g000800 [Sorghum bicolor]
 gb|EES14373.1| hypothetical protein SORBIDRAFT_07g000800 [Sorghum bicolor]
Length=495

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/122 (37%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E R +L       G  S  G  +  +++GH+C      L ++MSY V   CPDDW LG
Sbjct  171  AEETRKYLTAKGNRDGLPSVYGTNRTYSTIGHACVLMRRELDEYMSYDVGAHCPDDWDLG  230

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVN  442
            Q+L+L GC+PLPRRRC    +P   L   P P+  SLW+   +    WS   C+   C++
Sbjct  231  QRLMLGGCDPLPRRRCL---VPASKLFHRPLPINESLWTLPDDGNVRWSRYHCRGYRCLS  287

Query  443  SK  448
            ++
Sbjct  288  AR  289



>ref|XP_002284169.1| PREDICTED: uncharacterized protein LOC100257940 [Vitis vinifera]
Length=467

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  LGK +  G  K+  ++GH+C      L ++M Y +   C DDW+ 
Sbjct  154  VVEEIRKYITPKENRLGKINFYGTGKVYNTIGHACVLMKKELEEYMDYDIGSYCKDDWNQ  213

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      L L P+P+  SLW     +   WS   C+N  C+
Sbjct  214  AQKLMINGCDPLPRRRCLTRA---SKLYLGPYPINESLWRIPDGRNVRWSNYQCRNFECL  270

Query  440  NSK  448
            +SK
Sbjct  271  SSK  273



>emb|CAN77378.1| hypothetical protein VITISV_043863 [Vitis vinifera]
Length=467

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 44/123 (36%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  LGK +  G  K+  ++GH+C      L ++M Y +   C DDW+ 
Sbjct  154  VVEEIRKYITPKENRLGKINFYGTGKVYNTIGHACVLMKKELEEYMDYDIGSYCKDDWNQ  213

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      L L P+P+  SLW     +   WS   C+N  C+
Sbjct  214  AQKLMINGCDPLPRRRCLTRA---SKLYLGPYPINESLWRIPDGRNVRWSNYQCRNFECL  270

Query  440  NSK  448
            +SK
Sbjct  271  SSK  273



>ref|XP_010422784.1| PREDICTED: uncharacterized protein LOC104708006 [Camelina sativa]
 ref|XP_010422785.1| PREDICTED: uncharacterized protein LOC104708006 [Camelina sativa]
Length=470

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  160  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  219

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  220  RCFSRA-PQ--LYHKPFPINESLWKLPDNRNVRWGHYKCKNFACLAS  263



>ref|XP_010427634.1| PREDICTED: uncharacterized protein LOC104712426 [Camelina sativa]
 ref|XP_010427642.1| PREDICTED: uncharacterized protein LOC104712426 [Camelina sativa]
Length=470

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  160  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  219

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  220  RCFSRA-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  263



>ref|XP_008375945.1| PREDICTED: uncharacterized protein LOC103439174 [Malus domestica]
Length=672

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++      LGK +  G      S+GH+C      L ++M Y +   C DDW L
Sbjct  346  LTEEIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDIGDICNDDWRL  405

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRCF++  PK  L   PFP+  S+W    ++   WS   CKN  C+
Sbjct  406  AQKLMIHGCDPLPRRRCFSRA-PK--LYSTPFPIRESMWKLPDDRNVRWSNYICKNFTCL  462

Query  440  NSKK  451
             S K
Sbjct  463  ASNK  466



>ref|XP_010092875.1| hypothetical protein L484_022470 [Morus notabilis]
 gb|EXB52693.1| hypothetical protein L484_022470 [Morus notabilis]
Length=465

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 48/117 (41%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH C      L ++M Y V   C DDW L QK
Sbjct  144  EIRKYVKMKPNRLGKQNFMGANGTFTSIGHGCFAMKKELEEYMEYDVGEICNDDWKLAQK  203

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCF+   PK  L   PFP+  SLW    ++   WS   CKN AC+
Sbjct  204  LMVHGCDPLPRRRCFS-IAPK--LYSRPFPINESLWKLPDDRNVRWSHYRCKNFACL  257



>ref|XP_009338797.1| PREDICTED: uncharacterized protein LOC103931112, partial [Pyrus 
x bretschneideri]
Length=697

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 47/124 (38%), Positives = 67/124 (54%), Gaps = 5/124 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++      LGK +  G      S+GH+C      L ++M Y +   C DDW L
Sbjct  371  LTEEIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDIGDICNDDWRL  430

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRCF++  PK  L   PFP+  S+W    ++   WS   CKN  C+
Sbjct  431  AQKLMIHGCDPLPRRRCFSRA-PK--LYSTPFPIRESMWKLPDDRNVRWSNYICKNFTCL  487

Query  440  NSKK  451
             S K
Sbjct  488  ASNK  491



>ref|XP_011093041.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC105173085 
[Sesamum indicum]
Length=685

 Score = 91.7 bits (226),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 46/118 (39%), Positives = 62/118 (53%), Gaps = 1/118 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++      LGK +  G      S+GH+C      L ++M Y V   C DDW L
Sbjct  361  LTEEIRKYIRIKPNRLGKQNFMGANGTFTSIGHACFSMRKELEEYMEYDVGDICNDDWKL  420

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRCFAK  P+      P   SLW+   +K   WS   CKN  C+
Sbjct  421  AQKLMVHGCDPLPRRRCFAKA-PQFYTKPLPINESLWALPDDKNVRWSQYRCKNFTCL  477



>ref|XP_002533472.1| ATRAD3, putative [Ricinus communis]
 gb|EEF28904.1| ATRAD3, putative [Ricinus communis]
Length=400

