BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A16

Length=600
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|NP_001238096.1|  uncharacterized protein LOC100305622               127   2e-33   Glycine max [soybeans]
ref|NP_001238516.1|  copper chaperone homolog CCH                       125   1e-32   
gb|KJB75018.1|  hypothetical protein B456_012G020400                    124   2e-32   Gossypium raimondii
gb|KHG07070.1|  Copper transport protein ATOX1                          124   2e-32   Gossypium arboreum [tree cotton]
ref|XP_007145544.1|  hypothetical protein PHAVU_007G247500g             124   2e-32   Phaseolus vulgaris [French bean]
ref|XP_002443602.1|  hypothetical protein SORBIDRAFT_08g022260          123   2e-32   Sorghum bicolor [broomcorn]
gb|ACU18996.1|  unknown                                                 124   3e-32   Glycine max [soybeans]
ref|XP_009628520.1|  PREDICTED: copper transport protein CCH-like...    124   3e-32   Nicotiana tomentosiformis
gb|KJB75015.1|  hypothetical protein B456_012G020400                    123   4e-32   Gossypium raimondii
gb|KJB75017.1|  hypothetical protein B456_012G020400                    123   5e-32   Gossypium raimondii
ref|NP_564870.1|  copper transport protein ATX1                         122   5e-32   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002315448.2|  hypothetical protein POPTR_0010s24290g             122   6e-32   Populus trichocarpa [western balsam poplar]
ref|XP_008783994.1|  PREDICTED: copper transport protein ATX1           122   8e-32   Phoenix dactylifera
ref|XP_009800094.1|  PREDICTED: copper transport protein CCH isof...    122   1e-31   Nicotiana sylvestris
gb|ACV50430.1|  copper chaperone                                        121   1e-31   Jatropha curcas
ref|XP_009628580.1|  PREDICTED: copper transport protein CCH-like...    122   2e-31   Nicotiana tomentosiformis
ref|XP_006432301.1|  hypothetical protein CICLE_v10002981mg             120   2e-31   Citrus clementina [clementine]
ref|XP_011024240.1|  PREDICTED: copper transport protein ATX1-like      120   3e-31   Populus euphratica
ref|XP_010552928.1|  PREDICTED: copper transport protein ATX1           120   3e-31   Tarenaya hassleriana [spider flower]
ref|XP_002264332.1|  PREDICTED: copper transport protein CCH            120   3e-31   Vitis vinifera
gb|KFK34866.1|  hypothetical protein AALP_AA5G203500                    121   3e-31   Arabis alpina [alpine rockcress]
gb|KJB75016.1|  hypothetical protein B456_012G020400                    120   3e-31   Gossypium raimondii
ref|XP_002311033.2|  hypothetical protein POPTR_0008s02430g             120   3e-31   Populus trichocarpa [western balsam poplar]
ref|XP_006407536.1|  hypothetical protein EUTSA_v10021868mg             120   3e-31   Eutrema salsugineum [saltwater cress]
ref|XP_002888491.1|  hypothetical protein ARALYDRAFT_475728             120   3e-31   
ref|XP_006491863.1|  PREDICTED: copper transport protein ATX1-like      120   3e-31   Citrus sinensis [apfelsine]
ref|XP_010242607.1|  PREDICTED: copper transport protein CCH-like       120   4e-31   Nelumbo nucifera [Indian lotus]
emb|CAH59420.1|  copper chaperone                                       120   5e-31   Plantago major [cart-track plant]
emb|CDY00957.1|  BnaC05g42430D                                          119   5e-31   
gb|KDO36992.1|  hypothetical protein CISIN_1g033693mg                   120   6e-31   Citrus sinensis [apfelsine]
ref|XP_009800096.1|  PREDICTED: copper transport protein CCH isof...    120   6e-31   Nicotiana sylvestris
ref|XP_009146823.1|  PREDICTED: copper transport protein ATX1           119   7e-31   Brassica rapa
ref|XP_010511552.1|  PREDICTED: copper transport protein ATX1           119   7e-31   Camelina sativa [gold-of-pleasure]
gb|ADD69807.1|  copper transport protein ATOX1                          119   9e-31   Hevea brasiliensis [jebe]
ref|NP_001149242.1|  copper chaperone                                   119   1e-30   Zea mays [maize]
gb|KFK38450.1|  hypothetical protein AALP_AA3G114900                    118   1e-30   Arabis alpina [alpine rockcress]
ref|XP_009116322.1|  PREDICTED: copper transport protein CCH            119   1e-30   Brassica rapa
emb|CDO99889.1|  unnamed protein product                                119   1e-30   Coffea canephora [robusta coffee]
ref|XP_006303016.1|  hypothetical protein CARUB_v10021172mg             119   1e-30   
gb|KJB75019.1|  hypothetical protein B456_012G020400                    119   1e-30   Gossypium raimondii
ref|XP_010470498.1|  PREDICTED: copper transport protein ATX1-like      118   1e-30   Camelina sativa [gold-of-pleasure]
ref|XP_009103992.1|  PREDICTED: copper transport protein CCH            119   1e-30   Brassica rapa
ref|XP_006291912.1|  hypothetical protein CARUB_v10018096mg             121   2e-30   
ref|XP_010067150.1|  PREDICTED: copper transport protein CCH-like       118   2e-30   Eucalyptus grandis [rose gum]
ref|XP_011032831.1|  PREDICTED: copper transport protein CCH            118   2e-30   Populus euphratica
gb|KHN37836.1|  Copper transport protein ATOX1                          118   2e-30   Glycine soja [wild soybean]
ref|XP_002878075.1|  hypothetical protein ARALYDRAFT_486064             119   2e-30   
gb|AIL49299.1|  copper chaperone                                        119   2e-30   Capsicum annuum
ref|XP_002533872.1|  copper transport protein atox1, putative           118   2e-30   Ricinus communis
ref|XP_003536318.1|  PREDICTED: copper transport protein ATX1-like      117   2e-30   Glycine max [soybeans]
ref|XP_010912255.1|  PREDICTED: copper transport protein ATX1-lik...    119   3e-30   Elaeis guineensis
emb|CDY32007.1|  BnaC06g15850D                                          120   3e-30   Brassica napus [oilseed rape]
gb|KDP45000.1|  hypothetical protein JCGZ_01500                         118   3e-30   Jatropha curcas
ref|XP_010504524.1|  PREDICTED: copper transport protein CCH-like       118   3e-30   Camelina sativa [gold-of-pleasure]
emb|CDX67640.1|  BnaA07g16800D                                          119   3e-30   
dbj|BAJ34280.1|  unnamed protein product                                118   4e-30   Eutrema halophilum
ref|XP_006436645.1|  hypothetical protein CICLE_v10033197mg             117   5e-30   Citrus clementina [clementine]
dbj|BAJ92563.1|  predicted protein                                      118   5e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009619825.1|  PREDICTED: copper transport protein ATX1-lik...    117   5e-30   Nicotiana tomentosiformis
ref|NP_191183.1|  copper chaperone                                      118   5e-30   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234347.1|  copper chaperone                                   117   5e-30   Solanum lycopersicum
emb|CDY71670.1|  BnaAnng38380D                                          117   6e-30   Brassica napus [oilseed rape]
ref|XP_007010241.1|  Anti-oxidant 1                                     117   6e-30   
ref|XP_006851536.1|  hypothetical protein AMTR_s00040p00173680          116   7e-30   
dbj|BAJ88616.1|  predicted protein                                      118   7e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009781186.1|  PREDICTED: copper transport protein ATX1 iso...    116   8e-30   Nicotiana sylvestris
ref|XP_006361447.1|  PREDICTED: copper transport protein CCH-like       117   8e-30   Solanum tuberosum [potatoes]
ref|NP_001061234.1|  Os08g0205400                                       116   9e-30   
ref|XP_003556271.1|  PREDICTED: copper transport protein ATX1           116   1e-29   Glycine max [soybeans]
ref|XP_004979205.1|  PREDICTED: heavy metal-associated isoprenyla...    115   1e-29   Setaria italica
emb|CDX72154.1|  BnaC08g27200D                                          116   1e-29   
gb|ACG30983.1|  copper chaperone                                        115   1e-29   Zea mays [maize]
ref|XP_010427431.1|  PREDICTED: copper transport protein CCH isof...    115   1e-29   Camelina sativa [gold-of-pleasure]
ref|XP_006431955.1|  hypothetical protein CICLE_v10002978mg             115   2e-29   Citrus clementina [clementine]
gb|KJB11925.1|  hypothetical protein B456_002G145400                    115   2e-29   Gossypium raimondii
ref|XP_010912254.1|  PREDICTED: copper transport protein ATX1-lik...    117   2e-29   Elaeis guineensis
ref|XP_006468127.1|  PREDICTED: copper transport protein ATX1-like      115   2e-29   
ref|XP_006659209.1|  PREDICTED: copper transport protein ATX1-like      115   2e-29   Oryza brachyantha
gb|KHG03721.1|  superoxide dismutase 1 copper chaperone                 115   3e-29   Gossypium arboreum [tree cotton]
ref|XP_004249983.1|  PREDICTED: copper transport protein CCH-like       115   3e-29   Solanum lycopersicum
ref|XP_006647337.1|  PREDICTED: copper transport protein CCH-like       116   3e-29   Oryza brachyantha
gb|AFK43760.1|  unknown                                                 116   3e-29   Lotus japonicus
gb|AFK35185.1|  unknown                                                 116   3e-29   Lotus japonicus
ref|XP_003563850.1|  PREDICTED: copper transport protein ATX1-like      115   3e-29   Brachypodium distachyon [annual false brome]
ref|XP_010516231.1|  PREDICTED: copper transport protein CCH-like...    115   4e-29   Camelina sativa [gold-of-pleasure]
ref|XP_010088759.1|  Copper transport protein ATOX1                     115   5e-29   Morus notabilis
ref|XP_010907148.1|  PREDICTED: copper transport protein ATX1-like      114   5e-29   Elaeis guineensis
ref|NP_001173001.1|  Os02g0530100                                       119   5e-29   
ref|XP_011076928.1|  PREDICTED: copper transport protein CCH-like       114   7e-29   Sesamum indicum [beniseed]
gb|AAF15285.1|AF198626_1  copper chaperone homolog CCH                  115   8e-29   Oryza sativa [red rice]
ref|XP_010244224.1|  PREDICTED: copper transport protein CCH-like       114   8e-29   Nelumbo nucifera [Indian lotus]
ref|XP_009139111.1|  PREDICTED: copper transport protein CCH-like...    116   1e-28   Brassica rapa
ref|XP_003591755.1|  Copper chaperone                                   113   1e-28   Medicago truncatula
ref|XP_009403731.1|  PREDICTED: copper transport protein ATX1-like      114   1e-28   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABK20883.1|  unknown                                                 113   1e-28   Picea sitchensis
ref|XP_009139112.1|  PREDICTED: copper transport protein CCH-like...    115   1e-28   Brassica rapa
ref|XP_007143814.1|  hypothetical protein PHAVU_007G103800g             113   2e-28   Phaseolus vulgaris [French bean]
ref|XP_009404819.1|  PREDICTED: copper transport protein CCH            113   2e-28   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004489515.1|  PREDICTED: uncharacterized protein LOC101501125    114   3e-28   Cicer arietinum [garbanzo]
ref|XP_009125574.1|  PREDICTED: copper transport protein ATX1-like      111   5e-28   Brassica rapa
emb|CDY14145.1|  BnaC02g02620D                                          112   5e-28   Brassica napus [oilseed rape]
ref|XP_010522335.1|  PREDICTED: copper transport protein CCH-like       112   5e-28   Tarenaya hassleriana [spider flower]
emb|CAE51321.1|  chopper chaperone                                      112   5e-28   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004308552.1|  PREDICTED: copper transport protein ATX1-like      112   9e-28   Fragaria vesca subsp. vesca
ref|XP_003575064.1|  PREDICTED: copper transport protein CCH-like       111   1e-27   Brachypodium distachyon [annual false brome]
gb|EYU19787.1|  hypothetical protein MIMGU_mgv1a017040mg                111   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_009336005.1|  PREDICTED: copper transport protein CCH-like       111   1e-27   Pyrus x bretschneideri [bai li]
emb|CDX76052.1|  BnaA04g03160D                                          112   1e-27   
gb|KJB73384.1|  hypothetical protein B456_011G230400                    113   1e-27   Gossypium raimondii
emb|CDY43346.1|  BnaC04g25100D                                          113   1e-27   Brassica napus [oilseed rape]
ref|XP_010427430.1|  PREDICTED: copper transport protein CCH isof...    110   2e-27   Camelina sativa [gold-of-pleasure]
ref|XP_006398924.1|  hypothetical protein EUTSA_v10015160mg             110   2e-27   Eutrema salsugineum [saltwater cress]
ref|XP_004496193.1|  PREDICTED: copper transport protein ATOX1-like     110   2e-27   Cicer arietinum [garbanzo]
gb|EMS45185.1|  Copper transport protein ATOX1                          112   2e-27   Triticum urartu
ref|XP_007221369.1|  hypothetical protein PRUPE_ppa014090mg             110   2e-27   Prunus persica
ref|XP_004489516.1|  PREDICTED: heavy metal-associated isoprenyla...    111   2e-27   Cicer arietinum [garbanzo]
ref|XP_008446769.1|  PREDICTED: copper transport protein CCH-like       110   3e-27   Cucumis melo [Oriental melon]
ref|XP_004150491.1|  PREDICTED: copper transport protein ATOX1-li...    110   4e-27   Cucumis sativus [cucumbers]
gb|ACJ84810.1|  unknown                                                 110   4e-27   Medicago truncatula
ref|XP_004952635.1|  PREDICTED: heavy metal-associated isoprenyla...    110   5e-27   
ref|XP_010516230.1|  PREDICTED: copper transport protein CCH-like...    110   5e-27   Camelina sativa [gold-of-pleasure]
ref|XP_010032092.1|  PREDICTED: copper transport protein ATX1-like      109   8e-27   Eucalyptus grandis [rose gum]
ref|XP_004489514.1|  PREDICTED: uncharacterized protein LOC101500482    110   8e-27   Cicer arietinum [garbanzo]
ref|XP_010694708.1|  PREDICTED: copper transport protein ATX1-like      109   1e-26   Beta vulgaris subsp. vulgaris [field beet]
gb|ACC95537.1|  copper chaperone protein                                108   1e-26   Knorringia sibirica
gb|KHG07071.1|  Copper transport protein ATOX1                          108   1e-26   Gossypium arboreum [tree cotton]
ref|XP_002453929.1|  hypothetical protein SORBIDRAFT_04g021590          108   1e-26   Sorghum bicolor [broomcorn]
ref|NP_001154453.1|  copper transport protein ATX1                      107   2e-26   Arabidopsis thaliana [mouse-ear cress]
dbj|BAH57197.1|  AT1G66240                                              107   2e-26   Arabidopsis thaliana [mouse-ear cress]
gb|KJB75020.1|  hypothetical protein B456_012G020400                    108   3e-26   Gossypium raimondii
ref|XP_006407535.1|  hypothetical protein EUTSA_v10021868mg             106   3e-26   Eutrema salsugineum [saltwater cress]
ref|XP_006398923.1|  hypothetical protein EUTSA_v10015160mg             107   4e-26   
ref|XP_004150490.1|  PREDICTED: copper transport protein ATOX1-li...    107   4e-26   
gb|KCW51481.1|  hypothetical protein EUGRSUZ_J01000                     107   5e-26   Eucalyptus grandis [rose gum]
ref|XP_008345701.1|  PREDICTED: copper transport protein CCH-like       106   6e-26   Malus domestica [apple tree]
emb|CDP21618.1|  unnamed protein product                                107   6e-26   Coffea canephora [robusta coffee]
ref|XP_010415167.1|  PREDICTED: copper transport protein ATX1 iso...    105   7e-26   Camelina sativa [gold-of-pleasure]
gb|ACH63216.1|  copper homeostasis factor                               105   1e-25   Rheum australe [Himalayan rhubarb]
gb|KHN10367.1|  Copper transport protein ATOX1                          106   1e-25   Glycine soja [wild soybean]
gb|KDO36998.1|  hypothetical protein CISIN_1g034633mg                   105   1e-25   Citrus sinensis [apfelsine]
ref|XP_007224903.1|  hypothetical protein PRUPE_ppa022012mg             105   2e-25   
gb|ACG28065.1|  hypothetical protein                                    105   2e-25   Zea mays [maize]
gb|ACG24461.1|  hypothetical protein                                    105   3e-25   Zea mays [maize]
tpg|DAA47615.1|  TPA: hypothetical protein ZEAMMB73_968377              104   3e-25   
ref|XP_008219348.1|  PREDICTED: LOW QUALITY PROTEIN: copper trans...    104   3e-25   Prunus mume [ume]
gb|ACG27146.1|  hypothetical protein                                    105   3e-25   Zea mays [maize]
ref|XP_009356113.1|  PREDICTED: copper transport protein CCH            104   4e-25   Pyrus x bretschneideri [bai li]
gb|KDP33082.1|  hypothetical protein JCGZ_13655                         103   4e-25   Jatropha curcas
emb|CDX80916.1|  BnaC03g01700D                                          112   9e-25   
ref|XP_002978885.1|  hypothetical protein SELMODRAFT_109953             102   1e-24   
ref|XP_003621459.1|  Copper transport protein ATOX1                     104   1e-24   
ref|XP_001768826.1|  predicted protein                                  102   3e-24   
ref|XP_009619826.1|  PREDICTED: copper transport protein ATX1-lik...    101   4e-24   Nicotiana tomentosiformis
ref|XP_009781188.1|  PREDICTED: copper transport protein ATX1 iso...    101   5e-24   Nicotiana sylvestris
emb|CDY11299.1|  BnaA03g01350D                                        98.2    7e-23   Brassica napus [oilseed rape]
ref|XP_004150489.1|  PREDICTED: copper transport protein ATOX1-li...  97.8    2e-22   
gb|KHN00909.1|  hypothetical protein glysoja_000577                   97.4    5e-22   Glycine soja [wild soybean]
gb|EPS63271.1|  copper chaperone                                      95.1    9e-22   Genlisea aurea
ref|XP_008232042.1|  PREDICTED: copper transport protein CCH-like     93.6    5e-21   Prunus mume [ume]
ref|XP_005649391.1|  hypothetical protein COCSUDRAFT_14202            88.6    2e-19   Coccomyxa subellipsoidea C-169
ref|XP_002954752.1|  hypothetical protein VOLCADRAFT_82965            88.2    3e-19   Volvox carteri f. nagariensis
ref|XP_002975956.1|  hypothetical protein SELMODRAFT_104411           85.9    4e-18   
ref|XP_003060365.1|  predicted protein                                84.3    1e-17   Micromonas pusilla CCMP1545
ref|XP_002968528.1|  hypothetical protein SELMODRAFT_169899           84.0    2e-17   
gb|KIY96157.1|  copper chaperone                                      81.3    1e-16   Monoraphidium neglectum
ref|XP_011398390.1|  Copper transport protein ATOX1                   81.3    1e-16   Auxenochlorella protothecoides
ref|XP_002505251.1|  predicted protein                                80.9    2e-16   Micromonas commoda
gb|KDD72288.1|  hypothetical protein H632_c3575p0                     79.7    4e-16   Helicosporidium sp. ATCC 50920
gb|ABK23854.1|  unknown                                               79.7    4e-15   Picea sitchensis
gb|EMS53372.1|  hypothetical protein TRIUR3_28512                     78.2    1e-14   Triticum urartu
ref|XP_003524069.1|  PREDICTED: uncharacterized protein LOC100802591  74.7    2e-13   Glycine max [soybeans]
gb|KHN30679.1|  hypothetical protein glysoja_049471                   74.7    2e-13   Glycine soja [wild soybean]
ref|XP_003531045.2|  PREDICTED: uncharacterized protein LOC100785162  74.7    2e-13   Glycine max [soybeans]
ref|XP_006351801.1|  PREDICTED: uncharacterized protein LOC102587724  74.7    3e-13   Solanum tuberosum [potatoes]
ref|XP_010269157.1|  PREDICTED: uncharacterized protein LOC104605904  74.3    3e-13   Nelumbo nucifera [Indian lotus]
ref|XP_010030932.1|  PREDICTED: copper transport protein ATX1-like    73.9    4e-13   Eucalyptus grandis [rose gum]
ref|XP_001694742.1|  copper chaperone                                 71.6    5e-13   Chlamydomonas reinhardtii
ref|XP_007151507.1|  hypothetical protein PHAVU_004G052700g           73.2    6e-13   Phaseolus vulgaris [French bean]
ref|XP_006585452.1|  PREDICTED: uncharacterized protein LOC102661113  73.2    7e-13   Glycine max [soybeans]
ref|XP_011087847.1|  PREDICTED: uncharacterized protein LOC105169203  73.6    7e-13   Sesamum indicum [beniseed]
emb|CBI32881.3|  unnamed protein product                              73.2    9e-13   Vitis vinifera
ref|XP_007395908.1|  hypothetical protein PHACADRAFT_256312           70.9    9e-13   Phanerochaete carnosa HHB-10118-sp
ref|XP_006846435.1|  hypothetical protein AMTR_s00018p00054220        73.2    1e-12   Amborella trichopoda
ref|XP_006493297.1|  PREDICTED: uncharacterized protein LOC102621358  73.2    1e-12   
ref|XP_007043020.1|  Chloroplast-targeted copper chaperone protein    72.8    1e-12   
gb|KDO42559.1|  hypothetical protein CISIN_1g029814mg                 73.2    1e-12   Citrus sinensis [apfelsine]
gb|KJB32008.1|  hypothetical protein B456_005G218500                  72.8    1e-12   Gossypium raimondii
ref|XP_006432488.1|  hypothetical protein CICLE_v10002596mg           73.2    1e-12   Citrus clementina [clementine]
ref|XP_002967453.1|  hypothetical protein SELMODRAFT_39116            70.5    1e-12   
ref|XP_010657601.1|  PREDICTED: uncharacterized protein LOC100243595  72.8    1e-12   Vitis vinifera
emb|CAN60769.1|  hypothetical protein VITISV_043918                   72.8    1e-12   Vitis vinifera
gb|KJB47189.1|  hypothetical protein B456_008G014900                  72.0    2e-12   Gossypium raimondii
ref|XP_007863821.1|  hypothetical protein GLOTRDRAFT_98891            69.7    2e-12   Gloeophyllum trabeum ATCC 11539
ref|XP_004230641.1|  PREDICTED: uncharacterized protein LOC101246479  71.6    3e-12   Solanum lycopersicum
ref|XP_010261208.1|  PREDICTED: uncharacterized protein LOC104600082  71.6    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_003547074.2|  PREDICTED: uncharacterized protein LOC100814...  71.6    3e-12   Glycine max [soybeans]
gb|KHN33508.1|  hypothetical protein glysoja_005550                   71.2    4e-12   Glycine soja [wild soybean]
ref|XP_010687472.1|  PREDICTED: uncharacterized protein LOC104901580  71.2    4e-12   Beta vulgaris subsp. vulgaris [field beet]
gb|ABK22487.1|  unknown                                               71.6    4e-12   Picea sitchensis
gb|EMS62936.1|  hypothetical protein TRIUR3_26593                     72.0    5e-12   Triticum urartu
ref|XP_008674049.1|  PREDICTED: vitellogenin                          73.2    5e-12   Zea mays [maize]
ref|XP_009775803.1|  PREDICTED: uncharacterized protein LOC104225657  71.2    5e-12   Nicotiana sylvestris
ref|XP_003618919.1|  Copper transport protein ATOX1-like protein      70.5    5e-12   Medicago truncatula
ref|XP_004504935.1|  PREDICTED: uncharacterized protein LOC101489107  70.9    5e-12   Cicer arietinum [garbanzo]
ref|XP_007321248.1|  hypothetical protein SERLADRAFT_473829           68.6    5e-12   Serpula lacrymans var. lacrymans S7.9
ref|XP_008809313.1|  PREDICTED: uncharacterized protein LOC103721057  70.5    6e-12   Phoenix dactylifera
gb|KDQ60788.1|  hypothetical protein JAAARDRAFT_31766                 68.6    7e-12   Jaapia argillacea MUCL 33604
ref|XP_009612016.1|  PREDICTED: uncharacterized protein LOC104105424  70.9    7e-12   Nicotiana tomentosiformis
ref|XP_008455533.1|  PREDICTED: uncharacterized protein LOC103495684  70.5    7e-12   
emb|CDO97473.1|  unnamed protein product                              70.5    8e-12   Coffea canephora [robusta coffee]
ref|XP_005851421.1|  hypothetical protein CHLNCDRAFT_137700           68.2    8e-12   Chlorella variabilis
ref|XP_003525732.2|  PREDICTED: heavy metal-associated isoprenyla...  70.1    9e-12   
gb|ETS64554.1|  hypothetical protein PaG_01019                        70.1    9e-12   Moesziomyces aphidis DSM 70725
ref|XP_008447442.1|  PREDICTED: uncharacterized protein LOC103489885  71.2    9e-12   Cucumis melo [Oriental melon]
gb|KDQ33322.1|  hypothetical protein PLEOSDRAFT_1110514               73.6    9e-12   Pleurotus ostreatus PC15
ref|XP_010530606.1|  PREDICTED: uncharacterized protein LOC104807161  69.7    1e-11   Tarenaya hassleriana [spider flower]
ref|XP_007148430.1|  hypothetical protein PHAVU_006G207900g           70.1    1e-11   Phaseolus vulgaris [French bean]
ref|XP_004170944.1|  PREDICTED: uncharacterized LOC101208798          71.2    1e-11   
ref|XP_007159084.1|  hypothetical protein PHAVU_002G207200g           70.1    1e-11   Phaseolus vulgaris [French bean]
ref|XP_009374689.1|  PREDICTED: uncharacterized protein LOC103963579  71.6    1e-11   Pyrus x bretschneideri [bai li]
gb|EMS62935.1|  hypothetical protein TRIUR3_26592                     71.6    1e-11   Triticum urartu
ref|XP_008218901.1|  PREDICTED: uncharacterized protein LOC103319165  70.5    1e-11   Prunus mume [ume]
ref|XP_008798426.1|  PREDICTED: heavy metal-associated isoprenyla...  69.7    1e-11   Phoenix dactylifera
ref|XP_007361198.1|  copper chaperone taha                            67.8    1e-11   Dichomitus squalens LYAD-421 SS1
gb|KGN54216.1|  hypothetical protein Csa_4G293260                     71.2    1e-11   Cucumis sativus [cucumbers]
gb|KGN43698.1|  hypothetical protein Csa_7G060180                     69.7    1e-11   Cucumis sativus [cucumbers]