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 1/119 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            ++ +E   F     LP G ++      +   VG SC    + L+++M+YKV+G CPDD  
Sbjct  74   DLPSEFLAFTSGQLLPFGFNTNFDSDTIYPPVGQSCTLFPNELNRYMNYKVNGSCPDDEL  133

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            L QKL+LKGCEPLPRRRC     P       P P SLW+   +    W+  +CK   C+
Sbjct  134  LAQKLLLKGCEPLPRRRCRPAAQPNYD-EPYPLPTSLWTTPPDSSVVWTAYTCKGYTCL  191



>ref|XP_007220933.1| hypothetical protein PRUPE_ppa023757mg [Prunus persica]
 gb|EMJ22132.1| hypothetical protein PRUPE_ppa023757mg [Prunus persica]
Length=477

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 65/121 (54%), Gaps = 5/121 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y +   C DDW L QK
Sbjct  156  EIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDIGEICNDDWRLAQK  215

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L++ GC+PLPRRRCF++  PK  L   PFP+  S+W     +   WS   CKN  C+ S 
Sbjct  216  LMVHGCDPLPRRRCFSRA-PK--LYSKPFPIHESMWKLPDNRNVRWSNYRCKNFTCLASN  272

Query  449  K  451
            K
Sbjct  273  K  273



>ref|XP_011023653.1| PREDICTED: uncharacterized protein LOC105125062 [Populus euphratica]
Length=468

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +G  +  G  ++  ++GH+C      L ++M Y +   C DDWSL
Sbjct  155  VVEEIRKYITPKENRVGNTNIYGTLRIYNTIGHACVLMKKELEEYMDYDIGSYCKDDWSL  214

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL++ GC+PLPRRRC  +   KV     P   SLW    ++   WS   C+N  C++S
Sbjct  215  SQKLMVSGCDPLPRRRCLTRA-SKVYQKPYPINESLWRLPDDRNVRWSNYQCRNFQCLSS  273

Query  446  K  448
            K
Sbjct  274  K  274



>gb|ABK28240.1| unknown [Arabidopsis thaliana]
Length=479

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  168  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  227

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  228  RCFSRG-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  271



>gb|ABE65508.1| hypothetical protein At4g01240 [Arabidopsis thaliana]
Length=478

 Score = 90.9 bits (224),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  168  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  227

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  228  RCFSRG-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  271



>emb|CAN66988.1| hypothetical protein VITISV_005164 [Vitis vinifera]
Length=713

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/106 (41%), Positives = 61/106 (58%), Gaps = 1/106 (1%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            GK +   +  +  S+G +C      + QFM+YK+ G CPDDW + QKLI  GC+PLPRRR
Sbjct  412  GKKNFLNVEAVNPSIGSACAHMAWNIDQFMTYKIYGTCPDDWDMAQKLIASGCDPLPRRR  471

Query  314  CFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKK  451
            CFA++ P     L P   SLW+  S+    W    CK+ +C+ S +
Sbjct  472  CFARSPPHYSKPL-PINSSLWTQPSDVNILWKHYKCKDYSCLVSNE  516



>ref|XP_010464063.1| PREDICTED: uncharacterized protein LOC104744673 [Camelina sativa]
 ref|XP_010464064.1| PREDICTED: uncharacterized protein LOC104744673 [Camelina sativa]
Length=463

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      +GK +  G  ++  ++GH+C      L ++M Y +   C DDW+L QK
Sbjct  153  EIRKYITPKDNRVGKINMFGTERVFNTIGHACVLMKRELEKYMDYDIGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            LIL GC+PLPRRRC  +          P+P+  SLW    +K   W    C+N AC++SK
Sbjct  213  LILSGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDKNVRWGNYQCRNFACLSSK  269



>ref|XP_002318999.2| hypothetical protein POPTR_0013s02010g [Populus trichocarpa]
 gb|EEE94922.2| hypothetical protein POPTR_0013s02010g [Populus trichocarpa]
Length=468

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/121 (35%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +G  +  G  ++  ++GH+C      L ++M Y +   C DDWSL
Sbjct  155  VVEEIRKYITPKENRVGNTNIYGTERIYNTIGHACVLMKKELEEYMDYDIGSYCKDDWSL  214

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL++ GC+PLPRRRC  +   KV     P   SLW    ++   WS   C+N  C++S
Sbjct  215  SQKLMVNGCDPLPRRRCLTRA-SKVYQKPYPINESLWRLPDDRNVRWSTYQCRNFQCLSS  273

Query  446  K  448
            K
Sbjct  274  K  274



>dbj|BAK05115.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=483

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/123 (37%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +A E R ++       G+ +  G  +   S+GH+C      L ++MSY V   CPDDW L
Sbjct  166  MAEETRKYVTTKGNREGRPNVYGTNRTYGSIGHACVLMRRELDEYMSYDVGSYCPDDWDL  225

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            GQ+L+L GC+PLPRRRC A+      L   P P+  SLW    +    WS   C+   C+
Sbjct  226  GQRLMLGGCDPLPRRRCLARA---SKLFQRPLPINESLWKLPDDGNVRWSRYHCRGYRCL  282

Query  440  NSK  448
            ++K
Sbjct  283  SAK  285



>ref|XP_006290179.1| hypothetical protein CARUB_v10003858mg [Capsella rubella]
 gb|EOA23077.1| hypothetical protein CARUB_v10003858mg [Capsella rubella]
Length=883

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 60/107 (56%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C    + L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  573  LGKQNFMGANGTFTSIGHACFAMKNDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  632

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  633  RCFSRA-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  676



>ref|XP_004490294.1| PREDICTED: uncharacterized protein LOC101497349 [Cicer arietinum]
Length=460