ref|XP_001865898.1|  antioxidant enzyme                               67.8    1e-11   Culex quinquefasciatus
ref|XP_004489636.1|  PREDICTED: heavy metal-associated isoprenyla...  69.3    1e-11   
ref|XP_010103837.1|  hypothetical protein L484_024139                 70.5    1e-11   Morus notabilis
ref|XP_009542664.1|  copper chaperone                                 67.8    1e-11   Heterobasidion irregulare TC 32-1
ref|XP_002457859.1|  hypothetical protein SORBIDRAFT_03g016720        71.6    1e-11   Sorghum bicolor [broomcorn]
ref|XP_006645411.1|  PREDICTED: uncharacterized protein LOC102709416  70.1    1e-11   Oryza brachyantha
gb|ABK22742.1|  unknown                                               69.3    1e-11   Picea sitchensis
ref|XP_004968755.1|  PREDICTED: uncharacterized protein LOC101762466  72.0    2e-11   Setaria italica
emb|CBI20049.3|  unnamed protein product                              70.1    2e-11   Vitis vinifera
ref|XP_007226847.1|  hypothetical protein PRUPE_ppa017295mg           70.1    2e-11   Prunus persica
gb|ABK24206.1|  unknown                                               69.3    2e-11   Picea sitchensis
ref|NP_001241088.1|  uncharacterized protein LOC100778653             69.3    2e-11   Glycine max [soybeans]
ref|XP_006378456.1|  hypothetical protein POPTR_0010s12480g           68.6    2e-11   
gb|EMT29987.1|  hypothetical protein F775_17366                       68.9    2e-11   
ref|XP_011070194.1|  PREDICTED: heavy metal-associated isoprenyla...  68.6    2e-11   
ref|XP_011390806.1|  putative copper metallochaperone ATX1            67.0    2e-11   Ustilago maydis 521
ref|XP_010905917.1|  PREDICTED: uncharacterized protein LOC105033001  68.9    2e-11   Elaeis guineensis
ref|XP_010248218.1|  PREDICTED: heavy metal-associated isoprenyla...  68.6    2e-11   Nelumbo nucifera [Indian lotus]
ref|XP_008783756.1|  PREDICTED: uncharacterized protein LOC103702895  69.3    2e-11   Phoenix dactylifera
ref|XP_003552099.1|  PREDICTED: heavy metal-associated isoprenyla...  68.9    2e-11   Glycine max [soybeans]
ref|XP_010044169.1|  PREDICTED: heavy metal-associated isoprenyla...  68.6    3e-11   Eucalyptus grandis [rose gum]
gb|KHN44322.1|  hypothetical protein glysoja_014363                   68.6    3e-11   Glycine soja [wild soybean]
ref|XP_006660117.1|  PREDICTED: uncharacterized protein LOC102713206  68.2    3e-11   
gb|KDN47548.1|  putative ATX1-antioxidant protein and metal homeo...  66.6    3e-11   Tilletiaria anomala UBC 951
gb|EMT16131.1|  hypothetical protein F775_15810                       68.9    3e-11   
ref|XP_002315894.1|  heavy-metal-associated domain-containing fam...  68.2    3e-11   Populus trichocarpa [western balsam poplar]
ref|XP_001778457.1|  predicted protein                                66.2    3e-11   
ref|XP_009341632.1|  PREDICTED: uncharacterized protein LOC103933662  70.1    3e-11   Pyrus x bretschneideri [bai li]
ref|XP_010235110.1|  PREDICTED: uncharacterized protein LOC100834333  68.6    3e-11   Brachypodium distachyon [annual false brome]
ref|NP_001051712.1|  Os03g0819400                                     68.9    3e-11   
ref|XP_008369836.1|  PREDICTED: putative protein TPRXL                70.1    3e-11   Malus domestica [apple tree]
emb|CDY47384.1|  BnaC04g24790D                                        68.2    4e-11   Brassica napus [oilseed rape]
emb|CBQ68789.1|  probable ATX1-antioxidant protein and metal home...  66.2    4e-11   Sporisorium reilianum SRZ2
ref|NP_001061768.1|  Os08g0405700                                     68.9    4e-11   
ref|XP_003565192.1|  PREDICTED: uncharacterized protein LOC100845276  70.1    4e-11   Brachypodium distachyon [annual false brome]
ref|XP_007764734.1|  copper chaperone taha                            66.2    4e-11   Coniophora puteana RWD-64-598 SS2
gb|EEC83555.1|  hypothetical protein OsI_29189                        68.9    4e-11   Oryza sativa Indica Group [Indian rice]
ref|XP_008677205.1|  PREDICTED: heavy metal-associated domain con...  68.9    4e-11   
ref|XP_009380842.1|  PREDICTED: uncharacterized protein LOC103969118  68.2    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009377116.1|  PREDICTED: flocculation protein FLO11-like       70.1    4e-11   Pyrus x bretschneideri [bai li]
ref|XP_006826993.1|  hypothetical protein AMTR_s00010p00210890        68.2    4e-11   
ref|XP_010505322.1|  PREDICTED: uncharacterized protein LOC104782...  69.3    4e-11   Camelina sativa [gold-of-pleasure]
ref|XP_008359704.1|  PREDICTED: uncharacterized protein LOC103423409  69.7    4e-11   
ref|XP_006296095.1|  hypothetical protein CARUB_v10025244mg           69.3    5e-11   Capsella rubella
ref|XP_006650801.1|  PREDICTED: uncharacterized protein LOC102709351  68.6    5e-11   
ref|XP_008355148.1|  PREDICTED: uncharacterized protein LOC103418817  68.9    5e-11   
gb|EPS66470.1|  hypothetical protein M569_08310                       67.4    5e-11   Genlisea aurea
dbj|BAJ91462.1|  predicted protein                                    70.1    5e-11   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_010509344.1|  PREDICTED: uncharacterized protein LOC104785...  70.1    5e-11   Camelina sativa [gold-of-pleasure]
ref|XP_010916917.1|  PREDICTED: heavy metal-associated isoprenyla...  67.8    5e-11   Elaeis guineensis
ref|XP_007163627.1|  hypothetical protein PHAVU_001G250300g           67.8    6e-11   Phaseolus vulgaris [French bean]
gb|EMT23051.1|  hypothetical protein F775_43162                       67.8    6e-11   
ref|XP_001243291.1|  hypothetical protein CIMG_07187                  65.9    6e-11   Coccidioides immitis RS
ref|XP_004494987.1|  PREDICTED: uncharacterized protein LOC101494357  68.6    6e-11   
ref|XP_011039025.1|  PREDICTED: heavy metal-associated isoprenyla...  67.4    6e-11   
ref|XP_009374740.1|  PREDICTED: copper transport protein ATX1         67.4    6e-11   
emb|CDP00747.1|  unnamed protein product                              67.4    6e-11   
ref|XP_006591338.1|  PREDICTED: copper transport protein ATX1-like    66.6    6e-11   
gb|KCW85621.1|  hypothetical protein EUGRSUZ_B02409                   68.6    6e-11   
ref|XP_004973391.1|  PREDICTED: uncharacterized protein LOC101786...  68.2    6e-11   
ref|XP_008599486.1|  heavy-metal-associated domain-containing pro...  65.9    6e-11   
ref|XP_009399540.1|  PREDICTED: uncharacterized protein LOC103983...  67.4    6e-11   
ref|XP_002262627.2|  PREDICTED: heavy metal-associated isoprenyla...  67.4    6e-11   
ref|XP_006424736.1|  hypothetical protein CICLE_v10029192mg           68.6    6e-11   
emb|CDY55410.1|  BnaCnng28760D                                        67.0    7e-11   
gb|KHG07180.1|  Superoxide dismutase 1 copper chaperone               67.4    7e-11   
ref|XP_009384510.1|  PREDICTED: uncharacterized protein LOC103972042  67.8    7e-11   
ref|XP_010542616.1|  PREDICTED: uncharacterized protein DDB_G0271670  68.6    7e-11   
ref|XP_010517006.1|  PREDICTED: uncharacterized protein LOC104792...  68.9    7e-11   
gb|KJB47190.1|  hypothetical protein B456_008G014900                  67.4    7e-11   
ref|XP_002281217.1|  PREDICTED: heavy metal-associated isoprenyla...  67.4    7e-11   
gb|KIM95206.1|  hypothetical protein OIDMADRAFT_45173                 65.9    7e-11   
ref|XP_002160755.1|  PREDICTED: copper transport protein ATOX1 ho...  65.5    7e-11   
ref|XP_010517007.1|  PREDICTED: uncharacterized protein LOC104792...  68.6    7e-11   
dbj|BAJ86188.1|  predicted protein                                    67.8    7e-11   
ref|XP_010043601.1|  PREDICTED: uncharacterized protein LOC104432775  68.6    8e-11   
ref|XP_009407472.1|  PREDICTED: uncharacterized protein LOC103990145  68.2    8e-11   
ref|XP_010926254.1|  PREDICTED: heavy metal-associated isoprenyla...  67.0    8e-11   
ref|XP_001764340.1|  predicted protein                                68.6    8e-11   
ref|XP_010919019.1|  PREDICTED: heavy metal-associated isoprenyla...  67.8    8e-11   
ref|XP_010685849.1|  PREDICTED: uncharacterized protein LOC104900182  69.7    8e-11   
gb|KJB75159.1|  hypothetical protein B456_012G027800                  67.0    8e-11   
ref|XP_001656348.1|  AAEL003136-PA                                    65.5    8e-11   
ref|XP_009416114.1|  PREDICTED: uncharacterized protein LOC103996824  67.8    8e-11   
dbj|BAD95360.1|  hypothetical protein                                 67.0    8e-11   
ref|XP_009388637.1|  PREDICTED: uncharacterized protein LOC103975405  67.8    9e-11   
ref|XP_010481263.1|  PREDICTED: uncharacterized protein LOC104760111  67.4    9e-11   
ref|NP_001189699.1|  chloroplast-targeted copper chaperone protein    68.2    9e-11   
ref|XP_009394956.1|  PREDICTED: heavy metal-associated isoprenyla...  67.0    9e-11   
ref|XP_010056054.1|  PREDICTED: uncharacterized protein LOC104444141  67.4    9e-11   
ref|XP_010441398.1|  PREDICTED: uncharacterized protein LOC104724...  67.4    9e-11   
gb|KFK32967.1|  hypothetical protein AALP_AA6G312600                  67.4    1e-10   
gb|KJB08520.1|  hypothetical protein B456_001G086100                  67.4    1e-10   
ref|XP_011040654.1|  PREDICTED: copper transport protein CCH          67.0    1e-10   
ref|XP_010529871.1|  PREDICTED: uncharacterized protein LOC104806...  68.2    1e-10   
emb|CDX72102.1|  BnaC08g27720D                                        67.0    1e-10   
ref|XP_006405273.1|  hypothetical protein EUTSA_v10027957mg           67.4    1e-10   
ref|XP_010529870.1|  PREDICTED: uncharacterized protein LOC104806...  68.2    1e-10   
ref|NP_001045566.1|  Os01g0976300                                     67.4    1e-10   
emb|CDY55938.1|  BnaC02g44160D                                        66.6    1e-10   
ref|XP_008240650.1|  PREDICTED: copper transport protein ATX1         66.6    1e-10   
gb|EAY77435.1|  hypothetical protein OsI_05428                        67.4    1e-10   
gb|KJB16894.1|  hypothetical protein B456_002G253400                  67.4    1e-10   
ref|XP_002886158.1|  hypothetical protein ARALYDRAFT_319771           67.0    1e-10   
ref|XP_006410921.1|  hypothetical protein EUTSA_v10017074mg           68.2    1e-10   
gb|KJB59135.1|  hypothetical protein B456_009G240400                  66.6    1e-10   
ref|XP_007337142.1|  copper chaperone taha                            65.1    1e-10   
ref|XP_006293146.1|  hypothetical protein CARUB_v10019458mg           67.0    1e-10   
ref|XP_006687866.1|  antioxidant and copper/iron homeostasis protein  65.1    1e-10   
ref|XP_003070325.1|  Metal homeostasis factor, putative               65.1    1e-10   
ref|XP_004300701.1|  PREDICTED: uncharacterized protein LOC101305376  67.0    1e-10   
ref|XP_004973389.1|  PREDICTED: heavy metal-associated isoprenyla...  66.6    1e-10   
gb|KJB20189.1|  hypothetical protein B456_003G137300                  67.4    1e-10   
ref|XP_010509343.1|  PREDICTED: uncharacterized protein LOC104785...  68.2    1e-10   
ref|XP_002284123.1|  PREDICTED: heavy metal-associated isoprenyla...  66.6    1e-10   
ref|XP_010495020.1|  PREDICTED: uncharacterized protein LOC104772...  67.0    1e-10   
ref|XP_009125222.1|  PREDICTED: uncharacterized protein LOC103850256  67.0    1e-10   
gb|KJB20190.1|  hypothetical protein B456_003G137300                  67.4    1e-10   
ref|NP_849973.3|  putative protein NPCC11                             67.0    1e-10   
gb|AAN08440.1|  hypothetical protein                                  67.8    1e-10   
gb|KJB08519.1|  hypothetical protein B456_001G086000                  66.2    1e-10   
gb|AFK40945.1|  unknown                                               66.2    1e-10   
ref|XP_010939249.1|  PREDICTED: uncharacterized protein LOC105057867  66.6    1e-10   
ref|XP_009382227.1|  PREDICTED: uncharacterized protein LOC103970249  67.0    1e-10   
ref|XP_011038679.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    1e-10   
ref|NP_181275.2|  chloroplast-targeted copper chaperone protein       67.8    1e-10   
ref|XP_008457088.1|  PREDICTED: uncharacterized protein LOC103496852  67.0    1e-10   
ref|XP_010505321.1|  PREDICTED: uncharacterized protein LOC104782...  67.8    2e-10   
ref|XP_006402937.1|  hypothetical protein EUTSA_v10006453mg           66.2    2e-10   
ref|XP_009390577.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    2e-10   
emb|CAN63279.1|  hypothetical protein VITISV_023249                   66.6    2e-10   
ref|XP_004290860.2|  PREDICTED: heavy metal-associated isoprenyla...  66.6    2e-10   
ref|XP_010505320.1|  PREDICTED: uncharacterized protein LOC104782...  67.8    2e-10   
ref|XP_011000312.1|  PREDICTED: uncharacterized protein LOC105107917  67.8    2e-10   
ref|XP_009358309.1|  PREDICTED: uncharacterized protein LOC103948940  67.4    2e-10   
ref|XP_009409966.1|  PREDICTED: uncharacterized protein LOC103992100  66.2    2e-10   
gb|KFY20039.1|  hypothetical protein V493_07758                       65.1    2e-10   
ref|XP_011027672.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    2e-10   
ref|XP_010670695.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    2e-10   
gb|KIO13765.1|  hypothetical protein M404DRAFT_123052                 64.7    2e-10   
ref|XP_011070418.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    2e-10   
gb|KHG07179.1|  Superoxide dismutase 1 copper chaperone               66.2    2e-10   
emb|CDY27183.1|  BnaA09g36190D                                        66.2    2e-10   
ref|XP_006850635.1|  hypothetical protein AMTR_s00034p00190630        67.0    2e-10   
gb|KCW88894.1|  hypothetical protein EUGRSUZ_A01222                   67.4    2e-10   
gb|KFY84403.1|  hypothetical protein V500_09336                       65.1    2e-10   
ref|XP_009116390.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    2e-10   
ref|XP_008241646.1|  PREDICTED: uncharacterized protein DDB_G0271...  68.2    2e-10   
ref|XP_006281187.1|  hypothetical protein CARUB_v10027221mg           66.2    2e-10   
ref|XP_008790801.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    2e-10   
gb|KJB34894.1|  hypothetical protein B456_006G088900                  65.9    2e-10   
ref|XP_007205618.1|  hypothetical protein PRUPE_ppa009112mg           67.8    2e-10   
ref|XP_006429717.1|  hypothetical protein CICLE_v10013113mg           65.5    2e-10   
gb|KFY78255.1|  hypothetical protein V499_02531                       64.7    2e-10   
emb|CDP12256.1|  unnamed protein product                              66.2    2e-10   
ref|XP_010269172.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    2e-10   
gb|KFK36635.1|  hypothetical protein AALP_AA4G150600                  67.4    2e-10   
gb|KDP35575.1|  hypothetical protein JCGZ_09013                       67.4    2e-10   
ref|XP_008375456.1|  PREDICTED: heavy metal-associated isoprenyla...  66.2    2e-10   
emb|CDK26840.1|  unnamed protein product                              64.3    2e-10   
ref|XP_004505903.1|  PREDICTED: uncharacterized protein LOC101512232  66.6    2e-10   
ref|XP_001392155.1|  metal homeostasis factor ATX1                    64.3    2e-10   
ref|XP_002444313.1|  hypothetical protein SORBIDRAFT_07g020020        65.9    2e-10   
emb|CDI54876.1|  probable ATX1-antioxidant protein and metal home...  63.9    2e-10   
ref|XP_002465969.1|  hypothetical protein SORBIDRAFT_01g049160        66.2    2e-10   
ref|XP_010516293.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    3e-10   
ref|XP_006649292.1|  PREDICTED: uncharacterized protein LOC102718718  66.2    3e-10   
ref|XP_006398718.1|  hypothetical protein EUTSA_v10015743mg           67.8    3e-10   
gb|KDN69259.1|  putative heavy-metal-associated domain-containing...  64.3    3e-10   
ref|NP_001147129.1|  metal ion binding protein                        65.5    3e-10   
gb|KJB52424.1|  hypothetical protein B456_008G261300                  66.2    3e-10   
gb|EFQ31621.1|  heavy-metal-associated domain-containing protein      64.3    3e-10   
ref|XP_002534052.1|  chloroplast-targeted copper chaperone, putative  67.4    3e-10   
ref|XP_008036502.1|  copper chaperone taha                            63.9    3e-10   
gb|EFX06334.1|  iron copper transporter                               64.3    3e-10   
ref|XP_002518950.1|  metal ion binding protein, putative              65.9    3e-10   
ref|XP_008352454.1|  PREDICTED: copper transport protein ATX1         65.5    3e-10   
ref|XP_010047295.1|  PREDICTED: uncharacterized protein LOC104436265  67.4    3e-10   
ref|XP_002323431.2|  heavy-metal-associated domain-containing fam...  67.4    3e-10   
gb|EAY88311.1|  hypothetical protein OsI_09769                        65.9    3e-10   
ref|NP_001048788.1|  Os03g0120400                                     66.2    3e-10   
ref|XP_002878117.1|  hypothetical protein ARALYDRAFT_324196           65.9    3e-10   
ref|XP_009409538.1|  PREDICTED: uncharacterized protein LOC103991727  66.2    3e-10   
ref|XP_006430657.1|  hypothetical protein CICLE_v10013659mg           65.5    3e-10   
ref|XP_009390217.1|  PREDICTED: uncharacterized protein LOC103976655  67.8    3e-10   
ref|XP_010427540.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    3e-10   
ref|XP_007385615.1|  copper chaperone taha                            63.9    3e-10   
tpg|DAA49093.1|  TPA: hypothetical protein ZEAMMB73_689973            65.1    3e-10   
ref|XP_009380943.1|  PREDICTED: uncharacterized protein LOC103969198  67.8    3e-10   
ref|XP_008657976.1|  PREDICTED: uncharacterized protein LOC103637594  66.2    3e-10   
ref|XP_003657531.1|  hypothetical protein THITE_2123350               63.9    3e-10   
ref|XP_010243803.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|XP_006289860.1|  hypothetical protein CARUB_v10003472mg           67.4    4e-10   
gb|KHG20896.1|  putative cadmium-transporting ATPase                  65.9    4e-10   
dbj|GAA87577.1|  heavy metal ion transporter                          63.9    4e-10   
ref|XP_009416702.1|  PREDICTED: uncharacterized protein LOC103997259  65.9    4e-10   
gb|ABK95329.1|  unknown                                               65.1    4e-10   
gb|KFX89880.1|  hypothetical protein O988_08444                       64.3    4e-10   
gb|KHN29092.1|  hypothetical protein glysoja_008427                   65.1    4e-10   
ref|XP_009360220.1|  PREDICTED: heavy metal-associated isoprenyla...  65.9    4e-10   
ref|XP_009791012.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
gb|ACG36377.1|  metal ion binding protein                             65.1    4e-10   
ref|XP_002300522.1|  copper chaperone-related family protein          65.5    4e-10   
ref|XP_008783549.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
emb|CAB85997.1|  putative protein                                     67.4    4e-10   
ref|XP_002879666.1|  predicted protein                                66.6    4e-10   
ref|XP_004302798.1|  PREDICTED: uncharacterized protein LOC101311684  67.4    4e-10   
gb|KFX98696.1|  hypothetical protein V490_02170                       64.3    4e-10   
emb|CDP03359.1|  unnamed protein product                              65.1    4e-10   
emb|CDY38431.1|  BnaA10g17270D                                        65.1    4e-10   
tpg|DAA43000.1|  TPA: metal ion binding protein                       65.9    4e-10   
emb|CDY16919.1|  BnaC09g40460D                                        65.1    4e-10   
ref|XP_008812723.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|XP_009107517.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|NP_001148571.1|  LOC100282187                                     65.5    4e-10   
ref|XP_004237423.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|XP_010939612.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|XP_009125457.1|  PREDICTED: uncharacterized protein LOC103850453  67.0    4e-10   
ref|XP_010558674.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    4e-10   
ref|XP_010424811.1|  PREDICTED: synapsin-like                         67.4    4e-10   
gb|KHN38201.1|  hypothetical protein glysoja_003866                   64.7    4e-10   
gb|ERL88139.1|  hypothetical protein D910_05527                       63.5    4e-10   
ref|XP_011409690.1|  PREDICTED: metal homeostasis factor ATX1-like    63.5    4e-10   
ref|NP_568105.1|  heavy metal transport/detoxification domain-con...  67.4    4e-10   
gb|ENN77039.1|  hypothetical protein YQE_06467                        63.5    5e-10   
ref|XP_009389280.1|  PREDICTED: uncharacterized protein LOC103975886  65.5    5e-10   
gb|AFK40125.1|  unknown                                               65.1    5e-10   
ref|XP_006818931.1|  PREDICTED: copper transport protein ATOX1-like   63.5    5e-10   
ref|XP_002873063.1|  heavy-metal-associated domain-containing pro...  67.0    5e-10   
ref|XP_010554914.1|  PREDICTED: uncharacterized protein LOC104824508  66.6    5e-10   
gb|KJB16895.1|  hypothetical protein B456_002G253400                  65.5    5e-10   
gb|KEH42337.1|  copper chaperone                                      66.2    5e-10   
emb|CDY04859.1|  BnaAnng00410D                                        67.0    5e-10   
gb|EAY96576.1|  hypothetical protein OsI_18480                        67.4    5e-10   
emb|CDX91358.1|  BnaC04g07920D                                        66.2    5e-10   
dbj|BAJ92645.1|  predicted protein                                    67.0    5e-10   
ref|XP_010096770.1|  hypothetical protein L484_025888                 64.7    5e-10   
ref|XP_008437470.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    5e-10   
gb|KDP37922.1|  hypothetical protein JCGZ_05361                       65.1    5e-10   
gb|ACJ86072.1|  unknown                                               64.7    5e-10   
emb|CCF50723.1|  probable ATX1-antioxidant protein and metal home...  63.2    5e-10   
ref|XP_010490722.1|  PREDICTED: synapsin isoform X1                   67.0    5e-10   
emb|CDM84695.1|  unnamed protein product                              64.7    5e-10   
ref|XP_009608957.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    5e-10   
ref|XP_009409202.1|  PREDICTED: uncharacterized protein LOC103991453  67.4    5e-10   
ref|XP_010105872.1|  hypothetical protein L484_021527                 64.7    6e-10   
ref|XP_010504600.1|  PREDICTED: heavy metal-associated isoprenyla...  65.1    6e-10   
gb|EGU75424.1|  hypothetical protein FOXB_14049                       63.2    6e-10   
ref|XP_010452106.1|  PREDICTED: synapsin-like                         67.0    6e-10   
emb|CCF32045.1|  heavy-metal-associated domain-containing protein     63.2    6e-10   
ref|XP_010490723.1|  PREDICTED: synapsin isoform X2                   67.0    6e-10   
gb|EMT06328.1|  hypothetical protein F775_10794                       64.7    6e-10   
emb|CDX74966.1|  BnaA05g07120D                                        66.2    6e-10   
gb|EYU41326.1|  hypothetical protein MIMGU_mgv11b015499mg             65.5    6e-10   
gb|AFK43755.1|  unknown                                               64.7    6e-10   
ref|XP_003630071.1|  hypothetical protein MTR_8g091420                64.7    6e-10   
ref|XP_010934168.1|  PREDICTED: uncharacterized protein LOC105054379  66.2    6e-10   
ref|XP_004144820.1|  PREDICTED: uncharacterized protein LOC101221234  65.5    6e-10   
ref|XP_003531366.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    6e-10   
gb|EEC75375.1|  hypothetical protein OsI_11838                        64.7    6e-10   
gb|EPQ62839.1|  Cytosolic copper metallochaperone                     63.2    7e-10   
ref|XP_010905918.1|  PREDICTED: heavy metal-associated isoprenyla...  64.3    7e-10   
ref|XP_009139065.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    7e-10   
ref|XP_003536166.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    7e-10   
ref|XP_004981265.1|  PREDICTED: uncharacterized protein LOC101769589  65.1    7e-10   
gb|EMD38385.1|  hypothetical protein CERSUDRAFT_48050                 63.9    7e-10   
gb|KIL89907.1|  metal homeostasis factor atx1                         63.2    7e-10   
ref|NP_001238649.1|  uncharacterized protein LOC100500473             64.3    7e-10   
ref|XP_006579369.1|  PREDICTED: uncharacterized protein LOC100500...  64.3    7e-10   
ref|XP_007835854.1|  Metal homeostasis factor atx1                    63.2    7e-10   
gb|KEH42924.1|  heavy metal transport/detoxification superfamily ...  64.7    7e-10   
ref|XP_010907504.1|  PREDICTED: uncharacterized protein LOC105034152  67.4    7e-10   
ref|XP_006448292.1|  hypothetical protein CICLE_v10017849mg           64.3    7e-10   
ref|XP_009139061.1|  PREDICTED: heavy metal-associated isoprenyla...  64.7    7e-10   



>ref|NP_001238096.1| uncharacterized protein LOC100305622 [Glycine max]
 gb|ACU13402.1| unknown [Glycine max]
 gb|KHN19152.1| Copper transport protein ATOX1 [Glycine soja]
Length=130

 Score =   127 bits (318),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 79/146 (54%), Positives = 91/146 (62%), Gaps = 25/146 (17%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKVGMSCQGC GAV RVL KMEGVESFDI+++EQKVTVKGNVQPDEVLQ V+K
Sbjct  1    MSSQTVVLKVGMSCQGCAGAVNRVLEKMEGVESFDIDLKEQKVTVKGNVQPDEVLQAVSK  60

Query  240  TGKKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPPAQAVEEPPKQPESGPLAQ  419
            +GKKT FW  EA                  + P  +P    P  + E   K  ESGP+A 
Sbjct  61   SGKKTAFWVDEA------------------QPPENKPSETAPVTSAENDNKASESGPVAS  102

Query  420  PSAEP------PAQPKPEPS-TAVAT  476
             +  P       A P+ +PS TAV T
Sbjct  103  ENKPPEAAHVASADPETKPSETAVET  128



>ref|NP_001238516.1| copper chaperone homolog CCH [Glycine max]
 gb|AAF15286.1|AF198627_1 copper chaperone homolog CCH [Glycine max]
Length=130

 Score =   125 bits (313),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKVGMSCQGC GA+ RVLGKMEGVESFDI+++EQKVTVKGNV+PDEVLQ V+K
Sbjct  1    MSSQTVVLKVGMSCQGCAGAMNRVLGKMEGVESFDIDLKEQKVTVKGNVEPDEVLQAVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTAFW  68



>gb|KJB75018.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=114

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>gb|KHG07070.1| Copper transport protein ATOX1 [Gossypium arboreum]
Length=114

 Score =   124 bits (311),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_007145544.1| hypothetical protein PHAVU_007G247500g [Phaseolus vulgaris]
 gb|ESW17538.1| hypothetical protein PHAVU_007G247500g [Phaseolus vulgaris]
Length=128

 Score =   124 bits (312),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKVGMSCQGC GAV RVLGK+EGVESFDI+++EQKVTVKGN+QPDEVLQ V+K
Sbjct  1    MSSQTVVLKVGMSCQGCAGAVNRVLGKLEGVESFDIDLKEQKVTVKGNLQPDEVLQAVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTAFW  68



>ref|XP_002443602.1| hypothetical protein SORBIDRAFT_08g022260 [Sorghum bicolor]
 gb|EES17440.1| hypothetical protein SORBIDRAFT_08g022260 [Sorghum bicolor]
Length=87

 Score =   123 bits (308),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 59/68 (87%), Positives = 65/68 (96%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M++QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNV PD VLQTV+K
Sbjct  1    MAAQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTEFW  68



>gb|ACU18996.1| unknown [Glycine max]
Length=130

 Score =   124 bits (311),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 57/68 (84%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKVGMSCQGC GAV RVLGKMEGVESFDI+++EQKVTVKGNV+ DEVLQ V+K
Sbjct  1    MSSQTVVLKVGMSCQGCAGAVNRVLGKMEGVESFDIDLKEQKVTVKGNVESDEVLQAVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTAFW  68



>ref|XP_009628520.1| PREDICTED: copper transport protein CCH-like isoform X1 [Nicotiana 
tomentosiformis]
Length=117

 Score =   124 bits (310),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 76/129 (59%), Positives = 90/129 (70%), Gaps = 18/129 (14%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS QTVVLKVGMSCQGCVGAV RVLGKMEGVES+DI+I+EQKVTVKGNV+P+ V QTV+K
Sbjct  1    MSQQTVVLKVGMSCQGCVGAVNRVLGKMEGVESYDIDIKEQKVTVKGNVEPEAVFQTVSK  60

Query  240  TGKKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGP-PAQAVEEPPKQPESGPLA  416
            TGKKT FWE+EAP P                  P +PE+ P  A+  EE P    + P A
Sbjct  61   TGKKTSFWEAEAPAPA-----------------PTEPETKPVEAKPTEEKPADTAAEPEA  103

Query  417  QPSAEPPAQ  443
            +P+ E PA+
Sbjct  104  KPADEKPAE  112



>gb|KJB75015.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=121

 Score =   123 bits (309),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>gb|KJB75017.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=114

 Score =   123 bits (308),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|NP_564870.1| copper transport protein ATX1 [Arabidopsis thaliana]
 sp|Q94BT9.1|ATOX1_ARATH RecName: Full=Copper transport protein ATX1; AltName: Full=Copper 
chaperone ATX1 [Arabidopsis thaliana]
 gb|AAK64002.1| At1g66240/T6J19_6 [Arabidopsis thaliana]
 gb|AAL76156.1| At1g66240/T6J19_6 [Arabidopsis thaliana]
 gb|AEE34481.1| homolog of anti-oxidant 1 [Arabidopsis thaliana]
Length=106

 Score =   122 bits (307),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTVTKTG
Sbjct  32   SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTG  91

Query  246  KKT*FW  263
            KKT FW
Sbjct  92   KKTAFW  97



>ref|XP_002315448.2| hypothetical protein POPTR_0010s24290g [Populus trichocarpa]
 gb|AAT12488.1| copper chaperone [Populus alba x Populus glandulosa]
 gb|ABK94121.1| unknown [Populus trichocarpa]
 gb|ABK94400.1| unknown [Populus trichocarpa]
 gb|ABK95792.1| unknown [Populus trichocarpa]
 gb|ABK96218.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|ABK96571.1| unknown [Populus trichocarpa x Populus deltoides]
 gb|EEF01619.2| hypothetical protein POPTR_0010s24290g [Populus trichocarpa]
 gb|AIY32627.1| ATX2 [Populus simonii x Populus nigra]
Length=85

 Score =   122 bits (305),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKMEGVES+DI+++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMEGVESYDIDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_008783994.1| PREDICTED: copper transport protein ATX1 [Phoenix dactylifera]
Length=89

 Score =   122 bits (305),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVLKVGMSCQGCVGAVKRVLGKMEGVESFD+N+EEQKVTVKGNV+PD VLQTV+KTG
Sbjct  2    AETVVLKVGMSCQGCVGAVKRVLGKMEGVESFDVNLEEQKVTVKGNVKPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_009800094.1| PREDICTED: copper transport protein CCH isoform X1 [Nicotiana 
sylvestris]
Length=117

 Score =   122 bits (306),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 74/129 (57%), Positives = 88/129 (68%), Gaps = 18/129 (14%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS QTVVLKVGMSCQGCVGAV RVLGKMEGVES+DI+I+EQKVTVKGNV+P+ V QTV+K
Sbjct  1    MSQQTVVLKVGMSCQGCVGAVNRVLGKMEGVESYDIDIKEQKVTVKGNVEPEAVFQTVSK  60

Query  240  TGKKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPP-AQAVEEPPKQPESGPLA  416
            TGKKT FWE+EA  P                  P +PE+ P   +  EE P    + P A
Sbjct  61   TGKKTSFWEAEATTPA-----------------PAEPETKPAEVKPTEEKPADTPAEPEA  103

Query  417  QPSAEPPAQ  443
            +P+ E PA+
Sbjct  104  KPADEKPAE  112



>gb|ACV50430.1| copper chaperone [Jatropha curcas]
Length=93

 Score =   121 bits (303),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+DI+++EQKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYDIDLQEQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTEFW  67



>ref|XP_009628580.1| PREDICTED: copper transport protein CCH-like isoform X2 [Nicotiana 
tomentosiformis]
Length=116

 Score =   122 bits (305),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 89/127 (70%), Gaps = 18/127 (14%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVES+DI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESYDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGP-PAQAVEEPPKQPESGPLAQP  422
            KKT FWE+EAP P                  P +PE+ P  A+  EE P    + P A+P
Sbjct  62   KKTSFWEAEAPAPA-----------------PTEPETKPVEAKPTEEKPADTAAEPEAKP  104

Query  423  SAEPPAQ  443
            + E PA+
Sbjct  105  ADEKPAE  111



>ref|XP_006432301.1| hypothetical protein CICLE_v10002981mg [Citrus clementina]
 gb|ESR45541.1| hypothetical protein CICLE_v10002981mg [Citrus clementina]
 gb|KDO36997.1| hypothetical protein CISIN_1g034633mg [Citrus sinensis]
Length=88

 Score =   120 bits (301),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_011024240.1| PREDICTED: copper transport protein ATX1-like [Populus euphratica]
Length=85

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKMEGVES+DI+++EQKVTV GNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMEGVESYDIDLKEQKVTVNGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_010552928.1| PREDICTED: copper transport protein ATX1 [Tarenaya hassleriana]
Length=75

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV MSC+GCVGAVKRVLGKMEGVESFDI+++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVAMSCEGCVGAVKRVLGKMEGVESFDIDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_002264332.1| PREDICTED: copper transport protein CCH [Vitis vinifera]
 emb|CBI40250.3| unnamed protein product [Vitis vinifera]
Length=86

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSC+GCVGAVKRVLGKMEGVESFDI+++EQKVTVKGNVQPD VL+TV+KTG
Sbjct  2    AQTVVLKVGMSCEGCVGAVKRVLGKMEGVESFDIDLKEQKVTVKGNVQPDAVLKTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>gb|KFK34866.1| hypothetical protein AALP_AA5G203500 [Arabis alpina]
Length=122

 Score =   121 bits (304),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 72/130 (55%), Positives = 86/130 (66%), Gaps = 20/130 (15%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPPAQAVEEPPKQ-PESGPLAQP  422
            KKT +W                     +E  PK PE+ P A+AV E   +  E+   A+ 
Sbjct  62   KKTAYW------------------PSEVEAEPK-PEAEPKAEAVTETKTEAAETKTEAKV  102

Query  423  SAEPPAQPKP  452
             A+   +PKP
Sbjct  103  DAKAEVEPKP  112



>gb|KJB75016.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=107

 Score =   120 bits (302),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 66/99 (67%), Positives = 77/99 (78%), Gaps = 0/99 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGP  362
            KKT FWE+EA         E+       E  P +PE+ P
Sbjct  62   KKTAFWEAEALAETEAKPAETEVKPAETEAKPTEPEAKP  100



>ref|XP_002311033.2| hypothetical protein POPTR_0008s02430g [Populus trichocarpa]
 gb|ABK92578.1| unknown [Populus trichocarpa]
 gb|EEE88400.2| hypothetical protein POPTR_0008s02430g [Populus trichocarpa]
 gb|AIY32626.1| ATX1 [Populus simonii x Populus nigra]
Length=84

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC GCVGAVKRVLGKMEGVES+DI+++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCGGCVGAVKRVLGKMEGVESYDIDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_006407536.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
 gb|ESQ48989.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
Length=76