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 44/121 (36%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +GK +  G  K+  ++GHSC      + ++M Y +   C DDW+L
Sbjct  147  VTEEIRKYITPKENRVGKINLYGSDKVYNTIGHSCVLHKKEVEKYMDYDIGSYCDDDWNL  206

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL+L GC+PLPRRRC  +   KV     P   SLW    E+   W    C+N  C++S
Sbjct  207  AQKLMLNGCDPLPRRRCLTRA-SKVYNKPYPINESLWRLPDERNVRWGNYQCRNFDCLSS  265

Query  446  K  448
            K
Sbjct  266  K  266



>ref|XP_004986277.1| PREDICTED: uncharacterized protein LOC101771363 [Setaria italica]
Length=429

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 47/121 (39%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E   F   H LP G++   G  ++    GH C    DLL+ FMSY+V+G CPDD    Q+
Sbjct  84   EFHAFAGPHALPYGRNPNWGTAELRPPAGHPCLAFPDLLAAFMSYRVNGSCPDDELPAQR  143

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            L+L+GCEPLPRRRC             P+P +LWS   ++   WS   CK+  C+  +  
Sbjct  144  LLLRGCEPLPRRRCRPAAP-PDPAPPLPYPDALWSTPPDRSVHWSAYKCKSFRCLIDRAR  202

Query  455  S  457
            S
Sbjct  203  S  203



>ref|NP_187190.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF64543.1| hypothetical protein [Arabidopsis thaliana]
 gb|AAT69207.1| hypothetical protein At3g05390 [Arabidopsis thaliana]
 gb|AEE74232.1| uncharacterized protein AT3G05390 [Arabidopsis thaliana]
Length=463

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRQYITPKENRVGKINMFGTERVYNTIGHACALMKMELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L+L GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LMLNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>ref|XP_009128498.1| PREDICTED: uncharacterized protein LOC103853324 [Brassica rapa]
Length=474

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 58/107 (54%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  164  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  223

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN  C+ S
Sbjct  224  RCFSRA-PQ--LYYKPFPINESLWKLPDNRNVRWGQYKCKNFTCLAS  267



>gb|AAT68360.1| hypothetical protein At3g05390 [Arabidopsis thaliana]
Length=463

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRQYITPKENRVGKINMFGTERVYNTIGHACALMKMELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L+L GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LMLNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>ref|XP_002884510.1| hypothetical protein ARALYDRAFT_477828 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH60769.1| hypothetical protein ARALYDRAFT_477828 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRQYITPKENRVGKINMFGTERVYNTIGHACALMKIELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L+L GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LMLNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>ref|XP_006396286.1| hypothetical protein EUTSA_v10028611mg [Eutrema salsugineum]
 gb|ESQ37739.1| hypothetical protein EUTSA_v10028611mg [Eutrema salsugineum]
Length=490

 Score = 90.1 bits (222),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  180  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  239

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  240  RCFSRA-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  283



>ref|XP_002511929.1| ATRAD3, putative [Ricinus communis]
 gb|EEF50598.1| ATRAD3, putative [Ricinus communis]
Length=615

 Score = 90.9 bits (224),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y V   C DDW L Q+
Sbjct  293  EIRKYIRIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDVGEICNDDWKLAQR  352

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCF+K  P+  L   PFP+  S+W     +   WS   CKN  C+
Sbjct  353  LMVHGCDPLPRRRCFSKA-PQ--LYSKPFPINESMWKLPDNRNVRWSHYKCKNFTCL  406



>ref|NP_001169099.1| uncharacterized protein LOC100382943 precursor [Zea mays]
 gb|ACN31656.1| unknown [Zea mays]
Length=475

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            G  S  G  +   SVGH+C      L ++MSY V   CPDDW LGQ+L+L GC+PLPRRR
Sbjct  177  GLPSVYGTNRTYGSVGHACVLMRRELDEYMSYDVGARCPDDWDLGQRLMLGGCDPLPRRR  236

Query  314  CFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            C A   P   L   P P+  SLW+   +    WS   C+   C++++
Sbjct  237  CLA---PASKLFRRPLPVNESLWTLPDDGNVRWSHYHCRGYRCLSAR  280



>ref|XP_003594435.1| hypothetical protein MTR_2g028590 [Medicago truncatula]
 gb|AES64686.1| ATRAD3, putative [Medicago truncatula]
Length=464

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/126 (37%), Positives = 68/126 (54%), Gaps = 1/126 (1%)
 Frame = +2

Query  74   SKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPD  253
            +   ++ EL + L  H+LP     + G  ++   VG +C +  + L Q+M+Y + G CP 
Sbjct  141  AAATISDELGIALGPHKLPFEYSPKIGSGEIYMPVGEACLRLHEELKQYMTYDIGGECPV  200

Query  254  DWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLA  433
            D  L Q LILKGCEPLPRRRC +K++    +   P P SLW    +    W   SCK+  
Sbjct  201  DDVLSQGLILKGCEPLPRRRCHSKSLTNY-VEPTPLPDSLWMTPPDTSVIWEPYSCKSYQ  259

Query  434  CVNSKK  451
            C+  +K
Sbjct  260  CLVDRK  265



>ref|XP_009147246.1| PREDICTED: uncharacterized protein LOC103870827 [Brassica rapa]
Length=464

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDWSL QK
Sbjct  154  EIRKYITPKENHVGKMNMFGTERVYNTIGHACVLMKTELEKYMDYDVGAYCDDDWSLAQK  213

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L++ GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  214  LMVNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  270



>emb|CDY27772.1| BnaA05g31810D [Brassica napus]
Length=464

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 42/120 (35%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDWSL QK
Sbjct  154  EIRKYITPKENHVGKMNMFGTERVYNTIGHACVLMKTELEKYMDYDVGAYCDDDWSLAQK  213