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V MSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KK+ FW
Sbjct  62   KKSAFW  67



>ref|XP_002888491.1| hypothetical protein ARALYDRAFT_475728 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64750.1| hypothetical protein ARALYDRAFT_475728 [Arabidopsis lyrata subsp. 
lyrata]
Length=75

 Score =   120 bits (300),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTVTKTG
Sbjct  2    SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_006491863.1| PREDICTED: copper transport protein ATX1-like [Citrus sinensis]
Length=88

 Score =   120 bits (301),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQT++KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTISKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_010242607.1| PREDICTED: copper transport protein CCH-like [Nelumbo nucifera]
Length=90

 Score =   120 bits (301),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 58/66 (88%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSC+GCVGAVKRVLGKMEGVESFDI ++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    AQTVVLKVGMSCEGCVGAVKRVLGKMEGVESFDIYLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>emb|CAH59420.1| copper chaperone [Plantago major]
Length=109

 Score =   120 bits (301),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 75/138 (54%), Positives = 88/138 (64%), Gaps = 30/138 (22%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV LKVGMSCQGCVGAVKRVLGKMEGVESFDI+IE+QKVTVKGNV+ + VLQTV+KTG
Sbjct  2    SQTVELKVGMSCQGCVGAVKRVLGKMEGVESFDIDIEKQKVTVKGNVEKEAVLQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPPAQAVEEPPKQPESGPLAQPS  425
            KKT FW                        P +  E  P A+  E P   PE    A+P+
Sbjct  62   KKTEFW------------------------PEEAAE--PEAKITEAPAPVPE----AKPT  91

Query  426  AEPPAQPKPEPSTAVATA  479
              P A+P+ +P+ AV TA
Sbjct  92   EAPAAEPESKPTEAVVTA  109



>emb|CDY00957.1| BnaC05g42430D [Brassica napus]
Length=76

 Score =   119 bits (299),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V MSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KK+ FW
Sbjct  62   KKSAFW  67



>gb|KDO36992.1| hypothetical protein CISIN_1g033693mg [Citrus sinensis]
Length=113

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_009800096.1| PREDICTED: copper transport protein CCH isoform X2 [Nicotiana 
sylvestris]
Length=116

 Score =   120 bits (301),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 73/127 (57%), Positives = 87/127 (69%), Gaps = 18/127 (14%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVES+DI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESYDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPP-AQAVEEPPKQPESGPLAQP  422
            KKT FWE+EA  P                  P +PE+ P   +  EE P    + P A+P
Sbjct  62   KKTSFWEAEATTPA-----------------PAEPETKPAEVKPTEEKPADTPAEPEAKP  104

Query  423  SAEPPAQ  443
            + E PA+
Sbjct  105  ADEKPAE  111



>ref|XP_009146823.1| PREDICTED: copper transport protein ATX1 [Brassica rapa]
 emb|CDY08589.1| BnaA05g28250D [Brassica napus]
Length=76

 Score =   119 bits (298),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V MSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KK+ FW
Sbjct  62   KKSAFW  67



>ref|XP_010511552.1| PREDICTED: copper transport protein ATX1 [Camelina sativa]
 ref|XP_010415166.1| PREDICTED: copper transport protein ATX1 isoform X1 [Camelina 
sativa]
Length=76

 Score =   119 bits (297),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>gb|ADD69807.1| copper transport protein ATOX1 [Hevea brasiliensis]
Length=86

 Score =   119 bits (298),  Expect = 9e-31, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKMEGVES+DI+++EQKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMEGVESYDIDLKEQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|NP_001149242.1| copper chaperone [Zea mays]
 gb|ACG26800.1| copper chaperone [Zea mays]
 gb|ACG28110.1| copper chaperone [Zea mays]
 gb|ACG34693.1| copper chaperone [Zea mays]
 gb|ACR35516.1| unknown [Zea mays]
 tpg|DAA47616.1| TPA: hypothetical protein ZEAMMB73_968377 [Zea mays]
Length=84

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSC+GCVGAVKRVLGKMEGVES+D++I EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    AQTVVLKVGMSCEGCVGAVKRVLGKMEGVESYDVDIMEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>gb|KFK38450.1| hypothetical protein AALP_AA3G114900 [Arabis alpina]
Length=77

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KK+ FW
Sbjct  62   KKSAFW  67



>ref|XP_009116322.1| PREDICTED: copper transport protein CCH [Brassica rapa]
Length=106

 Score =   119 bits (298),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>emb|CDO99889.1| unnamed protein product [Coffea canephora]
Length=86

 Score =   119 bits (297),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVL KMEGVESFDI+++EQKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLSKMEGVESFDIDLKEQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_006303016.1| hypothetical protein CARUB_v10021172mg, partial [Capsella rubella]
 gb|EOA35914.1| hypothetical protein CARUB_v10021172mg, partial [Capsella rubella]
Length=114

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTG
Sbjct  41   SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTG  100

Query  246  KKT*FW  263
            KKT FW
Sbjct  101  KKTAFW  106



>gb|KJB75019.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=115

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_010470498.1| PREDICTED: copper transport protein ATX1-like [Camelina sativa]
Length=76

 Score =   118 bits (296),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL+V M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTV+GNVQPD VLQTV+KTG
Sbjct  2    SQTVVLRVAMTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVRGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_009103992.1| PREDICTED: copper transport protein CCH [Brassica rapa]
Length=127

 Score =   119 bits (299),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQ+VTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQRVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|XP_006291912.1| hypothetical protein CARUB_v10018096mg, partial [Capsella rubella]
 gb|EOA24810.1| hypothetical protein CARUB_v10018096mg, partial [Capsella rubella]
Length=181

 Score =   121 bits (303),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/70 (81%), Positives = 64/70 (91%), Gaps = 0/70 (0%)
 Frame = +3

Query  54   LTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTV  233
            L + +QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV
Sbjct  62   LVIMTQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTV  121

Query  234  TKTGKKT*FW  263
            +KTGKKT FW
Sbjct  122  SKTGKKTSFW  131



>ref|XP_010067150.1| PREDICTED: copper transport protein CCH-like [Eucalyptus grandis]
 gb|KCW65216.1| hypothetical protein EUGRSUZ_G02703 [Eucalyptus grandis]
 gb|KCW65217.1| hypothetical protein EUGRSUZ_G02703 [Eucalyptus grandis]
Length=86

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSC+GCVGAVKRVLGKMEGVESFDI+++EQKVTVKGNVQP+ VL+TV+KTG
Sbjct  2    AQTVVLKVGMSCEGCVGAVKRVLGKMEGVESFDIDLKEQKVTVKGNVQPNAVLKTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_011032831.1| PREDICTED: copper transport protein CCH [Populus euphratica]
Length=85

 Score =   118 bits (296),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC GCVGAVKRVLGKMEGVES+DI+++EQ VTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCGGCVGAVKRVLGKMEGVESYDIDLKEQTVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>gb|KHN37836.1| Copper transport protein ATOX1 [Glycine soja]
Length=81

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGK++GVES+DI+++EQKV VKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVQPDTVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_002878075.1| hypothetical protein ARALYDRAFT_486064 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH54334.1| hypothetical protein ARALYDRAFT_486064 [Arabidopsis lyrata subsp. 
lyrata]
Length=121

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 67/130 (52%), Positives = 84/130 (65%), Gaps = 23/130 (18%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    AQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FWeseappppppaqpesvpsaqaLEEPPKQPESG--PPAQAVEEPPKQPESGPLAQ  419
            KKT +W                       +   +P++G  P A+AV E   + E+   A+
Sbjct  62   KKTSYWPV---------------------DAETEPKAGAEPKAEAVTETKTEAETKTEAK  100

Query  420  PSAEPPAQPK  449
              A+   +PK
Sbjct  101  VDAKADVEPK  110



>gb|AIL49299.1| copper chaperone [Capsicum annuum]
Length=109

 Score =   119 bits (297),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_002533872.1| copper transport protein atox1, putative [Ricinus communis]
 gb|EEF28512.1| copper transport protein atox1, putative [Ricinus communis]
Length=86

 Score =   118 bits (295),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GC GAV+RVLGKMEGVES+DI+++EQKVTVKGNVQPD V QTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCAGAVRRVLGKMEGVESYDIDMKEQKVTVKGNVQPDAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_003536318.1| PREDICTED: copper transport protein ATX1-like [Glycine max]
Length=81

 Score =   117 bits (294),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGK++GVES+DI+++EQKV VKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVQPDTVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_010912255.1| PREDICTED: copper transport protein ATX1-like isoform X2 [Elaeis 
guineensis]
Length=129

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/72 (76%), Positives = 65/72 (90%), Gaps = 0/72 (0%)
 Frame = +3

Query  48   QFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQ  227
            + +   ++TVVL+VGMSCQGCVGAVKRVLGKMEGVESFD++++EQKVTVKGNV PD VLQ
Sbjct  26   RLIYAMAETVVLRVGMSCQGCVGAVKRVLGKMEGVESFDVDLKEQKVTVKGNVTPDAVLQ  85

Query  228  TVTKTGKKT*FW  263
            TV+KTGKKT FW
Sbjct  86   TVSKTGKKTSFW  97



>emb|CDY32007.1| BnaC06g15850D [Brassica napus]
Length=185

 Score =   120 bits (302),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/71 (77%), Positives = 64/71 (90%), Gaps = 0/71 (0%)
 Frame = +3

Query  51   FLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQT  230
            ++   SQTVVLKVGMSCQGCVGAV RVLGKM+GVESFDI+I+EQKVTVKGNV+P+ V QT
Sbjct  55   YIVAMSQTVVLKVGMSCQGCVGAVNRVLGKMDGVESFDIDIKEQKVTVKGNVEPEAVFQT  114

Query  231  VTKTGKKT*FW  263
            V+KTGKKT +W
Sbjct  115  VSKTGKKTSYW  125



>gb|KDP45000.1| hypothetical protein JCGZ_01500 [Jatropha curcas]
Length=115

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/65 (86%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
             TVVLKVGMSCQGCVGAVKRVLGKMEGVES+DI+++EQKVTVKGNVQP+ VLQTV+KTGK
Sbjct  25   HTVVLKVGMSCQGCVGAVKRVLGKMEGVESYDIDLQEQKVTVKGNVQPEAVLQTVSKTGK  84

Query  249  KT*FW  263
            KT FW
Sbjct  85   KTEFW  89



>ref|XP_010504524.1| PREDICTED: copper transport protein CCH-like [Camelina sativa]
Length=117

 Score =   118 bits (296),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    AQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>emb|CDX67640.1| BnaA07g16800D [Brassica napus]
Length=126

 Score =   119 bits (297),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTGK
Sbjct  2    QTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGK  61

Query  249  KT*FW  263
            KT +W
Sbjct  62   KTSYW  66



>dbj|BAJ34280.1| unnamed protein product [Thellungiella halophila]
Length=117

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|XP_006436645.1| hypothetical protein CICLE_v10033197mg [Citrus clementina]
 ref|XP_006492199.1| PREDICTED: copper transport protein ATX1-like [Citrus sinensis]
 gb|ABL67657.1| putative copper chaperone [Citrus hybrid cultivar]
 gb|ESR49885.1| hypothetical protein CICLE_v10033197mg [Citrus clementina]
 gb|KDO42138.1| hypothetical protein CISIN_1g034639mg [Citrus sinensis]
Length=88

 Score =   117 bits (293),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQP  VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPGAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>dbj|BAJ92563.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=114

 Score =   118 bits (295),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV L+VGMSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  37   SQTVELRVGMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG  96

Query  246  KKT*FW  263
            KKT FW
Sbjct  97   KKTSFW  102



>ref|XP_009619825.1| PREDICTED: copper transport protein ATX1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=86

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVE+FDI+++EQKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVENFDIDLKEQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KPTSFW  67



>ref|NP_191183.1| copper chaperone [Arabidopsis thaliana]
 sp|O82089.1|CCH_ARATH RecName: Full=Copper transport protein CCH; AltName: Full=Copper 
chaperone CCH [Arabidopsis thaliana]
 gb|AAK32872.1|AF361860_1 AT3g56240/F18O21_200 [Arabidopsis thaliana]
 gb|AAC33510.1| copper homeostasis factor [Arabidopsis thaliana]
 emb|CAB87423.1| copper homeostasis factor [Arabidopsis thaliana]
 gb|AAL47423.1| AT3g56240/F18O21_200 [Arabidopsis thaliana]
 gb|AAM62878.1| copper homeostasis factor [Arabidopsis thaliana]
 gb|AEE79500.1| copper chaperone [Arabidopsis thaliana]
Length=121

 Score =   118 bits (295),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    AQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|NP_001234347.1| copper chaperone [Solanum lycopersicum]
 ref|XP_006345865.1| PREDICTED: copper transport protein ATX1-like [Solanum tuberosum]
 gb|AAP06757.1| copper chaperone [Solanum lycopersicum]
 gb|ACB32235.1| copper chaperone [Solanum chacoense]
Length=81

 Score =   117 bits (292),  Expect = 5e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKMEGVE+FDI+++EQKVTVKGNVQPD VL+TV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMEGVETFDIDLKEQKVTVKGNVQPDAVLKTVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KPTSFW  67



>emb|CDY71670.1| BnaAnng38380D [Brassica napus]
Length=105

 Score =   117 bits (294),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTGK
Sbjct  2    QTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGK  61

Query  249  KT*FW  263
            KT +W
Sbjct  62   KTSYW  66



>ref|XP_007010241.1| Anti-oxidant 1 [Theobroma cacao]
 gb|EOY19051.1| Anti-oxidant 1 [Theobroma cacao]
Length=86

 Score =   117 bits (292),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV LKVGMSC+GCVGAVKRVLGKMEGVES++++++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVFLKVGMSCEGCVGAVKRVLGKMEGVESYEVDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_006851536.1| hypothetical protein AMTR_s00040p00173680 [Amborella trichopoda]
 gb|ERN13117.1| hypothetical protein AMTR_s00040p00173680 [Amborella trichopoda]
Length=78

 Score =   116 bits (291),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/64 (88%), Positives = 61/64 (95%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TVVLKVGMSC+GCVGAVKRVL KMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTGKK
Sbjct  4    TVVLKVGMSCEGCVGAVKRVLTKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTGKK  63

Query  252  T*FW  263
            T FW
Sbjct  64   TSFW  67



>dbj|BAJ88616.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=130

 Score =   118 bits (295),  Expect = 7e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV L+VGMSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  53   SQTVELRVGMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG  112

Query  246  KKT*FW  263
            KKT FW
Sbjct  113  KKTSFW  118



>ref|XP_009781186.1| PREDICTED: copper transport protein ATX1 isoform X1 [Nicotiana 
sylvestris]
Length=86

 Score =   116 bits (291),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 57/66 (86%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGKMEGVE+FDI+++EQKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKMEGVENFDIDLKEQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KPTSFW  67



>ref|XP_006361447.1| PREDICTED: copper transport protein CCH-like [Solanum tuberosum]
Length=106

 Score =   117 bits (293),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTV GNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVNGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|NP_001061234.1| Os08g0205400 [Oryza sativa Japonica Group]
 dbj|BAD05334.1| putative copper chaperone [Oryza sativa Japonica Group]
 dbj|BAD11546.1| putative copper chaperone [Oryza sativa Japonica Group]
 dbj|BAF23148.1| Os08g0205400 [Oryza sativa Japonica Group]
 gb|EAZ05973.1| hypothetical protein OsI_28214 [Oryza sativa Indica Group]
 gb|EAZ05976.1| hypothetical protein OsI_28217 [Oryza sativa Indica Group]
 gb|EAZ41860.1| hypothetical protein OsJ_26405 [Oryza sativa Japonica Group]
 dbj|BAH01657.1| unnamed protein product [Oryza sativa Japonica Group]
Length=81

 Score =   116 bits (290),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVL+VGMSC+GCVGAVKRVLGKM+GVESFD++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    AETVVLRVGMSCEGCVGAVKRVLGKMQGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_003556271.1| PREDICTED: copper transport protein ATX1 [Glycine max]
 gb|ACU14576.1| unknown [Glycine max]
Length=81

 Score =   116 bits (290),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGK++GVES+DI+++EQKV VKGNVQPD VL TV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVQPDTVLATVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_004979205.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Setaria italica]
Length=79

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVL+VGMSC+GCVGAVKRVLGKMEGVES++++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    AQTVVLRVGMSCEGCVGAVKRVLGKMEGVESYEVDIKEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>emb|CDX72154.1| BnaC08g27200D [Brassica napus]
Length=105

 Score =   116 bits (291),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/65 (85%), Positives = 62/65 (95%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V+QTV+KTGK
Sbjct  2    QTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVIQTVSKTGK  61

Query  249  KT*FW  263
            KT +W
Sbjct  62   KTSYW  66



>gb|ACG30983.1| copper chaperone [Zea mays]
Length=84

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSC+GCVGAVK VLGKMEGVES+D++I EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    AQTVVLKVGMSCEGCVGAVKXVLGKMEGVESYDVDIMEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_010427431.1| PREDICTED: copper transport protein CCH isoform X2 [Camelina 
sativa]
 ref|XP_010427443.1| PREDICTED: copper transport protein CCH isoform X2 [Camelina 
sativa]
Length=79

 Score =   115 bits (289),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTG
Sbjct  2    AQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_006431955.1| hypothetical protein CICLE_v10002978mg [Citrus clementina]
 gb|ESR45195.1| hypothetical protein CICLE_v10002978mg [Citrus clementina]
 gb|KDO39569.1| hypothetical protein CISIN_1g043507mg [Citrus sinensis]
Length=88

 Score =   115 bits (289),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV MSC+GC GAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQTV+K G
Sbjct  2    SQTVVLKVDMSCEGCYGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKAG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>gb|KJB11925.1| hypothetical protein B456_002G145400 [Gossypium raimondii]
Length=69

 Score =   115 bits (287),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGKMEGVES++++++EQKVTVKG VQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKMEGVESYEVDLKEQKVTVKGQVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_010912254.1| PREDICTED: copper transport protein ATX1-like isoform X1 [Elaeis 
guineensis]
Length=142

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/66 (85%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            S TVVL+VGMSCQGCVGAVKRVLGKMEGVESFD++++EQKVTVKGNV PD VLQTV+KTG
Sbjct  45   SGTVVLRVGMSCQGCVGAVKRVLGKMEGVESFDVDLKEQKVTVKGNVTPDAVLQTVSKTG  104

Query  246  KKT*FW  263
            KKT FW
Sbjct  105  KKTSFW  110



>ref|XP_006468127.1| PREDICTED: copper transport protein ATX1-like [Citrus sinensis]
Length=88

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV MSC+GC GAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQTV+K G
Sbjct  2    SQTVVLKVDMSCEGCYGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKAG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_006659209.1| PREDICTED: copper transport protein ATX1-like [Oryza brachyantha]
Length=84

 Score =   115 bits (288),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVL+VGMSC+GCVGAVKRVLGKM+GVESFD++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    AETVVLRVGMSCEGCVGAVKRVLGKMQGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTEFW  67



>gb|KHG03721.1| superoxide dismutase 1 copper chaperone [Gossypium arboreum]
Length=82

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+ CVGAVKRVLGKM+GVES++++++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCESCVGAVKRVLGKMQGVESYEVDLKEQKVTVKGNVQPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_004249983.1| PREDICTED: copper transport protein CCH-like [Solanum lycopersicum]
Length=113

 Score =   115 bits (289),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTV GNV+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVIGNVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|XP_006647337.1| PREDICTED: copper transport protein CCH-like [Oryza brachyantha]
Length=119

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+++TVVLKVGMSCQGC GAVKRVL KMEGVE+FDI++E+QKVTVKGNV+P++V QTV+K
Sbjct  1    MAAETVVLKVGMSCQGCAGAVKRVLTKMEGVETFDIDLEQQKVTVKGNVKPEDVFQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTSFW  68



>gb|AFK43760.1| unknown [Lotus japonicus]
Length=136

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKV MSCQGC GAV RVL KMEGVESF+I+++EQKVTVKGNV+P++VL+TV+K
Sbjct  1    MSSQTVVLKVRMSCQGCAGAVNRVLEKMEGVESFNIDLKEQKVTVKGNVKPEDVLETVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTAFW  68



>gb|AFK35185.1| unknown [Lotus japonicus]
Length=136

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTVVLKV MSCQGC GAV RVL KMEGVESF+I+++EQKVTVKGNV+P++VL+TV+K
Sbjct  1    MSSQTVVLKVRMSCQGCAGAVNRVLEKMEGVESFNIDLKEQKVTVKGNVKPEDVLETVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTAFW  68



>ref|XP_003563850.1| PREDICTED: copper transport protein ATX1-like [Brachypodium distachyon]
Length=83

 Score =   115 bits (287),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQT+ L+VGMSC+GCVGAVKRVL KMEGVESFD++I+EQKVTVKGNV PD VLQTV+KTG
Sbjct  2    SQTIELRVGMSCEGCVGAVKRVLSKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTAFW  67



>ref|XP_010516231.1| PREDICTED: copper transport protein CCH-like isoform X2 [Camelina 
sativa]
Length=117