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L++ GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  214  LMVNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  270



>ref|XP_011023264.1| PREDICTED: uncharacterized protein LOC105124820 isoform X3 [Populus 
euphratica]
Length=378

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      + ++M Y V   C DDW L QK
Sbjct  57   EIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKKDIEEYMDYDVGEICKDDWKLAQK  116

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            L++ GC+PLPRRRCFA+  P+  L   PFP+  S+W     +   WS   CKN  C+ S
Sbjct  117  LMVHGCDPLPRRRCFARA-PQ--LYSKPFPINESMWKLPDNRNVRWSQYRCKNFICLAS  172



>gb|KDP28553.1| hypothetical protein JCGZ_14324 [Jatropha curcas]
Length=478

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y V   C DDW L QK
Sbjct  156  EIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKKELEEYMDYDVGEICNDDWKLAQK  215

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCF++  P+  L   PFP+  S+W     +   WS   CKN  C+
Sbjct  216  LMIHGCDPLPRRRCFSRA-PQ--LYSKPFPINESMWKLPDNRNVRWSHYRCKNFTCL  269



>gb|AFW74244.1| hypothetical protein ZEAMMB73_912598 [Zea mays]
Length=489

 Score = 90.1 bits (222),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 44/107 (41%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            G  S  G  +   SVGH+C      L ++MSY V   CPDDW LGQ+L+L GC+PLPRRR
Sbjct  191  GLPSVYGTNRTYGSVGHACVLMRRELDEYMSYDVGARCPDDWDLGQRLMLGGCDPLPRRR  250

Query  314  CFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            C A   P   L   P P+  SLW+   +    WS   C+   C++++
Sbjct  251  CLA---PASKLFRRPLPVNESLWTLPDDGNVRWSHYHCRGYRCLSAR  294



>ref|XP_011023263.1| PREDICTED: uncharacterized protein LOC105124820 isoform X2 [Populus 
euphratica]
Length=384

 Score = 89.0 bits (219),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 48/131 (37%), Positives = 70/131 (53%), Gaps = 5/131 (4%)
 Frame = +2

Query  59   ESIDLSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVS  238
            +S + +K  +  E+R ++      LGK +  G      S+GH+C      + ++M Y V 
Sbjct  51   QSDEPAKFFLIEEIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKKDIEEYMDYDVG  110

Query  239  GPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSG  412
              C DDW L QKL++ GC+PLPRRRCFA+  P+  L   PFP+  S+W     +   WS 
Sbjct  111  EICKDDWKLAQKLMVHGCDPLPRRRCFARA-PQ--LYSKPFPINESMWKLPDNRNVRWSQ  167

Query  413  LSCKNLACVNS  445
              CKN  C+ S
Sbjct  168  YRCKNFICLAS  178



>ref|XP_010936580.1| PREDICTED: uncharacterized protein LOC105056176 [Elaeis guineensis]
Length=463

 Score = 89.7 bits (221),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 50/146 (34%), Positives = 75/146 (51%), Gaps = 7/146 (5%)
 Frame = +2

Query  23   KLTRMEKEVLGYESID--LSKPNVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEK  196
            +L R+ K   G+ S +  L       E R ++       GK S+ G  K  A++GH+C  
Sbjct  128  RLIRIPKPDSGFNSTEDPLINFFTVEETRKYITPKGNKNGKLSKYGTNKTYATIGHACVL  187

Query  197  SLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--S  370
                L ++M+Y +   C DDW L QKL+L GC+P+PRRRC A+      L   P P+  S
Sbjct  188  MRKELEEYMNYDIGSYCNDDWHLAQKLMLGGCDPVPRRRCLARA---SKLYQQPLPINES  244

Query  371  LWSNNSEKIYTWSGLSCKNLACVNSK  448
            LW+   ++   WS   C+N  C++ K
Sbjct  245  LWTMPDDRNVRWSNYRCRNFKCLSIK  270



>ref|XP_009383492.1| PREDICTED: uncharacterized protein LOC103971243 [Musa acuminata 
subsp. malaccensis]
Length=477

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 44/117 (38%), Positives = 64/117 (55%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G     AS+GH+C    + + ++M Y V   C DDW   Q+
Sbjct  157  EVRKYMRIKPNRLGKQNFMGANGTFASIGHACFSMKEEMEEYMDYDVGDFCEDDWKQAQR  216

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCFA+  PK  L   P P+  S W    ++   WS   CK+ AC+
Sbjct  217  LMVHGCDPLPRRRCFARA-PK--LYTKPLPINESTWRYPDDRNVRWSHYRCKSFACL  270



>emb|CDP15495.1| unnamed protein product [Coffea canephora]
Length=468

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++      +GK +  G  K+  ++GH+C      L ++M Y +   C DDW+L
Sbjct  155  VTEEIRKYITPKDNRVGKVNIYGTGKIYNTIGHACVSMKKELQEYMDYDIGSYCKDDWNL  214

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      L   P+P+  SLW     +   WS   C+N  C+
Sbjct  215  AQKLMVNGCDPLPRRRCLTRA---SKLYQKPYPINESLWKIPDGRNVRWSNYQCRNFECL  271

Query  440  NSK  448
            +SK
Sbjct  272  SSK  274



>gb|EEE65710.1| hypothetical protein OsJ_21345 [Oryza sativa Japonica Group]
Length=445

 Score = 89.4 bits (220),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 44/122 (36%), Positives = 65/122 (53%), Gaps = 5/122 (4%)
 Frame = +2

Query  89   AAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLG  268
            A E R ++   +   G+    G  +   S+GH+C      L ++MSY V   CPDDW LG
Sbjct  167  AEETRKYVTAKRNREGRPGAYGANRTYGSIGHACVVMRRELDEYMSYDVGALCPDDWDLG  226

Query  269  QKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVN  442
            Q+L+L GC+PLPRRRC A+      L   P P+  SLW+   +    WS   C+   C++
Sbjct  227  QRLMLGGCDPLPRRRCLARASK---LFRRPLPINESLWALPDDGNVRWSRYHCRGYRCLS  283

Query  443  SK  448
            ++
Sbjct  284  AR  285



>gb|KEH18781.1| methyltransferase domain protein, putative [Medicago truncatula]
Length=490

 Score = 89.7 bits (221),  Expect = 6e-18, Method: Compositional matrix adjust.
 Identities = 45/119 (38%), Positives = 66/119 (55%), Gaps = 5/119 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C    + L ++M Y +   C DDW L QK
Sbjct  167  EIRKYVRIRPNRLGKQNFMGANATFTSIGHACFSMKEELEEYMDYDIGEICNDDWKLAQK  226

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            L++ GC+PLPRRRC +++ PK  L   PFP+  S+W    ++   WS   CKN  C+ S
Sbjct  227  LMVHGCDPLPRRRCLSRS-PK--LYSKPFPINESMWKLPDDRNVRWSQYRCKNFTCLAS  282



>ref|XP_010485980.1| PREDICTED: uncharacterized protein LOC104764193 [Camelina sativa]
Length=463

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRKYITPKDNRVGKINMFGTERVFNTIGHACVLMKMELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            LIL GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LILSGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>ref|XP_003616242.1| hypothetical protein MTR_5g077710 [Medicago truncatula]
 gb|AES99200.1| methyltransferase [Medicago truncatula]
Length=388

 Score = 88.6 bits (218),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 45/107 (42%), Positives = 58/107 (54%), Gaps = 1/107 (1%)
 Frame = +2

Query  119  HQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEP  298
             +LPLG +       +    G +C    D +  FMSY V+G CPDD  L Q+L+LKGCEP
Sbjct  76   QKLPLGFNRNFNSDTVHPPAGSACTLFPDDIRSFMSYDVNGSCPDDEILSQRLLLKGCEP  135

Query  299  LPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACV  439
            LPRRRC     P     + PFP SLWS  S     W+  +CK+  C+
Sbjct  136  LPRRRCRPAAPPNFPQPI-PFPSSLWSTPSNSSVVWTAYTCKSYTCL  181



>ref|NP_192033.1| putative methyltransferase [Arabidopsis thaliana]
 emb|CAB80933.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE81998.1| putative methyltransferase [Arabidopsis thaliana]
Length=659

 Score = 90.1 bits (222),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  349  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  408

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  409  RCFSRG-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  452



>ref|XP_008784991.1| PREDICTED: uncharacterized protein LOC103703787 [Phoenix dactylifera]
Length=472

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++       GK S+ G  K   ++GH+C      L ++M+Y +   C DDW L QK
Sbjct  163  EIRKYITAKGNKNGKLSKYGTNKTYGTIGHACVLMRKELEEYMNYDIGSYCNDDWHLAQK  222

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L+L GC+PLPRRRC A+      L   P P+  SLW+   ++   WS   C+N  C++ K
Sbjct  223  LMLGGCDPLPRRRCLARA---SKLYQRPLPINESLWTMPDDRNVRWSRYRCRNFKCLSKK  279



>gb|AAB61017.1| A_IG002N01.7 gene product [Arabidopsis thaliana]
Length=598

 Score = 89.7 bits (221),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 45/107 (42%), Positives = 59/107 (55%), Gaps = 5/107 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G      S+GH+C      L ++M Y V   C DDW L QKL++ GC+PLPRR
Sbjct  288  LGKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWRLAQKLMVHGCDPLPRR  347

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            RCF++  P+  L   PFP+  SLW     +   W    CKN AC+ S
Sbjct  348  RCFSRG-PQ--LYHKPFPINESLWKLPDNRNVRWGQYKCKNFACLAS  391



>gb|KEH17516.1| methyltransferase domain protein, putative [Medicago truncatula]
Length=460

 Score = 89.0 bits (219),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 43/121 (36%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  + + +  G  K+  ++GH+C      L Q+M Y +   C DDW+L
Sbjct  147  VTEEIRKYITPKENRVSRINLYGSDKVYNTIGHACVLHKKELEQYMDYDIGSYCDDDWNL  206

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL+L GC+PLPRRRC  +   KV     P   SLW    E+   W    C+N  C++S
Sbjct  207  AQKLMLNGCDPLPRRRCLTRA-SKVYSKPYPINESLWRLPDERNVRWGNYQCRNFECLSS  265

Query  446  K  448
            K
Sbjct  266  K  266



>ref|XP_006299195.1| hypothetical protein CARUB_v10015342mg [Capsella rubella]
 gb|EOA32093.1| hypothetical protein CARUB_v10015342mg [Capsella rubella]
Length=463

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRKYITPKDNRVGKINMFGTERVYNTIGHTCVLMKMELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            LIL GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LILGGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>ref|XP_009781541.1| PREDICTED: uncharacterized protein LOC104230427 [Nicotiana sylvestris]
Length=453

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/123 (37%), Positives = 68/123 (55%), Gaps = 1/123 (1%)
 Frame = +2

Query  83   NVAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWS  262
            +++ E ++ L  H+LPLG   R+   ++  SVG  C    + L+Q+M+Y V   CP D  
Sbjct  134  DLSNEAKLGLGPHKLPLGLSPRSRTDEVYPSVGGGCLMYKEDLAQYMTYNVGKECPVDDV  193