 Score =   115 bits (289),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 55/64 (86%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKGNV+P+ V QTV+KTGKK
Sbjct  4    TVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKTGKK  63

Query  252  T*FW  263
            T FW
Sbjct  64   TSFW  67



>ref|XP_010088759.1| Copper transport protein ATOX1 [Morus notabilis]
 gb|EXB36942.1| Copper transport protein ATOX1 [Morus notabilis]
Length=106

 Score =   115 bits (287),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAVKRVLGK+EGVES+DI+IE+QKVTVKG+V P+ VLQTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDIEQQKVTVKGSVPPETVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTAYW  67



>ref|XP_010907148.1| PREDICTED: copper transport protein ATX1-like [Elaeis guineensis]
Length=87

 Score =   114 bits (286),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVL+VGM+C+GCVGAVKRVLG+MEGVESFD++++EQKVTVKGNV+PD VLQTV+KTG
Sbjct  2    AETVVLRVGMTCEGCVGAVKRVLGRMEGVESFDVDLQEQKVTVKGNVKPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|NP_001173001.1| Os02g0530100 [Oryza sativa Japonica Group]
 dbj|BAD73816.1| putative copper chaperone [Oryza sativa Japonica Group]
 dbj|BAG86720.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH91730.1| Os02g0530100 [Oryza sativa Japonica Group]
Length=252

 Score =   119 bits (298),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 53/72 (74%), Positives = 67/72 (93%), Gaps = 0/72 (0%)
 Frame = +3

Query  48   QFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQ  227
            +FL ++++TVVLKVGMSCQGC GAV+RVL KMEGVE+FDI++E+QKVTVKGNV+P++V Q
Sbjct  117  RFLHVTTKTVVLKVGMSCQGCAGAVRRVLTKMEGVETFDIDMEQQKVTVKGNVKPEDVFQ  176

Query  228  TVTKTGKKT*FW  263
            TV+KTGKKT FW
Sbjct  177  TVSKTGKKTSFW  188



>ref|XP_011076928.1| PREDICTED: copper transport protein CCH-like [Sesamum indicum]
Length=99

 Score =   114 bits (286),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV LKV MSCQGCVGAVKRVLGKMEGVESFDI++E+QKVTVKGNVQP+ VLQTV+KTG
Sbjct  2    SQTVELKVAMSCQGCVGAVKRVLGKMEGVESFDIDLEKQKVTVKGNVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            K T +W
Sbjct  62   KATSYW  67



>gb|AAF15285.1|AF198626_1 copper chaperone homolog CCH [Oryza sativa]
 dbj|BAD25440.1| copper chaperone homolog CCH [Oryza sativa Japonica Group]
 gb|EAY86120.1| hypothetical protein OsI_07492 [Oryza sativa Indica Group]
 gb|EAZ23296.1| hypothetical protein OsJ_06993 [Oryza sativa Japonica Group]
Length=132

 Score =   115 bits (288),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 64/68 (94%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+++TVVLKVGMSCQGC GAV+RVL KMEGVE+FDI++E+QKVTVKGNV+P++V QTV+K
Sbjct  1    MAAETVVLKVGMSCQGCAGAVRRVLTKMEGVETFDIDMEQQKVTVKGNVKPEDVFQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTSFW  68



>ref|XP_010244224.1| PREDICTED: copper transport protein CCH-like [Nelumbo nucifera]
Length=110

 Score =   114 bits (286),  Expect = 8e-29, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKVGMSCQGC GAVKRVL KMEGVESFDI+++EQKVTVKGNVQ D V Q V+KTG
Sbjct  2    AQTVVLKVGMSCQGCAGAVKRVLDKMEGVESFDIDLKEQKVTVKGNVQADAVFQNVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_009139111.1| PREDICTED: copper transport protein CCH-like isoform X1 [Brassica 
rapa]
Length=166

 Score =   116 bits (290),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKG V+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGRVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|XP_003591755.1| Copper chaperone [Medicago truncatula]
 gb|AES62006.1| copper chaperone [Medicago truncatula]
 gb|AFK35902.1| unknown [Medicago truncatula]
 gb|AFK44825.1| unknown [Medicago truncatula]
Length=79

 Score =   113 bits (283),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSSQTV LKVGMSC+GCVGAVKRVLGK++GVES+DI+++EQKV VKGNV+PD VL+TV+K
Sbjct  1    MSSQTVTLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVEPDTVLKTVSK  60

Query  240  TGKKT*FW  263
            TGK T FW
Sbjct  61   TGKPTAFW  68



>ref|XP_009403731.1| PREDICTED: copper transport protein ATX1-like [Musa acuminata 
subsp. malaccensis]
Length=112

 Score =   114 bits (285),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVLKVGMSC+GCVGAVKRVL KMEGVESFD++++EQKVTVKGNV+P+ VLQTV+KTG
Sbjct  29   AETVVLKVGMSCEGCVGAVKRVLTKMEGVESFDVDLKEQKVTVKGNVKPEAVLQTVSKTG  88

Query  246  KKT*FW  263
            KKT FW
Sbjct  89   KKTSFW  94



>gb|ABK20883.1| unknown [Picea sitchensis]
 gb|ABK20930.1| unknown [Picea sitchensis]
 gb|ABK21353.1| unknown [Picea sitchensis]
 gb|ABK21373.1| unknown [Picea sitchensis]
 gb|ABK21459.1| unknown [Picea sitchensis]
 gb|ABK22435.1| unknown [Picea sitchensis]
 gb|ABK23656.1| unknown [Picea sitchensis]
 gb|ABK25379.1| unknown [Picea sitchensis]
 gb|ABR16647.1| unknown [Picea sitchensis]
 gb|ABR17385.1| unknown [Picea sitchensis]
 gb|ABR17772.1| unknown [Picea sitchensis]
 gb|ACN39889.1| unknown [Picea sitchensis]
 gb|ACN40021.1| unknown [Picea sitchensis]
 gb|ACN40279.1| unknown [Picea sitchensis]
 gb|ACN40510.1| unknown [Picea sitchensis]
 gb|ACN40696.1| unknown [Picea sitchensis]
Length=75

 Score =   113 bits (282),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVLKVGMSC+GCVGAVKRVL KMEGVE++D+N++EQKVTVKGNV+PD VLQTV+KTG
Sbjct  2    AETVVLKVGMSCEGCVGAVKRVLNKMEGVETYDVNLKEQKVTVKGNVKPDAVLQTVSKTG  61

Query  246  KKT*FW  263
            K+T FW
Sbjct  62   KETSFW  67



>ref|XP_009139112.1| PREDICTED: copper transport protein CCH-like isoform X2 [Brassica 
rapa]
Length=139

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 61/66 (92%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKG V+P+ V QTV+KTG
Sbjct  2    SQTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGRVEPEAVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>ref|XP_007143814.1| hypothetical protein PHAVU_007G103800g [Phaseolus vulgaris]
 gb|ESW15808.1| hypothetical protein PHAVU_007G103800g [Phaseolus vulgaris]
Length=82

 Score =   113 bits (282),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV MSC+GCVGAVKRVLGK++GVES+DI+++E+KV VKGNVQPD VLQTV+KTG
Sbjct  2    SQTVVLKVEMSCEGCVGAVKRVLGKLDGVESYDIDLKEKKVVVKGNVQPDTVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTTFW  67



>ref|XP_009404819.1| PREDICTED: copper transport protein CCH [Musa acuminata subsp. 
malaccensis]
Length=109

 Score =   113 bits (283),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 63/66 (95%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVLKVGMSCQGCVGAVKRVL KMEGVESFD++++EQKVTVKGNV+P++V QTV+KTG
Sbjct  2    AETVVLKVGMSCQGCVGAVKRVLTKMEGVESFDVDLKEQKVTVKGNVKPEDVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_004489515.1| PREDICTED: uncharacterized protein LOC101501125 [Cicer arietinum]
Length=158

 Score =   114 bits (286),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSS+TVVLKV MSCQGC GAV RVL KMEGVESFDI+++EQKVTVKGNV+P EV +TV+K
Sbjct  1    MSSETVVLKVKMSCQGCAGAVNRVLEKMEGVESFDIDLKEQKVTVKGNVKPQEVYETVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTEFW  68



>ref|XP_009125574.1| PREDICTED: copper transport protein ATX1-like [Brassica rapa]
 ref|XP_009130832.1| PREDICTED: copper transport protein ATX1-like [Brassica rapa]
 emb|CDY04920.1| BnaAnng01020D [Brassica napus]
Length=77

 Score =   111 bits (278),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTG
Sbjct  2    SQTVVLKVAMPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>emb|CDY14145.1| BnaC02g02620D [Brassica napus]
Length=118

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTG
Sbjct  43   SQTVVLKVAMPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTG  102

Query  246  KKT*FW  263
            KKT FW
Sbjct  103  KKTSFW  108



>ref|XP_010522335.1| PREDICTED: copper transport protein CCH-like [Tarenaya hassleriana]
Length=104

 Score =   112 bits (280),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 54/66 (82%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            S+TVVLKVGMSCQGCVGAV RVLGKMEGVESFDIN++EQKVTV GNV+P  VL+TV+KTG
Sbjct  2    SKTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDINLKEQKVTVNGNVEPGAVLETVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KPTAFW  67



>emb|CAE51321.1| chopper chaperone [Hordeum vulgare subsp. vulgare]
 dbj|BAK02216.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06222.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAK06667.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=112

 Score =   112 bits (281),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 62/68 (91%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+S+TVVLKV MSC GC GAVKRVL KMEGVESFDI++E+QKVTVKGNV+P++V QTV+K
Sbjct  1    MASETVVLKVAMSCGGCSGAVKRVLTKMEGVESFDIDMEQQKVTVKGNVKPEDVFQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTAFW  68



>ref|XP_004308552.1| PREDICTED: copper transport protein ATX1-like, partial [Fragaria 
vesca subsp. vesca]
Length=110

 Score =   112 bits (279),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 53/68 (78%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+SQT VLKVGMSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVKGNV  + VLQTV+K
Sbjct  24   MASQTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKGNVPAETVLQTVSK  83

Query  240  TGKKT*FW  263
            TGKKT +W
Sbjct  84   TGKKTAYW  91



>ref|XP_003575064.1| PREDICTED: copper transport protein CCH-like [Brachypodium distachyon]
Length=93

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 51/68 (75%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+S+TVVLKV MSC+GC GAVKRVL KM+GVE+FDI+++EQKVTVKGNV+P++V QTV+K
Sbjct  1    MASETVVLKVAMSCEGCSGAVKRVLTKMQGVETFDIDMKEQKVTVKGNVKPEDVFQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTSFW  68



>gb|EYU19787.1| hypothetical protein MIMGU_mgv1a017040mg [Erythranthe guttata]
Length=96

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/66 (83%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTV LKVGMSCQGCVGAVKRVLGKMEGVESFDI+IE+QKVTV G VQP+ VLQTV+KTG
Sbjct  2    SQTVELKVGMSCQGCVGAVKRVLGKMEGVESFDIDIEKQKVTVVGKVQPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            K T +W
Sbjct  62   KATSYW  67



>ref|XP_009336005.1| PREDICTED: copper transport protein CCH-like [Pyrus x bretschneideri]
Length=87

 Score =   111 bits (277),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+SQT VLKVGMSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVK N+ P+ VLQTV+K
Sbjct  1    MASQTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT +W
Sbjct  61   TGKKTAYW  68



>emb|CDX76052.1| BnaA04g03160D [Brassica napus]
Length=138

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKG V+P+ V QTV+KTGK
Sbjct  2    QTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGRVEPEAVFQTVSKTGK  61

Query  249  KT*FW  263
            KT +W
Sbjct  62   KTSYW  66



>gb|KJB73384.1| hypothetical protein B456_011G230400, partial [Gossypium raimondii]
Length=166

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 64/66 (97%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++TVVLKVGMSC+GCVGAVKRVLGKM+GVES++++++EQKVTVKGNVQPD VLQTV+KTG
Sbjct  86   NKTVVLKVGMSCEGCVGAVKRVLGKMQGVESYEVDLKEQKVTVKGNVQPDAVLQTVSKTG  145

Query  246  KKT*FW  263
            KKT FW
Sbjct  146  KKTTFW  151



>emb|CDY43346.1| BnaC04g25100D [Brassica napus]
Length=170

 Score =   113 bits (283),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/65 (83%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTVVLKVGMSCQGCVGAV RVLGKMEGVESFDI+I+EQKVTVKG V+P+ V QTV+KTGK
Sbjct  7    QTVVLKVGMSCQGCVGAVNRVLGKMEGVESFDIDIKEQKVTVKGKVEPEAVFQTVSKTGK  66

Query  249  KT*FW  263
            KT +W
Sbjct  67   KTSYW  71



>ref|XP_010427430.1| PREDICTED: copper transport protein CCH isoform X1 [Camelina 
sativa]
 ref|XP_010427442.1| PREDICTED: copper transport protein CCH isoform X1 [Camelina 
sativa]
Length=82

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 56/69 (81%), Positives = 62/69 (90%), Gaps = 3/69 (4%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEG---VESFDINIEEQKVTVKGNVQPDEVLQTVT  236
            +QTVVLKVGMSCQGCVGAV RVLGKMEG   VESFDI+I+EQKVTVKGNV+P+ V QTV+
Sbjct  2    AQTVVLKVGMSCQGCVGAVNRVLGKMEGLHGVESFDIDIKEQKVTVKGNVEPEAVFQTVS  61

Query  237  KTGKKT*FW  263
            KTGKKT FW
Sbjct  62   KTGKKTSFW  70



>ref|XP_006398924.1| hypothetical protein EUTSA_v10015160mg [Eutrema salsugineum]
 gb|ESQ40377.1| hypothetical protein EUTSA_v10015160mg [Eutrema salsugineum]
Length=79

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 53/66 (80%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTG
Sbjct  2    SQTVVLKVAMPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>ref|XP_004496193.1| PREDICTED: copper transport protein ATOX1-like [Cicer arietinum]
Length=78

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/66 (79%), Positives = 62/66 (94%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKVGMSC+GCVGAVKRVLGK++GVES+DI+++EQKV VKGNV+PD VL+TV+KTG
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKLDGVESYDIDLKEQKVVVKGNVEPDTVLKTVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KPTAFW  67



>gb|EMS45185.1| Copper transport protein ATOX1 [Triticum urartu]
Length=167

 Score =   112 bits (281),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 54/64 (84%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TV L+VGMSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNV PD VLQTV+KTGKK
Sbjct  92   TVELRVGMSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVTPDAVLQTVSKTGKK  151

Query  252  T*FW  263
            T FW
Sbjct  152  TAFW  155



>ref|XP_007221369.1| hypothetical protein PRUPE_ppa014090mg [Prunus persica]
 ref|XP_008375574.1| PREDICTED: copper transport protein CCH-like [Malus domestica]
 gb|EMJ22568.1| hypothetical protein PRUPE_ppa014090mg [Prunus persica]
Length=87

 Score =   110 bits (275),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+SQT VLKVGMSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVK N+ P+ VLQTV+K
Sbjct  1    MASQTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTVSK  60

Query  240  TGKKT*FW  263
            TGKKT +W
Sbjct  61   TGKKTAYW  68



>ref|XP_004489516.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=122

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 61/68 (90%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+S+TVVLKV MSCQGC GAV RVL KMEGVESFDI+++EQKVTVKGNV+P EV +TV+K
Sbjct  1    MASETVVLKVKMSCQGCAGAVNRVLEKMEGVESFDIDLKEQKVTVKGNVKPQEVFETVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTEFW  68



>ref|XP_008446769.1| PREDICTED: copper transport protein CCH-like [Cucumis melo]
Length=95

 Score =   110 bits (274),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQT VLKV MSCQGCVGAVKRVLGK+EGV++FDI+I+ QKVTVKGNV+ D V QTV+KTG
Sbjct  2    SQTTVLKVAMSCQGCVGAVKRVLGKLEGVDTFDIDIDAQKVTVKGNVERDVVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTAYW  67



>ref|XP_004150491.1| PREDICTED: copper transport protein ATOX1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004165178.1| PREDICTED: copper transport protein ATOX1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004165179.1| PREDICTED: copper transport protein ATOX1-like isoform 4 [Cucumis 
sativus]
 gb|KGN52199.1| Copper chaperone [Cucumis sativus]
Length=95

 Score =   110 bits (274),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQT VLKV MSCQGCVGAVKRVLGK+EGVE++DI+I+ QKVTVKGNV+ D V QTV+KTG
Sbjct  2    SQTTVLKVAMSCQGCVGAVKRVLGKLEGVETYDIDIDAQKVTVKGNVERDVVFQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTAYW  67



>gb|ACJ84810.1| unknown [Medicago truncatula]
 gb|AFK47931.1| unknown [Medicago truncatula]
 gb|AES77677.2| copper chaperone [Medicago truncatula]
Length=126

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSS+TVVLKV MSC GC GAV RVL KMEGVESFDI+++EQKVTVKGNV+P +V  TV+K
Sbjct  1    MSSETVVLKVKMSCSGCSGAVNRVLEKMEGVESFDIDMKEQKVTVKGNVKPQDVFDTVSK  60

Query  240  TGKKT*FW  263
            TGKKT FW
Sbjct  61   TGKKTEFW  68



>ref|XP_004952635.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like, partial [Setaria italica]
Length=118

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 49/72 (68%), Positives = 64/72 (89%), Gaps = 0/72 (0%)
 Frame = +3

Query  48   QFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQ  227
             +L ++ QTVVLKV MSC+GC GAV+RVL KMEGVE+FDI+++EQKVTVKGNV+P++V Q
Sbjct  7    DYLHLAMQTVVLKVAMSCEGCAGAVRRVLTKMEGVETFDIDLKEQKVTVKGNVKPEDVFQ  66

Query  228  TVTKTGKKT*FW  263
            TV+K+GKKT +W
Sbjct  67   TVSKSGKKTSYW  78



>ref|XP_010516230.1| PREDICTED: copper transport protein CCH-like isoform X1 [Camelina 
sativa]
Length=120

 Score =   110 bits (275),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 60/67 (90%), Gaps = 3/67 (4%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEG---VESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            TVVLKVGMSCQGCVGAV RVLGKMEG   VESFDI+I+EQKVTVKGNV+P+ V QTV+KT
Sbjct  4    TVVLKVGMSCQGCVGAVNRVLGKMEGLHGVESFDIDIKEQKVTVKGNVEPEAVFQTVSKT  63

Query  243  GKKT*FW  263
            GKKT FW
Sbjct  64   GKKTSFW  70



>ref|XP_010032092.1| PREDICTED: copper transport protein ATX1-like [Eucalyptus grandis]
 gb|KCW51482.1| hypothetical protein EUGRSUZ_J01000 [Eucalyptus grandis]
Length=116

 Score =   109 bits (273),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKV MSCQGC GAV+RVL K EGVE+FDI+++EQKVTVKGN+QPD VLQTV+K+G
Sbjct  2    AQTVVLKVKMSCQGCAGAVRRVLEKTEGVETFDIDLKEQKVTVKGNLQPDAVLQTVSKSG  61

Query  246  KKT*FW  263
            K+T FW
Sbjct  62   KQTAFW  67



>ref|XP_004489514.1| PREDICTED: uncharacterized protein LOC101500482 [Cicer arietinum]
Length=135

 Score =   110 bits (275),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 52/68 (76%), Positives = 60/68 (88%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MSS+TVVLKV MSCQGC GAV RVL KMEGVESF I+++EQKVTVKGNV+P EV +TV+K
Sbjct  1    MSSETVVLKVKMSCQGCAGAVNRVLAKMEGVESFGIDLKEQKVTVKGNVKPQEVYETVSK  60

Query  240  TGKKT*FW  263
            +GKKT FW
Sbjct  61   SGKKTEFW  68



>ref|XP_010694708.1| PREDICTED: copper transport protein ATX1-like [Beta vulgaris 
subsp. vulgaris]
Length=120

 Score =   109 bits (273),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 49/66 (74%), Positives = 58/66 (88%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVL V M+C+GC GAVKRVL KMEGVES+DIN+EE+KVTV GN+ P+ VLQTV+KTG
Sbjct  2    SQTVVLNVAMTCKGCSGAVKRVLDKMEGVESYDINLEEKKVTVTGNITPEAVLQTVSKTG  61

Query  246  KKT*FW  263
            KKT +W
Sbjct  62   KKTSYW  67



>gb|ACC95537.1| copper chaperone protein [Knorringia sibirica]
Length=75

 Score =   108 bits (269),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 51/66 (77%), Positives = 59/66 (89%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV M+CQGCVGAV+RVLGKMEGVESFD+N+EE+KVTV GNV P+ VLQ V+KTG
Sbjct  2    SQTVVLKVEMTCQGCVGAVQRVLGKMEGVESFDVNLEEKKVTVNGNVDPEAVLQKVSKTG  61

Query  246  KKT*FW  263
            + T FW
Sbjct  62   RATSFW  67



>gb|KHG07071.1| Copper transport protein ATOX1 [Gossypium arboreum]
Length=104

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTGKKT FW
Sbjct  1    MSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTGKKTAFW  57



>ref|XP_002453929.1| hypothetical protein SORBIDRAFT_04g021590 [Sorghum bicolor]
 gb|EES06905.1| hypothetical protein SORBIDRAFT_04g021590 [Sorghum bicolor]
Length=113