Query  263  LGQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVN  442
              Q+L+LKGCEPLP RRC  K  P   +   P P SLWS   +    W   +CKN +C+ 
Sbjct  194  FAQRLMLKGCEPLPIRRCHPKA-PAGYVEPTPLPKSLWSTPPDTSIIWDPYTCKNYSCLI  252

Query  443  SKK  451
             ++
Sbjct  253  ERR  255



>ref|XP_007030960.1| Methyltransferase, putative [Theobroma cacao]
 gb|EOY11462.1| Methyltransferase, putative [Theobroma cacao]
Length=471

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 41/121 (34%), Positives = 65/121 (54%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++   +  + K +  G  K+  ++GH+C      L ++M Y +   C DDW+L
Sbjct  157  ITEEIRKYITPKENRIVKVNFYGTEKIYNTIGHACVLMKKELQEYMDYDIGSYCKDDWNL  216

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL++ GC+PLPRRRC  +   KV     P   SLW    ++   W G  C+N  C++S
Sbjct  217  AQKLMVGGCDPLPRRRCLTRA-SKVYQKPYPINESLWKLPDDRNVRWGGYKCRNFGCLSS  275

Query  446  K  448
            K
Sbjct  276  K  276



>ref|XP_011023262.1| PREDICTED: uncharacterized protein LOC105124820 isoform X1 [Populus 
euphratica]
Length=472

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 46/119 (39%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      + ++M Y V   C DDW L QK
Sbjct  151  EIRKYVRIKPNRLGKQNFMGANGTFTSIGHACFAMKKDIEEYMDYDVGEICKDDWKLAQK  210

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNS  445
            L++ GC+PLPRRRCFA+  P+  L   PFP+  S+W     +   WS   CKN  C+ S
Sbjct  211  LMVHGCDPLPRRRCFARA-PQ--LYSKPFPINESMWKLPDNRNVRWSQYRCKNFICLAS  266



>ref|XP_002990866.1| hypothetical protein SELMODRAFT_44179, partial [Selaginella moellendorffii]
 gb|EFJ08139.1| hypothetical protein SELMODRAFT_44179, partial [Selaginella moellendorffii]
Length=335

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = +2

Query  95   ELRMFLL--QHQLPLGKDSRTGITKMVASVGHSCEKSLDL-LSQFMSYKVSGPCPDDWSL  265
            E+  +LL  +H+L  GK +  G      SVG +C  S+   L Q+M Y V   CPDDW+L
Sbjct  5    EINKYLLPREHRLEPGKKNFMGGNATFPSVGLACATSMKAELEQYMDYDVGDYCPDDWTL  64

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
            GQKL++ GC+PLPRRRC A+  P++         SLW     +   W+   CKN  C+  
Sbjct  65   GQKLLVHGCDPLPRRRCLARA-PQLYQKPLAANESLWRIPDSRNVRWNNYKCKNFECLAG  123

Query  446  KK  451
             K
Sbjct  124  NK  125



>gb|KHN24594.1| hypothetical protein glysoja_046776 [Glycine soja]
Length=265

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 43/98 (44%), Positives = 58/98 (59%), Gaps = 5/98 (5%)
 Frame = +2

Query  152  GITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRRCFAKTI  331
            G      S+GH+C    + L ++M Y V   C DDW L QKL++ GC+PLPRRRCF+++ 
Sbjct  2    GENASFTSIGHTCFAMKEELEEYMDYDVGEICNDDWKLAQKLMVHGCDPLPRRRCFSRS-  60

Query  332  PKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            PK  L   PFP+  SLW    ++   WS   CKN AC+
Sbjct  61   PK--LYKQPFPVNESLWKLPDDRNVRWSQYQCKNFACL  96



>ref|XP_002974326.1| hypothetical protein SELMODRAFT_52690, partial [Selaginella moellendorffii]
 gb|EFJ24548.1| hypothetical protein SELMODRAFT_52690, partial [Selaginella moellendorffii]
Length=335

 Score = 87.0 bits (214),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/122 (39%), Positives = 66/122 (54%), Gaps = 4/122 (3%)
 Frame = +2

Query  95   ELRMFLL--QHQLPLGKDSRTGITKMVASVGHSCEKSLDL-LSQFMSYKVSGPCPDDWSL  265
            E+  +LL  +H+L  GK +  G      SVG +C  S+   L Q+M Y V   CPDDW+L
Sbjct  5    EINKYLLPREHRLEPGKKNFMGGNATFPSVGLACATSMKAELEQYMDYDVGDYCPDDWTL  64

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
            GQKL++ GC+PLPRRRC A+  P++         SLW     +   W+   CKN  C+  
Sbjct  65   GQKLLVHGCDPLPRRRCLARA-PQLYQKPLAANESLWRIPDSRNVRWNNYKCKNFECLAG  123

Query  446  KK  451
             K
Sbjct  124  NK  125



>ref|XP_010326694.1| PREDICTED: uncharacterized protein LOC101265683 isoform X1 [Solanum 
lycopersicum]
 ref|XP_010326695.1| PREDICTED: uncharacterized protein LOC101265683 isoform X1 [Solanum 
lycopersicum]
Length=466

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 45/117 (38%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      L K +  G      S+GH+C      L ++M Y V   C DDW L QK
Sbjct  145  EIRKYVRIKPNRLKKQNFMGANGTFTSIGHACFSMKSELEEYMDYDVGEMCNDDWRLAQK  204

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCFA+  P+  L   P+P+  S+W    +K   WS   CKN  C+
Sbjct  205  LMVHGCDPLPRRRCFARA-PQ--LYNKPYPINESIWKLPDDKNVRWSQYRCKNFTCL  258



>ref|XP_003563856.1| PREDICTED: uncharacterized protein LOC100824970 [Brachypodium 
distachyon]
Length=489

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/123 (35%), Positives = 65/123 (53%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +A E R ++       GK S  G  +   ++GH+C      L ++MSY V   CPDDW L
Sbjct  173  MAEETRKYVTTKGNRDGKPSVYGTNRTYGTIGHTCVLMRRELDEYMSYDVGSYCPDDWDL  232

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            GQ+L+L GC+PLPRRRC  +      L   P P+  SLW+   +    W+   C+   C+
Sbjct  233  GQRLMLGGCDPLPRRRCLTRA---SKLFTRPLPINESLWTLPDDGNVRWTHYHCRGYRCL  289

Query  440  NSK  448
            +++
Sbjct  290  SAR  292



>ref|XP_008450643.1| PREDICTED: uncharacterized protein LOC103492170 [Cucumis melo]
Length=473

 Score = 88.6 bits (218),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 42/123 (34%), Positives = 66/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +GK +      +  ++GH+C      L  +M Y +   C DDW+L
Sbjct  159  VVEEIRKYISPKKSRIGKLNMYMTENIYNTIGHACVLYKKELEDYMDYDIGSYCKDDWNL  218

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL+L GC+PLPRRRC  +      +   P+PL  SLW    ++   WS   C+N +C+
Sbjct  219  AQKLMLNGCDPLPRRRCLTRA---SKVYQKPYPLNESLWKTPDDRNVRWSNYQCRNFSCL  275

Query  440  NSK  448
            +SK
Sbjct  276  SSK  278



>gb|KHN23617.1| hypothetical protein glysoja_046357 [Glycine soja]
Length=218

 Score = 85.9 bits (211),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            +  E+R ++   +  +GK +  G  K+  ++GH+C      L ++M Y +   C DDW+L
Sbjct  15   ITEEIRKYISPKENRVGKINLYGADKVYNTIGHACVLYKKELEKYMDYDIGSYCDDDWNL  74

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
             QKL+L GC+PLPRRRC  +   K     +P   SLW     +   W    C+N  C++S
Sbjct  75   AQKLMLNGCDPLPRRRCLTRA-SKDYQKPHPIHESLWRLPDRRNVRWGNYQCRNFECLSS  133

Query  446  K  448
            +
Sbjct  134  Q  134



>ref|XP_010426521.1| PREDICTED: uncharacterized protein LOC104711485 [Camelina sativa]
Length=463

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      +GK +  G  ++  ++GH+C      L ++M Y V   C DDW+L QK
Sbjct  153  EIRKYITPKDNRVGKINMFGTERVSNTIGHACVLMKMELEKYMDYDVGAYCDDDWNLAQK  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            LIL GC+PLPRRRC  +          P+P+  SLW    ++   W    C+N AC++SK
Sbjct  213  LILGGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRNFACLSSK  269



>gb|ABL85035.1| expressed protein [Brachypodium sylvaticum]
Length=418

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 61/94 (65%), Gaps = 9/94 (10%)
 Frame = +2

Query  80   PNVAA---ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKS---LDLLSQFMSYKVSG  241
            PN+ A   EL +FL  H LPLG+D+R+G+T M ASVG  C +S   L LLSQFMSY    
Sbjct  85   PNLPADPPELFLFLTPHALPLGRDARSGLTHMPASVGSVCLRSPSALSLLSQFMSYAPHA  144

Query  242  PCPDDW---SLGQKLILKGCEPLPRRRCFAKTIP  334
             CP +    +L ++L+ KGCEPLPRRRC  +  P
Sbjct  145  ACPLNATASTLPRRLVSKGCEPLPRRRCLTRRPP  178



>gb|KDO56273.1| hypothetical protein CISIN_1g012235mg [Citrus sinensis]
Length=467

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +GK +  G  K+  ++GH+C      L ++M Y +   C DDW+L
Sbjct  154  VTEEIRKYITPKKNRVGKVNIYGAEKIHNTIGHACVLMKKELEEYMDYDIGSYCKDDWNL  213

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      +   PFP+  SLW     +   WS   C+N  C+
Sbjct  214  AQKLMVNGCDPLPRRRCLTRA---SKVYQKPFPINESLWKLPDGRNVRWSNYQCRNFECL  270

Query  440  NSK  448
            +SK
Sbjct  271  SSK  273



>gb|KCW78119.1| hypothetical protein EUGRSUZ_D02328 [Eucalyptus grandis]
Length=469

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 63/117 (54%), Gaps = 5/117 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      L K +  G      S+GH+C      L ++M Y V   C DDW L Q+
Sbjct  148  EIRKYVKIKPNRLKKQNFMGANGTFTSIGHACFAMKKDLEEYMDYDVGEICNDDWKLAQR  207

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            L++ GC+PLPRRRCF++  P+  L   PFP+  S+W    ++   W G  CKN  C+
Sbjct  208  LMVHGCDPLPRRRCFSRA-PQ--LYHKPFPINESIWKLPDDRNVRWGGYRCKNFTCL  261



>ref|XP_010261406.1| PREDICTED: uncharacterized protein LOC104600251 [Nelumbo nucifera]
Length=474

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 1/117 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++      LGK +  G      S+GH+C      L ++M Y V   C DDW L Q+
Sbjct  153  EIRKYVKIKPNRLGKQNFMGANGTFTSIGHACFSMKKELEEYMDYDVGDICKDDWKLAQR  212

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNS  445
            L++ GC+PLPRRRCFA+  P++     P   S+W     +   WS   CKN  C+ S
Sbjct  213  LMVHGCDPLPRRRCFARA-PQLYSKPLPIDESMWKLPDNRNVRWSQYRCKNFNCLVS  268