 Score =   108 bits (271),  Expect = 1e-26, Method: Compositional matrix adjust.
 Identities = 47/68 (69%), Positives = 63/68 (93%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+++TVVLKV MSC+GC GAV+RVL KMEG+E+FDI+++EQKVTVKGNV+P++V QTV+K
Sbjct  1    MAAETVVLKVAMSCEGCAGAVRRVLSKMEGIETFDIDLKEQKVTVKGNVKPEDVFQTVSK  60

Query  240  TGKKT*FW  263
            +GKKT +W
Sbjct  61   SGKKTSYW  68



>ref|NP_001154453.1| copper transport protein ATX1 [Arabidopsis thaliana]
 gb|AAG51766.1|AC066691_6 copper homeostasis factor, putative; 27145-26758 [Arabidopsis 
thaliana]
 gb|AEE34482.1| homolog of anti-oxidant 1 [Arabidopsis thaliana]
Length=66

 Score =   107 bits (267),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTVTKTGKKT FW
Sbjct  1    MTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFW  57



>dbj|BAH57197.1| AT1G66240 [Arabidopsis thaliana]
Length=66

 Score =   107 bits (266),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 50/57 (88%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTVTKTGKKT FW
Sbjct  1    MTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVTKTGKKTAFW  57



>gb|KJB75020.1| hypothetical protein B456_012G020400 [Gossypium raimondii]
Length=111

 Score =   108 bits (269),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAVKRVLGKMEGVES+++++E+QKVTVKGNVQPD VLQTV+KTGKKT FW
Sbjct  1    MSCQGCVGAVKRVLGKMEGVESYEVDLEQQKVTVKGNVQPDAVLQTVSKTGKKTAFW  57



>ref|XP_006407535.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
 ref|XP_006407537.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
 gb|ESQ48988.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
 gb|ESQ48990.1| hypothetical protein EUTSA_v10021868mg [Eutrema salsugineum]
Length=66

 Score =   106 bits (265),  Expect = 3e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSC+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTGKK+ FW
Sbjct  1    MSCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTGKKSAFW  57



>ref|XP_006398923.1| hypothetical protein EUTSA_v10015160mg [Eutrema salsugineum]
 gb|ESQ40376.1| hypothetical protein EUTSA_v10015160mg [Eutrema salsugineum]
Length=84

 Score =   107 bits (266),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 51/64 (80%), Positives = 60/64 (94%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TVVLKV M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTGKK
Sbjct  9    TVVLKVAMPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTGKK  68

Query  252  T*FW  263
            T FW
Sbjct  69   TSFW  72



>ref|XP_004150490.1| PREDICTED: copper transport protein ATOX1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004165177.1| PREDICTED: copper transport protein ATOX1-like isoform 2 [Cucumis 
sativus]
Length=103

 Score =   107 bits (267),  Expect = 4e-26, Method: Compositional matrix adjust.
 Identities = 50/65 (77%), Positives = 58/65 (89%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QT VLKV MSCQGCVGAVKRVLGK+EGVE++DI+I+ QKVTVKGNV+ D V QTV+KTGK
Sbjct  11   QTTVLKVAMSCQGCVGAVKRVLGKLEGVETYDIDIDAQKVTVKGNVERDVVFQTVSKTGK  70

Query  249  KT*FW  263
            KT +W
Sbjct  71   KTAYW  75



>gb|KCW51481.1| hypothetical protein EUGRSUZ_J01000 [Eucalyptus grandis]
Length=114

 Score =   107 bits (267),  Expect = 5e-26, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +QTVVLKV MSCQGC GAV+RVL K EGVE+FDI+++EQKVTVKGN+QPD VLQTV+K+G
Sbjct  2    AQTVVLKVKMSCQGCAGAVRRVLEKTEGVETFDIDLKEQKVTVKGNLQPDAVLQTVSKSG  61

Query  246  KKT*FW  263
            K+T FW
Sbjct  62   KQTAFW  67



>ref|XP_008345701.1| PREDICTED: copper transport protein CCH-like [Malus domestica]
Length=90

 Score =   106 bits (265),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 52/69 (75%), Positives = 61/69 (88%), Gaps = 1/69 (1%)
 Frame = +3

Query  60   MSSQTV-VLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVT  236
            M+SQT  VLKVGMSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVK N+ P+ VLQTV+
Sbjct  1    MASQTTTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTVS  60

Query  237  KTGKKT*FW  263
            KTGKKT +W
Sbjct  61   KTGKKTAYW  69



>emb|CDP21618.1| unnamed protein product [Coffea canephora]
Length=109

 Score =   107 bits (267),  Expect = 6e-26, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAV RVL KMEGVESFDI+++EQKVTVKGNVQP+ VLQTV+KTGKKT FW
Sbjct  1    MSCQGCVGAVNRVLSKMEGVESFDIDLKEQKVTVKGNVQPEAVLQTVSKTGKKTSFW  57



>ref|XP_010415167.1| PREDICTED: copper transport protein ATX1 isoform X2 [Camelina 
sativa]
Length=66

 Score =   105 bits (263),  Expect = 7e-26, Method: Compositional matrix adjust.
 Identities = 49/57 (86%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            M+C+GCVGAVKRVLGKMEGVESFD++I+EQKVTVKGNVQPD VLQTV+KTGKKT FW
Sbjct  1    MTCEGCVGAVKRVLGKMEGVESFDVDIKEQKVTVKGNVQPDAVLQTVSKTGKKTAFW  57



>gb|ACH63216.1| copper homeostasis factor [Rheum australe]
Length=75

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 50/66 (76%), Positives = 60/66 (91%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV M+CQGCVGAV+RVLGKMEGVESF+++++E+KVTV GNV P+ VLQ V+KTG
Sbjct  2    SQTVVLKVEMTCQGCVGAVQRVLGKMEGVESFNVDLKEKKVTVNGNVDPEAVLQKVSKTG  61

Query  246  KKT*FW  263
            KKT FW
Sbjct  62   KKTSFW  67



>gb|KHN10367.1| Copper transport protein ATOX1 [Glycine soja]
Length=119

 Score =   106 bits (265),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 47/57 (82%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGC GAV RVLGKMEGVESFDI+++EQKVTVKGNV+PDEVLQ V+K+GKKT FW
Sbjct  1    MSCQGCAGAVNRVLGKMEGVESFDIDLKEQKVTVKGNVEPDEVLQAVSKSGKKTAFW  57



>gb|KDO36998.1| hypothetical protein CISIN_1g034633mg [Citrus sinensis]
Length=78

 Score =   105 bits (262),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 55/57 (96%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSC+GCVGAVKRVLGKM+GVE+FDI+++EQKVTVKGNVQPD VLQTV+KTGKKT FW
Sbjct  1    MSCEGCVGAVKRVLGKMDGVETFDIDLKEQKVTVKGNVQPDAVLQTVSKTGKKTAFW  57



>ref|XP_007224903.1| hypothetical protein PRUPE_ppa022012mg [Prunus persica]
 gb|EMJ26102.1| hypothetical protein PRUPE_ppa022012mg [Prunus persica]
Length=106

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 58/121 (48%), Positives = 74/121 (61%), Gaps = 23/121 (19%)
 Frame = +3

Query  12   YNPPLCFFFL*IQFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVT  191
            ++  L F FL    +++S  T V KVGMSCQGCVGAVKRVLGK+EGVES++I+ + Q VT
Sbjct  9    FHTHLLFGFL--LLVSISYLTTVFKVGMSCQGCVGAVKRVLGKLEGVESYNIDFDAQNVT  66

Query  192  VKGNVQPDEVLQTVTKTGKKT*FWeseappppppaqpesvpsaqaLEEPPKQPESGPPAQ  371
            VK N+ P+ VLQTV+KTGKKT +W                       E P +PE+ P A 
Sbjct  67   VKSNLPPETVLQTVSKTGKKTAYWR---------------------AEAPTKPEAKPVAA  105

Query  372  A  374
            A
Sbjct  106  A  106



>gb|ACG28065.1| hypothetical protein [Zea mays]
 gb|ACG32725.1| hypothetical protein [Zea mays]
Length=112

 Score =   105 bits (263),  Expect = 2e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            +TVVLKV MSC+GC GAV+RVL KMEGVE+FDI+++EQKVTVKGNV+P++V QTV+K+GK
Sbjct  5    ETVVLKVAMSCEGCAGAVRRVLSKMEGVETFDIDLKEQKVTVKGNVKPEDVFQTVSKSGK  64

Query  249  KT*FW  263
            +T +W
Sbjct  65   RTSYW  69



>gb|ACG24461.1| hypothetical protein [Zea mays]
Length=111

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            +TVVLKV MSC+GC GAV+RVL KMEGVE+FDI+++EQKVTVKGNV+P++V QTV+K+GK
Sbjct  5    ETVVLKVAMSCEGCAGAVRRVLSKMEGVETFDIDLKEQKVTVKGNVKPEDVFQTVSKSGK  64

Query  249  KT*FW  263
            +T +W
Sbjct  65   RTSYW  69



>tpg|DAA47615.1| TPA: hypothetical protein ZEAMMB73_968377 [Zea mays]
Length=74

 Score =   104 bits (259),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 53/57 (93%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSC+GCVGAVKRVLGKMEGVES+D++I EQKVTVKGNV PD VLQTV+KTGKKT FW
Sbjct  1    MSCEGCVGAVKRVLGKMEGVESYDVDIMEQKVTVKGNVTPDAVLQTVSKTGKKTSFW  57



>ref|XP_008219348.1| PREDICTED: LOW QUALITY PROTEIN: copper transport protein CCH-like 
[Prunus mume]
Length=87

 Score =   104 bits (260),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 48/68 (71%), Positives = 59/68 (87%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+SQT V KVGMSCQGCVGAVKR LG++EGVES+DI+ + QKVTVK N+ P+ VLQTV+K
Sbjct  1    MASQTTVFKVGMSCQGCVGAVKRXLGELEGVESYDIDFDAQKVTVKSNLPPETVLQTVSK  60

Query  240  TGKKT*FW  263
            +GKKT +W
Sbjct  61   SGKKTAYW  68



>gb|ACG27146.1| hypothetical protein [Zea mays]
 gb|ACL53946.1| unknown [Zea mays]
 gb|AFW71663.1| hypothetical protein ZEAMMB73_148745 [Zea mays]
Length=112

 Score =   105 bits (262),  Expect = 3e-25, Method: Compositional matrix adjust.
 Identities = 46/65 (71%), Positives = 60/65 (92%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            +TVVLKV MSC+GC GAV+RVL KMEGVE+FDI+++EQKVTVKGNV+P++V QTV+K+GK
Sbjct  5    ETVVLKVAMSCEGCAGAVRRVLSKMEGVETFDIDLKEQKVTVKGNVKPEDVFQTVSKSGK  64

Query  249  KT*FW  263
            +T +W
Sbjct  65   RTSYW  69



>ref|XP_009356113.1| PREDICTED: copper transport protein CCH [Pyrus x bretschneideri]
 ref|XP_009356114.1| PREDICTED: copper transport protein CCH [Pyrus x bretschneideri]
Length=88

 Score =   104 bits (260),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 57/64 (89%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            T VLKVGMSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVK N+ P+ VLQTV+KTGKK
Sbjct  6    TTVLKVGMSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTVSKTGKK  65

Query  252  T*FW  263
            T +W
Sbjct  66   TAYW  69



>gb|KDP33082.1| hypothetical protein JCGZ_13655 [Jatropha curcas]
Length=63

 Score =   103 bits (258),  Expect = 4e-25, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSC GCVG+VKRVLGKMEGVES+DI+++EQKVTVKGNVQPD VLQTV+KTGKKT FW
Sbjct  1    MSCDGCVGSVKRVLGKMEGVESYDIDLKEQKVTVKGNVQPDAVLQTVSKTGKKTSFW  57



>emb|CDX80916.1| BnaC03g01700D [Brassica napus]
Length=1479

 Score =   112 bits (281),  Expect = 9e-25, Method: Composition-based stats.
 Identities = 51/65 (78%), Positives = 61/65 (94%), Gaps = 0/65 (0%)
 Frame = +3

Query  69    QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
             +TVVLKV M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTGK
Sbjct  1405  KTVVLKVAMPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTGK  1464

Query  249   KT*FW  263
             KT FW
Sbjct  1465  KTSFW  1469



>ref|XP_002978885.1| hypothetical protein SELMODRAFT_109953, partial [Selaginella 
moellendorffii]
 ref|XP_002988398.1| hypothetical protein SELMODRAFT_128073, partial [Selaginella 
moellendorffii]
 gb|EFJ10488.1| hypothetical protein SELMODRAFT_128073, partial [Selaginella 
moellendorffii]
 gb|EFJ19842.1| hypothetical protein SELMODRAFT_109953, partial [Selaginella 
moellendorffii]
Length=70

 Score =   102 bits (255),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 48/65 (74%), Positives = 59/65 (91%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q V LKV M+C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+ ++VLQTV+KTGK
Sbjct  1    QIVELKVAMTCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVKAEDVLQTVSKTGK  60

Query  249  KT*FW  263
             T FW
Sbjct  61   ATTFW  65



>ref|XP_003621459.1| Copper transport protein ATOX1 [Medicago truncatula]
Length=124

 Score =   104 bits (259),  Expect = 1e-24, Method: Compositional matrix adjust.
 Identities = 49/64 (77%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TVVLKV MSC GC GAV RVL KMEGVESFDI+++EQKVTVKGNV+P +V  TV+KTGKK
Sbjct  3    TVVLKVKMSCSGCSGAVNRVLEKMEGVESFDIDMKEQKVTVKGNVKPQDVFDTVSKTGKK  62

Query  252  T*FW  263
            T FW
Sbjct  63   TEFW  66



>ref|XP_001768826.1| predicted protein [Physcomitrella patens]
 gb|EDQ66379.1| predicted protein [Physcomitrella patens]
Length=86

 Score =   102 bits (253),  Expect = 3e-24, Method: Compositional matrix adjust.
 Identities = 47/66 (71%), Positives = 57/66 (86%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            ++T VLKV MSCQGCVGAVKR +GK+EGVES+DI+I+EQKVTV G+V+PD VL  V+KTG
Sbjct  2    AETTVLKVAMSCQGCVGAVKRAIGKLEGVESYDIDIKEQKVTVVGSVKPDVVLDRVSKTG  61

Query  246  KKT*FW  263
            K T FW
Sbjct  62   KATSFW  67



>ref|XP_009619826.1| PREDICTED: copper transport protein ATX1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=76

 Score =   101 bits (252),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAVKRVLGKMEGVE+FDI+++EQKVTVKGNVQP+ VLQTV+KTGK T FW
Sbjct  1    MSCQGCVGAVKRVLGKMEGVENFDIDLKEQKVTVKGNVQPEAVLQTVSKTGKPTSFW  57



>ref|XP_009781188.1| PREDICTED: copper transport protein ATX1 isoform X2 [Nicotiana 
sylvestris]
Length=76

 Score =   101 bits (251),  Expect = 5e-24, Method: Compositional matrix adjust.
 Identities = 48/57 (84%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAVKRVLGKMEGVE+FDI+++EQKVTVKGNVQP+ VLQTV+KTGK T FW
Sbjct  1    MSCQGCVGAVKRVLGKMEGVENFDIDLKEQKVTVKGNVQPEAVLQTVSKTGKPTSFW  57



>emb|CDY11299.1| BnaA03g01350D [Brassica napus]
Length=67

 Score = 98.2 bits (243),  Expect = 7e-23, Method: Compositional matrix adjust.
 Identities = 45/57 (79%), Positives = 54/57 (95%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            M C+GCVGAVKRVLGKM+GVESFD++++EQKVTVKGNV+P+ VLQTV+KTGKKT FW
Sbjct  1    MPCEGCVGAVKRVLGKMQGVESFDVDLKEQKVTVKGNVEPEAVLQTVSKTGKKTSFW  57



>ref|XP_004150489.1| PREDICTED: copper transport protein ATOX1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004165176.1| PREDICTED: copper transport protein ATOX1-like isoform 1 [Cucumis 
sativus]
Length=114

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 51/85 (60%), Positives = 59/85 (69%), Gaps = 19/85 (22%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKME-------------------GVESFDINIEEQKV  188
            SQT VLKV MSCQGCVGAVKRVLGK+E                   GVE++DI+I+ QKV
Sbjct  2    SQTTVLKVAMSCQGCVGAVKRVLGKLEVNSKIWWIDYPCASEFLNDGVETYDIDIDAQKV  61

Query  189  TVKGNVQPDEVLQTVTKTGKKT*FW  263
            TVKGNV+ D V QTV+KTGKKT +W
Sbjct  62   TVKGNVERDVVFQTVSKTGKKTAYW  86



>gb|KHN00909.1| hypothetical protein glysoja_000577 [Glycine soja]
Length=123

 Score = 97.4 bits (241),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 54/108 (50%), Positives = 62/108 (57%), Gaps = 42/108 (39%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKME---------------------------------  146
            SQTVVLKVGMSC+GCVGAVKRVLGK++                                 
Sbjct  2    SQTVVLKVGMSCEGCVGAVKRVLGKLDAQPSSHCVLHSNCFLLRLSLHCVFYQLVLSSTA  61

Query  147  ---------GVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
                     GVES+DI+++EQKV VKGNVQPD VL TV+KTGKKT FW
Sbjct  62   RDARLEGEKGVESYDIDLKEQKVVVKGNVQPDTVLATVSKTGKKTTFW  109



>gb|EPS63271.1| copper chaperone, partial [Genlisea aurea]
Length=67

 Score = 95.1 bits (235),  Expect = 9e-22, Method: Compositional matrix adjust.
 Identities = 46/64 (72%), Positives = 55/64 (86%), Gaps = 0/64 (0%)
 Frame = +3

Query  72   TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKK  251
            TV LKV MSC GC GAVKRVLGK+EGVES+DI++E+QKVTVK +V P+ VL+TV+KTGK 
Sbjct  1    TVELKVAMSCGGCAGAVKRVLGKLEGVESYDIDLEKQKVTVKASVPPETVLETVSKTGKA  60

Query  252  T*FW  263
            T FW
Sbjct  61   TSFW  64



>ref|XP_008232042.1| PREDICTED: copper transport protein CCH-like [Prunus mume]
Length=87

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 51/57 (89%), Gaps = 0/57 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*FW  263
            MSCQGCVGAVKRVLGK+EGVES+DI+ + QKVTVK N+ P+ VLQT++KTGKKT +W
Sbjct  1    MSCQGCVGAVKRVLGKLEGVESYDIDFDAQKVTVKSNLPPETVLQTISKTGKKTAYW  57



>ref|XP_005649391.1| hypothetical protein COCSUDRAFT_14202, partial [Coccomyxa subellipsoidea 
C-169]
 gb|EIE24847.1| hypothetical protein COCSUDRAFT_14202, partial [Coccomyxa subellipsoidea 
C-169]
Length=64

 Score = 88.6 bits (218),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            VVLKV M+C GC GAV+RVL    GVES DI+++EQKV VKGNVQ D++ QTV+KTGKKT
Sbjct  1    VVLKVAMACSGCEGAVRRVLTGKPGVESVDIDLKEQKVVVKGNVQADDIFQTVSKTGKKT  60

Query  255  *FW  263
             FW
Sbjct  61   EFW  63



>ref|XP_002954752.1| hypothetical protein VOLCADRAFT_82965 [Volvox carteri f. nagariensis]
 gb|EFJ44158.1| hypothetical protein VOLCADRAFT_82965 [Volvox carteri f. nagariensis]
Length=67

 Score = 88.2 bits (217),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/60 (70%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            VVLKV M C GCV AV+RVLGKMEGVES+++++EEQKV VKGNV P +VL+ ++KTGKKT
Sbjct  4    VVLKVEMMCNGCVAAVQRVLGKMEGVESYNVSLEEQKVVVKGNVSPQDVLEKISKTGKKT  63



>ref|XP_002975956.1| hypothetical protein SELMODRAFT_104411, partial [Selaginella 
moellendorffii]
 gb|EFJ22861.1| hypothetical protein SELMODRAFT_104411, partial [Selaginella 
moellendorffii]
Length=86

 Score = 85.9 bits (211),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 57/66 (86%), Gaps = 1/66 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTV-KGNVQPDEVLQTVTKTG  245
            Q V LKV MSCQGCVGAVKRVLGK+EGV++F+I+++EQKV+V   +++P++VL+ V+K+G
Sbjct  1    QIVELKVAMSCQGCVGAVKRVLGKLEGVDNFEIDLKEQKVSVTTSSLKPEQVLEAVSKSG  60

Query  246  KKT*FW  263
            K T +W
Sbjct  61   KATSYW  66



>ref|XP_003060365.1| predicted protein [Micromonas pusilla CCMP1545]
 gb|EEH55134.1| predicted protein [Micromonas pusilla CCMP1545]
Length=69

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 40/66 (61%), Positives = 51/66 (77%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            S T+VLKV M C GC GAV+RVL KMEGV++FD+N+E QKVTVKG+V  +EV++ + KTG
Sbjct  2    SNTIVLKVAMMCGGCSGAVERVLSKMEGVDAFDVNLETQKVTVKGSVTQEEVIEKIAKTG  61