>ref|XP_009380402.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380403.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009380404.1| PREDICTED: uncharacterized protein LOC103968807 [Musa acuminata 
subsp. malaccensis]
Length=473

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 63/107 (59%), Gaps = 5/107 (5%)
 Frame = +2

Query  134  GKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRRR  313
            GK S  G  K   ++GH+C    + L ++M+Y +   C DDW+L QKL+L GC+PLPRRR
Sbjct  177  GKASVFGTNKTYNTIGHACVLMRNELEEYMNYDIGSYCRDDWNLAQKLMLGGCDPLPRRR  236

Query  314  CFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            C A+      L   P P+  SLW+   ++   WS  +C++  C++S+
Sbjct  237  CLARA---SRLYQRPLPINESLWTMPDDRNVRWSNYNCRDFKCLSSR  280



>ref|XP_008644572.1| PREDICTED: uncharacterized protein LOC103625944 [Zea mays]
 gb|AFW67815.1| hypothetical protein ZEAMMB73_756974 [Zea mays]
Length=407

 Score = 87.4 bits (215),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/121 (40%), Positives = 64/121 (53%), Gaps = 1/121 (1%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E   F   H LP G++   G  ++   VGH C     LL+ FMSY V+G CPDD    Q+
Sbjct  75   EFHAFAGPHALPYGRNPNWGTAELRPPVGHPCLAFPHLLAAFMSYPVNGSCPDDELHAQR  134

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPLSLWSNNSEKIYTWSGLSCKNLACVNSKKL  454
            L+L+GCEPLPRRRC             PFP +LWS   ++   WS  +CK+  C+  +  
Sbjct  135  LLLRGCEPLPRRRCRPAAP-PDPAPPLPFPDALWSTPPDRSVHWSAYTCKSFRCLVDRAR  193

Query  455  S  457
            S
Sbjct  194  S  194



>ref|XP_006433384.1| hypothetical protein CICLE_v10003882mg [Citrus clementina]
 ref|XP_006472058.1| PREDICTED: uncharacterized protein LOC102629548 [Citrus sinensis]
 gb|ESR46624.1| hypothetical protein CICLE_v10003882mg [Citrus clementina]
Length=467

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/123 (35%), Positives = 67/123 (54%), Gaps = 5/123 (4%)
 Frame = +2

Query  86   VAAELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSL  265
            V  E+R ++   +  +GK +  G  K+  ++GH+C      L ++M Y +   C DDW+L
Sbjct  154  VIEEIRKYITPKKNRVGKVNIYGAEKIRNTIGHACVLMKKELEEYMDYDIGSYCKDDWNL  213

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
             QKL++ GC+PLPRRRC  +      +   PFP+  SLW     +   WS   C+N  C+
Sbjct  214  AQKLMVNGCDPLPRRRCLTRA---SKVYQKPFPINESLWKLPDGRNVRWSNYQCRNFECL  270

Query  440  NSK  448
            +SK
Sbjct  271  SSK  273



>ref|XP_008805645.1| PREDICTED: uncharacterized protein LOC103718547 [Phoenix dactylifera]
Length=482

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 42/105 (40%), Positives = 58/105 (55%), Gaps = 5/105 (5%)
 Frame = +2

Query  131  LGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQKLILKGCEPLPRR  310
            LGK +  G     AS+GH+C    + L ++M Y V   C DDW   Q+L++ GC+PLPRR
Sbjct  174  LGKQNFLGANGTFASIGHACFSMKEELEEYMDYDVGDLCKDDWKQAQRLMVHGCDPLPRR  233

Query  311  RCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACV  439
            RCFA+  PK  L   P P+  S+W    ++   WS   C   AC+
Sbjct  234  RCFARA-PK--LYAKPLPINESMWKLPDDRNVRWSHYRCSTFACL  275



>ref|XP_002437791.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
 gb|EER89158.1| hypothetical protein SORBIDRAFT_10g002660 [Sorghum bicolor]
Length=386

 Score = 87.0 bits (214),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 45/87 (52%), Positives = 57/87 (66%), Gaps = 4/87 (5%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKS---LDLLSQFMSYKVSGPCPDDWSL  265
            EL +FL  H LPLG+D+RTG+T M ASV H+C +S   L LLS F SY     CP + +L
Sbjct  100  ELLLFLSPHALPLGRDARTGLTHMPASVAHACFRSPSTLALLSAFASYAPYAVCPRNATL  159

Query  266  GQKLILKGCEPLPRRRCFAKTIPKVGL  346
              +LI K CEPLPRRRC ++  P+  L
Sbjct  160  PHRLISKACEPLPRRRCLSRG-PRAAL  185



>emb|CDY05163.1| BnaC05g46400D [Brassica napus]
Length=464

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 66/120 (55%), Gaps = 5/120 (4%)
 Frame = +2

Query  95   ELRMFLLQHQLPLGKDSRTGITKMVASVGHSCEKSLDLLSQFMSYKVSGPCPDDWSLGQK  274
            E+R ++   +  +GK +  G  ++  ++GH+C      L ++M Y V   C DDWSL QK
Sbjct  154  EIRKYITPKENRVGKVNMFGTERVYNTIGHACVLMKTELEKYMDYDVGAYCDDDWSLAQK  213

Query  275  LILKGCEPLPRRRCFAKTIPKVGLNLNPFPL--SLWSNNSEKIYTWSGLSCKNLACVNSK  448
            L++ GC+PLPRRRC  +          P+P+  SLW    ++   W    C++ AC++SK
Sbjct  214  LMVNGCDPLPRRRCLTRASMTYQ---KPYPINESLWKLPDDRNVRWGNYQCRSFACLSSK  270



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 563956788320