Query  246  KKT*FW  263
            K    W
Sbjct  62   KAVEPW  67



>ref|XP_002968528.1| hypothetical protein SELMODRAFT_169899 [Selaginella moellendorffii]
 gb|EFJ30782.1| hypothetical protein SELMODRAFT_169899 [Selaginella moellendorffii]
Length=88

 Score = 84.0 bits (206),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/66 (59%), Positives = 56/66 (85%), Gaps = 1/66 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTV-KGNVQPDEVLQTVTKTG  245
            + V LKV MSCQGCVGAVKRVLGK+EGV+ F+I+++EQKV+V   +++P++VL+ V+K+G
Sbjct  3    EIVELKVAMSCQGCVGAVKRVLGKLEGVDKFEIDLKEQKVSVTTSSLKPEQVLEAVSKSG  62

Query  246  KKT*FW  263
            K T +W
Sbjct  63   KATSYW  68



>gb|KIY96157.1| copper chaperone, partial [Monoraphidium neglectum]
Length=66

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 38/60 (63%), Positives = 52/60 (87%), Gaps = 0/60 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            VVLKV M+C GC GAV+RVL K++GV+S+D+++E+Q+V VKG+V P+ VL+TV KTGKKT
Sbjct  5    VVLKVDMACSGCSGAVERVLAKLQGVDSYDVSLEKQQVVVKGSVSPEVVLETVKKTGKKT  64



>ref|XP_011398390.1| Copper transport protein ATOX1 [Auxenochlorella protothecoides]
 gb|KFM25494.1| Copper transport protein ATOX1 [Auxenochlorella protothecoides]
Length=67

 Score = 81.3 bits (199),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 36/61 (59%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = +3

Query  81   LKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*F  260
            L+V M+C+GC GAV+RVLG +EGVE  DI++ +QKVTV G+  P+ V +TV K+GKKT F
Sbjct  6    LRVAMACEGCAGAVRRVLGNLEGVEKVDIDLAKQKVTVLGSADPNTVKETVAKSGKKTEF  65

Query  261  W  263
            W
Sbjct  66   W  66



>ref|XP_002505251.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO66509.1| predicted protein [Micromonas sp. RCC299]
Length=69

 Score = 80.9 bits (198),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            + TV+LKV M C GC GAV+RVL KMEGV+SFD+N+E QKVTV G V  +EV+  + KTG
Sbjct  2    TNTVILKVAMMCTGCSGAVERVLSKMEGVQSFDVNLETQKVTVVGTVTHEEVVTKIAKTG  61

Query  246  K  248
            K
Sbjct  62   K  62



>gb|KDD72288.1| hypothetical protein H632_c3575p0 [Helicosporidium sp. ATCC 50920]
Length=67

 Score = 79.7 bits (195),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 35/61 (57%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = +3

Query  81   LKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT*F  260
            L+V M+CQGC GAV+RVL ++EGVES DI++ E+ V V G+  PD VL   +K GKKT F
Sbjct  6    LRVDMACQGCAGAVRRVLEQLEGVESVDIDVAEKSVVVTGSASPDAVLAAASKAGKKTEF  65

Query  261  W  263
            W
Sbjct  66   W  66



>gb|ABK23854.1| unknown [Picea sitchensis]
Length=169

 Score = 79.7 bits (195),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 50/67 (75%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S++ VV++V + CQGC G V+R + KMEGV SF I++E+QKVTV GNV P  VL++++K 
Sbjct  95   SNEVVVMRVSLHCQGCAGKVRRHISKMEGVTSFSIDLEKQKVTVAGNVSPSGVLESISKV  154

Query  243  GKKT*FW  263
             K+  FW
Sbjct  155  -KRAEFW  160



>gb|EMS53372.1| hypothetical protein TRIUR3_28512 [Triticum urartu]
Length=149

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +3

Query  93   MSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTV  233
            MSC GC GAVKRVL KMEGVESFDI++E+QKVTVKGNV+P++V QT 
Sbjct  1    MSCGGCSGAVKRVLTKMEGVESFDIDMEQQKVTVKGNVKPEDVFQTA  47



>ref|XP_003524069.1| PREDICTED: uncharacterized protein LOC100802591 [Glycine max]
Length=166

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G++ P EVL++++K  K
Sbjct  100  QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDVESKRVTVMGHISPVEVLESISKV-K  158

Query  249  KT*FW  263
            +  FW
Sbjct  159  RAEFW  163



>gb|KHN30679.1| hypothetical protein glysoja_049471 [Glycine soja]
Length=166

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G++ P EVL++++K  K
Sbjct  100  QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDVESKRVTVMGHISPVEVLESISKV-K  158

Query  249  KT*FW  263
            +  FW
Sbjct  159  RAEFW  163



>ref|XP_003531045.2| PREDICTED: uncharacterized protein LOC100785162 [Glycine max]
 gb|KHN39208.1| hypothetical protein glysoja_028013 [Glycine soja]
Length=168

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G++ P EVL++++K  K
Sbjct  102  QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDVESKRVTVMGHISPVEVLESISKV-K  160

Query  249  KT*FW  263
            +  FW
Sbjct  161  RAEFW  165



>ref|XP_006351801.1| PREDICTED: uncharacterized protein LOC102587724 [Solanum tuberosum]
Length=168

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 36/73 (49%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +3

Query  45   IQFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVL  224
            I F   S Q VV++V + CQGC G VK+ L KMEGV SF I+++ Q+VTV G+V P  VL
Sbjct  92   IPFTDNSFQVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLDSQRVTVMGHVSPVGVL  151

Query  225  QTVTKTGKKT*FW  263
            ++++K  K+  FW
Sbjct  152  ESISKV-KRAEFW  163



>ref|XP_010269157.1| PREDICTED: uncharacterized protein LOC104605904 [Nelumbo nucifera]
Length=173

 Score = 74.3 bits (181),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  VL++V+K  K
Sbjct  108  QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPAGVLESVSKV-K  166

Query  249  KT*FW  263
            K  FW
Sbjct  167  KAEFW  171



>ref|XP_010030932.1| PREDICTED: copper transport protein ATX1-like [Eucalyptus grandis]
Length=162

 Score = 73.9 bits (180),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 48/65 (74%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV+G+V P  VL++++K  K
Sbjct  96   QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVRGHVSPVGVLESISKV-K  154

Query  249  KT*FW  263
            +  FW
Sbjct  155  RAEFW  159



>ref|XP_001694742.1| copper chaperone [Chlamydomonas reinhardtii]
 gb|AAG01446.1|AF280056_1 putative copper chaperone [Chlamydomonas reinhardtii]
 gb|AAM94017.1| putative copper chaperone [Chlamydomonas reinhardtii]
 gb|EDP02326.1| copper chaperone [Chlamydomonas reinhardtii]
Length=70

 Score = 71.6 bits (174),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/64 (55%), Positives = 49/64 (77%), Gaps = 1/64 (2%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGN-VQPDEVLQTVTKT  242
            S  VVLKV M C GCVGAV+RVLGK++GV+S+++++E+Q+  V+G  + P  VL+ V KT
Sbjct  2    STEVVLKVDMMCNGCVGAVQRVLGKLDGVDSYEVSLEKQQAVVRGKALDPQAVLEKVAKT  61

Query  243  GKKT  254
            GKK 
Sbjct  62   GKKA  65



>ref|XP_007151507.1| hypothetical protein PHAVU_004G052700g [Phaseolus vulgaris]
 gb|ESW23501.1| hypothetical protein PHAVU_004G052700g [Phaseolus vulgaris]
Length=146

 Score = 73.2 bits (178),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 30/63 (48%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            V LKV M CQGC G ++R + K+ GV+S DI++++QKVTV G V+  +VL++V +TG++ 
Sbjct  16   VELKVHMDCQGCEGRIRRAISKLNGVDSLDIDMDQQKVTVTGYVEKGKVLRSVRRTGRRA  75

Query  255  *FW  263
             +W
Sbjct  76   EYW  78



>ref|XP_006585452.1| PREDICTED: uncharacterized protein LOC102661113 [Glycine max]
 gb|KHN26732.1| hypothetical protein glysoja_011324 [Glycine soja]
Length=167

 Score = 73.2 bits (178),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC   VKR L KMEGV SF +++E ++VTVKG++ P  VL++++K  K
Sbjct  102  QVVVMRVAIHCQGCASKVKRHLSKMEGVTSFSVDVESKRVTVKGHISPVGVLESISKV-K  160

Query  249  KT*FW  263
            +  FW
Sbjct  161  RAEFW  165



>ref|XP_011087847.1| PREDICTED: uncharacterized protein LOC105169203 [Sesamum indicum]
Length=172

 Score = 73.6 bits (179),  Expect = 7e-13, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  VL++++K  K
Sbjct  107  QVVVMRVSIHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPSGVLESISKV-K  165

Query  249  KT*FW  263
            K  FW
Sbjct  166  KAEFW  170



>emb|CBI32881.3| unnamed protein product [Vitis vinifera]
Length=162

 Score = 73.2 bits (178),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/78 (40%), Positives = 50/78 (64%), Gaps = 0/78 (0%)
 Frame = +3

Query  30   FFFL*IQFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQ  209
            F+   + +L++  Q V L V M C+GC   ++R + K+ GV+  DI++++QKVTV G V 
Sbjct  17   FYLSALIYLSIVWQIVELLVHMDCEGCEKRIRRAISKLSGVDHLDIDMDKQKVTVTGYVD  76

Query  210  PDEVLQTVTKTGKKT*FW  263
              +VL+ V +TG+K  FW
Sbjct  77   QRQVLKVVRRTGRKAEFW  94



>ref|XP_007395908.1| hypothetical protein PHACADRAFT_256312 [Phanerochaete carnosa 
HHB-10118-sp]
 gb|EKM55585.1| hypothetical protein PHACADRAFT_256312 [Phanerochaete carnosa 
HHB-10118-sp]
Length=72

 Score = 70.9 bits (172),  Expect = 9e-13, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 48/64 (75%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS  T    V M+C GC GA++RVL K EG++SFD+++E+Q+V VKG+++ D +L+ + K
Sbjct  1    MSEHTYKFDVKMTCGGCSGAIERVLKKTEGIDSFDVSLEKQEVIVKGSIEYDALLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_006846435.1| hypothetical protein AMTR_s00018p00054220 [Amborella trichopoda]
 gb|ERN08110.1| hypothetical protein AMTR_s00018p00054220 [Amborella trichopoda]
Length=168

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 46/68 (68%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            +S Q V LKV M C GCV  VK  L K+ GV+S DIN+E +KVTV G V  ++VL+ V +
Sbjct  35   LSLQIVELKVRMCCTGCVKEVKTALSKLRGVDSVDINLELEKVTVTGYVDRNKVLKYVRR  94

Query  240  TGKKT*FW  263
            +GK+  FW
Sbjct  95   SGKRAEFW  102



>ref|XP_006493297.1| PREDICTED: uncharacterized protein LOC102621358 [Citrus sinensis]
Length=181

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G +K+ L KMEGV SF I++E ++VTV G++ P  VL++++K  K
Sbjct  116  QVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIDLETKRVTVMGHISPTGVLESISKV-K  174

Query  249  KT*FW  263
            +  FW
Sbjct  175  RAEFW  179



>ref|XP_007043020.1| Chloroplast-targeted copper chaperone protein [Theobroma cacao]
 gb|EOX98851.1| Chloroplast-targeted copper chaperone protein [Theobroma cacao]
Length=164

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  VL++++K  K
Sbjct  99   QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPVGVLESISKV-K  157

Query  249  KT*FW  263
            K  FW
Sbjct  158  KAEFW  162



>gb|KDO42559.1| hypothetical protein CISIN_1g029814mg [Citrus sinensis]
Length=187

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G +K+ L KMEGV SF I++E ++VTV G++ P  VL++++K  K
Sbjct  122  QVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIDLETKRVTVMGHISPTGVLESISKV-K  180

Query  249  KT*FW  263
            +  FW
Sbjct  181  RAEFW  185



>gb|KJB32008.1| hypothetical protein B456_005G218500 [Gossypium raimondii]
Length=164

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I+IE ++VTV G+V P  VL++++K  K
Sbjct  99   QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDIETKRVTVMGHVSPVGVLESISKV-K  157

Query  249  KT*FW  263
            K  FW
Sbjct  158  KAEFW  162



>ref|XP_006432488.1| hypothetical protein CICLE_v10002596mg [Citrus clementina]
 gb|ESR45728.1| hypothetical protein CICLE_v10002596mg [Citrus clementina]
Length=187

 Score = 73.2 bits (178),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G +K+ L KMEGV SF I++E ++VTV G++ P  VL++++K  K
Sbjct  122  QVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIDLETKRVTVMGHISPTGVLESISKV-K  180

Query  249  KT*FW  263
            +  FW
Sbjct  181  RAEFW  185



>ref|XP_002967453.1| hypothetical protein SELMODRAFT_39116, partial [Selaginella moellendorffii]
 gb|EFJ32052.1| hypothetical protein SELMODRAFT_39116, partial [Selaginella moellendorffii]
Length=73

 Score = 70.5 bits (171),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 37/66 (56%), Positives = 45/66 (68%), Gaps = 0/66 (0%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            SQTVVLKV + C GC   VK+ L K++G+ S D+N  E KVTVKG V P EVL+   KTG
Sbjct  1    SQTVVLKVKIHCLGCEKKVKKSLNKVKGLMSLDVNRNEGKVTVKGFVDPKEVLKRAKKTG  60

Query  246  KKT*FW  263
            K+  FW
Sbjct  61   KQADFW  66



>ref|XP_010657601.1| PREDICTED: uncharacterized protein LOC100243595 [Vitis vinifera]
Length=167

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  VL++++K  K
Sbjct  102  QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLETKRVTVMGHVSPSGVLESISKV-K  160

Query  249  KT*FW  263
            K   W
Sbjct  161  KAELW  165



>emb|CAN60769.1| hypothetical protein VITISV_043918 [Vitis vinifera]
Length=196

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  VL++++K   
Sbjct  102  QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLETKRVTVMGHVSPSGVLESISKICD  161

Query  249  KT*FW  263
             T F 
Sbjct  162  NTTFM  166



>gb|KJB47189.1| hypothetical protein B456_008G014900 [Gossypium raimondii]
Length=164

 Score = 72.0 bits (175),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I +E ++VTV G+V P  VL++++K  K
Sbjct  99   QVVVMRVALHCQGCAGKVKKHLSKMEGVTSFSIELESKRVTVMGHVSPVGVLESISKV-K  157

Query  249  KT*FW  263
            K  FW
Sbjct  158  KAEFW  162



>ref|XP_007863821.1| hypothetical protein GLOTRDRAFT_98891 [Gloeophyllum trabeum ATCC 
11539]
 gb|EPQ58712.1| hypothetical protein GLOTRDRAFT_98891 [Gloeophyllum trabeum ATCC 
11539]
Length=72

 Score = 69.7 bits (169),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 33/64 (52%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS  T    V M+C GC GAV RVL K EGV S+DI++E+Q+V VKG +  D++L  + K
Sbjct  1    MSEHTYKFDVKMTCSGCSGAVDRVLKKAEGVSSYDISLEKQEVIVKGTIPYDDLLAKIQK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_004230641.1| PREDICTED: uncharacterized protein LOC101246479 [Solanum lycopersicum]
Length=178

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 1/73 (1%)
 Frame = +3

Query  45   IQFLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVL  224
            I +   S Q VV++V + CQGC G VK+ L KMEGV SF I+++ ++VTV G++ P  VL
Sbjct  102  IPYSDNSFQVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLDSKRVTVMGHLSPVSVL  161

Query  225  QTVTKTGKKT*FW  263
            ++++K  K+  FW
Sbjct  162  ESISKV-KRAEFW  173



>ref|XP_010261208.1| PREDICTED: uncharacterized protein LOC104600082 [Nelumbo nucifera]
Length=172

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV+KV + CQGC G V++ L KMEGV SF I++E ++VTV G++ P  +L++++K  K
Sbjct  106  QVVVMKVSLHCQGCAGKVRKHLSKMEGVTSFSIDLETKRVTVMGHISPAAILESISKV-K  164

Query  249  KT*FW  263
            K   W
Sbjct  165  KAELW  169



>ref|XP_003547074.2| PREDICTED: uncharacterized protein LOC100814406 isoform X1 [Glycine 
max]
Length=171

 Score = 71.6 bits (174),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF +++E ++VTV G++ P  VL++++K  K
Sbjct  106  QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSVDVESKRVTVMGHISPVGVLESISKV-K  164

Query  249  KT*FW  263
            +  FW
Sbjct  165  RAEFW  169



>gb|KHN33508.1| hypothetical protein glysoja_005550 [Glycine soja]
Length=160

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF +++E ++VTV G++ P  VL++++K  K
Sbjct  95   QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSVDVESKRVTVMGHISPVGVLESISKV-K  153

Query  249  KT*FW  263
            +  FW
Sbjct  154  RAEFW  158



>ref|XP_010687472.1| PREDICTED: uncharacterized protein LOC104901580 [Beta vulgaris 
subsp. vulgaris]
Length=167

 Score = 71.2 bits (173),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + CQ C G VK+ L +MEGV SF I+++ +KVT++G V P  VL++V+K  K
Sbjct  102  QVVVLRVSLHCQACAGKVKKHLSRMEGVTSFSIDLDTKKVTIRGQVSPTVVLESVSKI-K  160

Query  249  KT*FW  263
            K  FW
Sbjct  161  KAEFW  165



>gb|ABK22487.1| unknown [Picea sitchensis]
Length=215

 Score = 71.6 bits (174),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/69 (49%), Positives = 49/69 (71%), Gaps = 1/69 (1%)
 Frame = +3

Query  57   TMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVT  236
            T +++ VVL+V + CQGC G VK+ + KMEGV SF I++ +QKVTV GNV P EVL++++
Sbjct  142  TDATEVVVLRVSLHCQGCAGKVKKHISKMEGVTSFSIDLPKQKVTVVGNVTPLEVLESIS  201

Query  237  KTGKKT*FW  263
            +  K    W
Sbjct  202  RV-KNAELW  209



>gb|EMS62936.1| hypothetical protein TRIUR3_26593 [Triticum urartu]
Length=248

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/67 (52%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            ++Q VVL+V + C+GC G VK+ + KMEGV SFDI+I  +KVTV G+V P  VL +V+K 
Sbjct  170  TTQVVVLRVSLHCKGCAGKVKKHIAKMEGVTSFDIDIPSKKVTVVGDVTPLGVLTSVSKV  229

Query  243  GKKT*FW  263
             K   FW
Sbjct  230  -KPAQFW  235



>ref|XP_008674049.1| PREDICTED: vitellogenin [Zea mays]
 tpg|DAA54580.1| TPA: hypothetical protein ZEAMMB73_981027 [Zea mays]
Length=334

 Score = 73.2 bits (178),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + C+GC G VK+ L KMEGV SFDI+I  +KVTV G+V P  VL +++K  K
Sbjct  254  QVVVLRVSLHCKGCAGKVKKHLSKMEGVTSFDIDIATKKVTVVGDVTPLGVLNSISKV-K  312

Query  249  KT*FW  263
               FW
Sbjct  313  SAQFW  317



>ref|XP_009775803.1| PREDICTED: uncharacterized protein LOC104225657 [Nicotiana sylvestris]
Length=187

 Score = 71.2 bits (173),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I+++ ++VTV G+V P  VL++++K  K
Sbjct  123  QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLDSKRVTVMGHVSPVGVLESISKV-K  181

Query  249  KT*FW  263
            +  FW
Sbjct  182  RAEFW  186



>ref|XP_003618919.1| Copper transport protein ATOX1-like protein [Medicago truncatula]
 gb|AES75137.1| heavy metal transport/detoxification superfamily protein [Medicago 
truncatula]
Length=148

 Score = 70.5 bits (171),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/63 (51%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            V LKV M CQGC   ++RV+ K+ GV+S +I++E QKVTV G V   +VL+ V KTG+K 
Sbjct  18   VELKVHMDCQGCEERIRRVISKLNGVDSLEIDMENQKVTVTGYVDKSKVLRMVRKTGRKA  77

Query  255  *FW  263
             +W
Sbjct  78   EYW  80



>ref|XP_004504935.1| PREDICTED: uncharacterized protein LOC101489107 [Cicer arietinum]
Length=163

 Score = 70.9 bits (172),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P EV+++++K  K
Sbjct  96   QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDVESKRVTVMGHVSPVEVVESISKV-K  154

Query  249  KT*FW  263
            +   W
Sbjct  155  RAELW  159



>ref|XP_007321248.1| hypothetical protein SERLADRAFT_473829 [Serpula lacrymans var. 
lacrymans S7.9]
 gb|EGN95940.1| hypothetical protein SERLA73DRAFT_185373 [Serpula lacrymans var. 
lacrymans S7.3]
 gb|EGO21462.1| hypothetical protein SERLADRAFT_473829 [Serpula lacrymans var. 
lacrymans S7.9]
Length=72

 Score = 68.6 bits (166),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            M+  T    V MSC GC GAV+RVL K++GV S+DI++  Q+V VKG+   D VL+ + K
Sbjct  1    MADHTYKFNVKMSCSGCSGAVERVLKKLDGVSSYDISLANQEVIVKGSASYDTVLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_008809313.1| PREDICTED: uncharacterized protein LOC103721057 [Phoenix dactylifera]
Length=160

 Score = 70.5 bits (171),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G V++ + KMEGV SF I++E ++VTV G+V P  VL++++K  K
Sbjct  95   QVVVMRVSIHCQGCAGKVRKHISKMEGVTSFSIDLESKRVTVMGHVSPVGVLESISKV-K  153

Query  249  KT*FW  263
            +  FW
Sbjct  154  RAEFW  158



>gb|KDQ60788.1| hypothetical protein JAAARDRAFT_31766 [Jaapia argillacea MUCL 
33604]
Length=72

 Score = 68.6 bits (166),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 45/64 (70%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS  T    V M+C GC GA+ RVL K +GV S+DI++E+Q+V VKG +  D+VL+ + K
Sbjct  1    MSEHTYKFDVKMTCGGCSGAIDRVLKKTDGVSSYDISLEKQEVLVKGTIPYDDVLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_009612016.1| PREDICTED: uncharacterized protein LOC104105424 [Nicotiana tomentosiformis]
Length=188

 Score = 70.9 bits (172),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I+++ ++VTV G+V P  VL++++K  K
Sbjct  124  QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLDSKRVTVMGHVSPVGVLESISKV-K  182

Query  249  KT*FW  263
            +  FW
Sbjct  183  RAEFW  187



>ref|XP_008455533.1| PREDICTED: uncharacterized protein LOC103495684 [Cucumis melo]
Length=166

 Score = 70.5 bits (171),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
              VV++V + CQGC   VKR L KMEGV SF I++E ++VTV G++ P  VLQ+++K  K
Sbjct  99   HVVVMRVALHCQGCASKVKRHLSKMEGVTSFSIDLEAKRVTVMGHISPLGVLQSISKV-K  157

Query  249  KT*FW  263
            +   W
Sbjct  158  RAELW  162



>emb|CDO97473.1| unnamed protein product [Coffea canephora]
Length=167

 Score = 70.5 bits (171),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G+V P  V+++++K  K
Sbjct  99   QVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHVSPTGVVESISKV-K  157

Query  249  KT*FW  263
            +   W
Sbjct  158  RAELW  162



>ref|XP_005851421.1| hypothetical protein CHLNCDRAFT_137700 [Chlorella variabilis]
 gb|EFN59319.1| hypothetical protein CHLNCDRAFT_137700 [Chlorella variabilis]
Length=68

 Score = 68.2 bits (165),  Expect = 8e-12, Method: Compositional matrix adjust.
 Identities = 34/64 (53%), Positives = 45/64 (70%), Gaps = 1/64 (2%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKG-NVQPDEVLQTVTKTGKK  251
            V LKV M+C+GCVGAV+RV  K+ GV++ DI++  QKV VKG N+ P  V + V K+GK 
Sbjct  4    VALKVAMACEGCVGAVRRVAEKLPGVQAVDIDLAAQKVLVKGANLDPAAVKEGVAKSGKA  63

Query  252  T*FW  263
            T  W
Sbjct  64   TELW  67



>ref|XP_003525732.2| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
Length=148

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 45/63 (71%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            V LKV M CQGC   ++R + K+ G++S DI++++QKVTV G V+  +VL+ V +TG+K 
Sbjct  18   VELKVHMDCQGCEERIRRAISKLNGIDSLDIDMDQQKVTVTGYVEKGKVLRIVRRTGRKA  77

Query  255  *FW  263
             +W
Sbjct  78   EYW  80



>gb|ETS64554.1| hypothetical protein PaG_01019 [Pseudozyma aphidis DSM 70725]
Length=168

 Score = 70.1 bits (170),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 0/67 (0%)
 Frame = +3

Query  51   FLTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQT  230
            ++TMS       V M+C GC GAV+RVL K++GV+S+D+++E Q V V+G+   D VL+ 
Sbjct  94   YITMSEHEYKFDVVMTCSGCSGAVERVLSKLQGVDSYDVSLESQSVVVRGSAPFDTVLEK  153

Query  231  VTKTGKK  251
            + KTGK+
Sbjct  154  IKKTGKE  160



>ref|XP_008447442.1| PREDICTED: uncharacterized protein LOC103489885 [Cucumis melo]
Length=277

 Score = 71.2 bits (173),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S+Q VVL+V + C+GC G +++ L KMEGV SF+I+   +KVT+ GN+ P  +L++V+K 
Sbjct  189  SNQVVVLRVSLHCRGCEGKLRKHLSKMEGVNSFNIDFAAKKVTIMGNITPQGMLESVSKV  248

Query  243  GKKT*FW  263
             K   FW
Sbjct  249  -KNAQFW  254



>gb|KDQ33322.1| hypothetical protein PLEOSDRAFT_1110514 [Pleurotus ostreatus 
PC15]
Length=651

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Composition-based stats.
 Identities = 32/66 (48%), Positives = 49/66 (74%), Gaps = 0/66 (0%)
 Frame = +3

Query  54   LTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTV  233
            ++MS  T    V M+C GC GAV+RVL K +GV S+DI++E+Q+V VKG++  D++L+ +
Sbjct  578  ISMSDHTYKFDVKMTCSGCSGAVERVLKKTDGVSSYDISLEKQEVLVKGSIPYDDLLEKI  637

Query  234  TKTGKK  251
             KTGK+
Sbjct  638  KKTGKE  643



>ref|XP_010530606.1| PREDICTED: uncharacterized protein LOC104807161 [Tarenaya hassleriana]
Length=147

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/65 (51%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KM+GV+ F I++E + V V+GNV P E+L++V+K  K
Sbjct  82   QVVVMRVSIHCQGCAGKVKKHLSKMDGVKWFSIDLETKMVMVQGNVSPMELLESVSKI-K  140

Query  249  KT*FW  263
            K  FW
Sbjct  141  KAEFW  145



>ref|XP_007148430.1| hypothetical protein PHAVU_006G207900g [Phaseolus vulgaris]
 gb|ESW20424.1| hypothetical protein PHAVU_006G207900g [Phaseolus vulgaris]
Length=163

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + C+GC G VK+ L KMEGV SF +++E ++VTV G + P  VLQ+++K  K
Sbjct  98   QVVVMRVAIHCEGCAGKVKKHLSKMEGVTSFSVDVESKRVTVMGYISPVGVLQSISKV-K  156

Query  249  KT*FW  263
            +  FW
Sbjct  157  RAEFW  161



>ref|XP_004170944.1| PREDICTED: uncharacterized LOC101208798 [Cucumis sativus]
Length=285

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S+Q VVL+V + C+GC G +++ L KMEGV SF+I+   +KVT+ GN+ P  +L++V+K 
Sbjct  189  SNQVVVLRVSLHCRGCEGKLRKHLSKMEGVNSFNIDFAAKKVTIMGNITPQGMLESVSKV  248

Query  243  GKKT*FW  263
             K   FW
Sbjct  249  -KNAQFW  254



>ref|XP_007159084.1| hypothetical protein PHAVU_002G207200g [Phaseolus vulgaris]
 gb|ESW31078.1| hypothetical protein PHAVU_002G207200g [Phaseolus vulgaris]
Length=167

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E ++VTV G++ P  VL++++K  K
Sbjct  101  QVVVMRVAIHCQGCAGKVKKHLSKMEGVTSFSIDLESKRVTVMGHISPVAVLESISKV-K  159

Query  249  KT*FW  263
            +   W
Sbjct  160  RAELW  164



>ref|XP_009374689.1| PREDICTED: uncharacterized protein LOC103963579 [Pyrus x bretschneideri]
Length=301

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 33/67 (49%), Positives = 46/67 (69%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S+Q VVL V + C+GCVG +++ L +MEGV SF+I+   +KVTV G+V P  VL +V+K 
Sbjct  215  SNQVVVLMVSLHCKGCVGKLRKHLSRMEGVTSFNIDFAAKKVTVTGDVTPSSVLASVSKV  274

Query  243  GKKT*FW  263
             K   FW
Sbjct  275  -KNAQFW  280



>gb|EMS62935.1| hypothetical protein TRIUR3_26592 [Triticum urartu]
Length=304

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + C+GC G VK+ L KMEGV SFDI+I  +KVTV G+V P  VL +V K  K
Sbjct  228  QVVVLRVSLHCKGCAGKVKKHLAKMEGVTSFDIDIPSKKVTVVGDVTPLGVLTSVAKV-K  286

Query  249  KT*FW  263
               FW
Sbjct  287  PAQFW  291



>ref|XP_008218901.1| PREDICTED: uncharacterized protein LOC103319165 [Prunus mume]
Length=220

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 45/60 (75%), Gaps = 0/60 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF+I++E + VTV+G+V P  V+++++K  K
Sbjct  155  QVVVMRVSIHCQGCAGKVKKHLSKMEGVTSFNIDLETKMVTVRGHVSPSAVMESISKVKK  214



>ref|XP_008798426.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Phoenix dactylifera]
Length=151

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV LKV M C+GC   VK+ L  M+GV+S DIN ++QKVTV G V+P++VL+    TGK
Sbjct  26   QTVELKVRMDCEGCELKVKKALSSMKGVQSIDINRKQQKVTVVGYVEPNKVLKKAQSTGK  85

Query  249  KT*FW  263
            K   W
Sbjct  86   KAEIW  90



>ref|XP_007361198.1| copper chaperone taha [Dichomitus squalens LYAD-421 SS1]
 gb|EJF65936.1| copper chaperone taha [Dichomitus squalens LYAD-421 SS1]
Length=72

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS  T    V M+C GC GAV RVL K EGV S+DI++E+Q+V VKG +  D++   + K
Sbjct  1    MSEHTYKFNVKMTCSGCSGAVDRVLKKTEGVSSYDISLEKQEVIVKGTIPYDDLHAKIAK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>gb|KGN54216.1| hypothetical protein Csa_4G293260 [Cucumis sativus]
Length=281

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S+Q VVL+V + C+GC G +++ L KMEGV SF+I+   +KVT+ GN+ P  +L++V+K 
Sbjct  189  SNQVVVLRVSLHCRGCEGKLRKHLSKMEGVNSFNIDFAAKKVTIMGNITPQGMLESVSKV  248

Query  243  GKKT*FW  263
             K   FW
Sbjct  249  -KNAQFW  254



>gb|KGN43698.1| hypothetical protein Csa_7G060180 [Cucumis sativus]
Length=168

 Score = 69.7 bits (169),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
              VV++V + CQGC   VKR L +MEGV SF I++E ++VTV G++ P  VLQ+++K  K
Sbjct  101  HVVVMRVALHCQGCASKVKRHLSRMEGVTSFSIDLEAKRVTVMGHISPLGVLQSISKV-K  159

Query  249  KT*FW  263
            +   W
Sbjct  160  RAELW  164



>ref|XP_001865898.1| antioxidant enzyme [Culex quinquefasciatus]
 ref|XP_001869959.1| copper transport protein [Culex quinquefasciatus]
 gb|EDS30932.1| copper transport protein [Culex quinquefasciatus]
 gb|EDS42462.1| antioxidant enzyme [Culex quinquefasciatus]
Length=73

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/68 (51%), Positives = 49/68 (72%), Gaps = 1/68 (1%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKM-EGVESFDINIEEQKVTVKGNVQPDEVLQTVT  236
            M+SQT   KV M+C GC GAV+RVLGK+ E VE  DI+++ +KV V   +  DE+L+T+ 
Sbjct  1    MASQTHEFKVEMTCTGCSGAVERVLGKLKEKVEKVDIDLDNKKVFVTSALSADELLETIK  60

Query  237  KTGKKT*F  260
            KTGK+T +
Sbjct  61   KTGKETSY  68



>ref|XP_004489636.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Cicer arietinum]
Length=148

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            V LKV M CQGC   ++RV+ K+ GV+S +I++E QKVTV G V   +VL+ V +TG+K 
Sbjct  18   VELKVHMDCQGCEERIRRVISKLNGVDSLEIDMENQKVTVIGYVDKSKVLRIVRRTGRKA  77

Query  255  *FW  263
             +W
Sbjct  78   EYW  80



>ref|XP_010103837.1| hypothetical protein L484_024139 [Morus notabilis]
 gb|EXB97278.1| hypothetical protein L484_024139 [Morus notabilis]
Length=227

 Score = 70.5 bits (171),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/65 (48%), Positives = 46/65 (71%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G +K+ L KMEGV SF I +E ++VTV G+V P  VL++++K  +
Sbjct  146  QVVVMRVSLHCQGCAGKLKKHLSKMEGVTSFSIELETKRVTVMGHVSPAGVLESISKV-R  204

Query  249  KT*FW  263
            +  FW
Sbjct  205  RAEFW  209



>ref|XP_009542664.1| copper chaperone [Heterobasidion irregulare TC 32-1]
 gb|ETW85848.1| copper chaperone [Heterobasidion irregulare TC 32-1]
Length=72

 Score = 67.8 bits (164),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 46/64 (72%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS  +    V M+C GC GAV+RVL K EGV S+D+++E+Q+V VKG +  D++L+ + K
Sbjct  1    MSEHSYRFDVKMTCGGCSGAVERVLKKAEGVSSYDVSLEKQEVLVKGTIGYDDLLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_002457859.1| hypothetical protein SORBIDRAFT_03g016720 [Sorghum bicolor]
 gb|EES02979.1| hypothetical protein SORBIDRAFT_03g016720 [Sorghum bicolor]
Length=327

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/66 (52%), Positives = 46/66 (70%), Gaps = 1/66 (2%)
 Frame = +3

Query  66   SQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTG  245
            +Q VVL+V + C+GC G VK+ + KMEGV SFDI+I  +KVTV G+V P  VL +++K  
Sbjct  246  NQVVVLRVSLHCKGCAGKVKKHISKMEGVTSFDIDIATKKVTVVGDVTPLGVLNSISKV-  304

Query  246  KKT*FW  263
            K   FW
Sbjct  305  KSAQFW  310



>ref|XP_006645411.1| PREDICTED: uncharacterized protein LOC102709416 [Oryza brachyantha]
Length=202

 Score = 70.1 bits (170),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 44/65 (68%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + C+GC G VK+ + +MEGV S DI+I  +KVTV G+V P  VL TV+K  K
Sbjct  119  QVVVLRVSLHCKGCAGKVKKHISRMEGVTSLDIDIATKKVTVVGDVTPLAVLSTVSKI-K  177

Query  249  KT*FW  263
               FW
Sbjct  178  PAQFW  182



>gb|ABK22742.1| unknown [Picea sitchensis]
Length=152

 Score = 69.3 bits (168),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV L+V M C+GC   + +VL  M GV++ DIN + QKVTV G V+P++VL+ V +TGK
Sbjct  28   QTVELRVRMDCEGCERKINKVLSSMSGVQTVDINRKMQKVTVTGYVEPNKVLKKVKRTGK  87

Query  249  KT*FW  263
            +   W
Sbjct  88   RAELW  92



>ref|XP_004968755.1| PREDICTED: uncharacterized protein LOC101762466 [Setaria italica]
Length=380

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + C+GC G VK+ + KMEGV SFDI+I  +KVTV G+V P  VL +++K  K
Sbjct  300  QVVVLRVSLHCKGCAGKVKKHISKMEGVTSFDIDIATKKVTVVGDVTPLGVLNSISKV-K  358

Query  249  KT*FW  263
               FW
Sbjct  359  SAQFW  363



>emb|CBI20049.3| unnamed protein product [Vitis vinifera]
Length=238

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 37/85 (44%), Positives = 53/85 (62%), Gaps = 6/85 (7%)
 Frame = +3

Query  24   LCFFFL*IQFLTMSSQ-----TVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKV  188
            + F+ + I  L M  Q      VV++V + CQGC G VK+ L KMEGV SF I++E ++V
Sbjct  153  MSFYKIKIISLYMHCQKNIFNVVVMRVSLHCQGCAGKVKKHLSKMEGVTSFSIDLETKRV  212

Query  189  TVKGNVQPDEVLQTVTKTGKKT*FW  263
            TV G+V P  VL++++K  KK   W
Sbjct  213  TVMGHVSPSGVLESISKV-KKAELW  236



>ref|XP_007226847.1| hypothetical protein PRUPE_ppa017295mg [Prunus persica]
 gb|EMJ28046.1| hypothetical protein PRUPE_ppa017295mg [Prunus persica]
Length=221

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G VK+ L KMEGV SF I++E + VTV+G+V P  V+++++K  K
Sbjct  156  QVVVMRVSIHCQGCAGKVKKHLSKMEGVTSFSIDLETKMVTVRGHVSPSAVMESISKVKK  215



>gb|ABK24206.1| unknown [Picea sitchensis]
Length=152

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV L+V M C+GC   + +VL  M GV++ DIN + QKVTV G V+P++VL+ V +TGK
Sbjct  28   QTVELRVRMDCEGCERKINKVLSSMSGVQTVDINRKMQKVTVTGYVEPNKVLKKVKRTGK  87

Query  249  KT*FW  263
            +   W
Sbjct  88   RAELW  92



>ref|NP_001241088.1| uncharacterized protein LOC100778653 [Glycine max]
 gb|ACU20497.1| unknown [Glycine max]
Length=155

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV LKV M C GCV  VK+ L  ++GV+S +IN ++QKVTV G V+P++VL+    TGK
Sbjct  29   QTVELKVMMDCDGCVLKVKKALSSLDGVKSVEINRKQQKVTVTGYVEPNKVLKKANSTGK  88

Query  249  KT*FW  263
            K   W
Sbjct  89   KAEIW  93



>ref|XP_006378456.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
 gb|ERP56253.1| hypothetical protein POPTR_0010s12480g [Populus trichocarpa]
Length=130

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 46/67 (69%), Gaps = 0/67 (0%)
 Frame = +3

Query  63   SSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKT  242
            S QTV +KV M C GC   VK  +  M+GV+S ++N ++ +VTV GNV+P++VL+ V  T
Sbjct  6    SFQTVDIKVKMDCDGCERRVKNSVSSMKGVKSVEVNRKQSRVTVSGNVEPNKVLKKVKST  65

Query  243  GKKT*FW  263
            GK+  FW
Sbjct  66   GKRAEFW  72



>gb|EMT29987.1| hypothetical protein F775_17366 [Aegilops tauschii]
Length=166

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 35/65 (54%), Positives = 45/65 (69%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VVL+V + C+GC G VK+ + KMEGV SFDI+I  +KVTV G+V P  VL +V+K  K
Sbjct  90   QVVVLRVSLHCKGCAGKVKKHIAKMEGVTSFDIDIPSKKVTVVGDVTPLGVLTSVSKV-K  148

Query  249  KT*FW  263
               FW
Sbjct  149  PAQFW  153



>ref|XP_011070194.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Sesamum indicum]
Length=149

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/70 (41%), Positives = 47/70 (67%), Gaps = 0/70 (0%)
 Frame = +3

Query  54   LTMSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTV  233
            ++ S   V L V M C+GC   ++R + K+ GV+S DI++E+QKVTV+G V+   VL+ V
Sbjct  13   VSNSMSIVELLVRMDCEGCEKRIRRAISKLNGVDSVDIDMEKQKVTVRGYVEKSRVLKVV  72

Query  234  TKTGKKT*FW  263
             ++G++  FW
Sbjct  73   RRSGRRAEFW  82



>ref|XP_011390806.1| putative copper metallochaperone ATX1 [Ustilago maydis 521]
 gb|KIS67686.1| putative copper metallochaperone ATX1 [Ustilago maydis 521]
Length=72

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 31/64 (48%), Positives = 44/64 (69%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS       V M+C GC GAV RVLGK++GV+S+D+++E Q V VKG+   + VL+ + K
Sbjct  1    MSQHEYKFHVVMTCSGCSGAVSRVLGKLDGVDSYDVSLENQSVVVKGSAPFETVLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



>ref|XP_010905917.1| PREDICTED: uncharacterized protein LOC105033001 [Elaeis guineensis]
Length=160

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 30/65 (46%), Positives = 47/65 (72%), Gaps = 1/65 (2%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV++V + CQGC G V++ + KMEGV S+ I++E ++VTV G+V P  VL++++K  K
Sbjct  95   QVVVMRVSIHCQGCAGKVRKHISKMEGVTSYSIDLESKRVTVMGHVSPVGVLESISKV-K  153

Query  249  KT*FW  263
            +  FW
Sbjct  154  RAEFW  158



>ref|XP_010248218.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26 [Nelumbo nucifera]
Length=147

 Score = 68.6 bits (166),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 28/63 (44%), Positives = 44/63 (70%), Gaps = 0/63 (0%)
 Frame = +3

Query  75   VVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGKKT  254
            V L V M C+GC   ++R + K++G++S DI++++QKVTV G V   +VL+ V +TG+K 
Sbjct  17   VELLVHMDCEGCEKRIRRAISKLDGIDSLDIDMDKQKVTVTGYVDQRDVLKAVRRTGRKA  76

Query  255  *FW  263
             FW
Sbjct  77   EFW  79



>ref|XP_008783756.1| PREDICTED: uncharacterized protein LOC103702895 [Phoenix dactylifera]
Length=210

 Score = 69.3 bits (168),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 47/68 (69%), Gaps = 0/68 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            +S QTV LKVGM C GC   VK  L K+ GV+S ++++E +KVTV G V  ++VL+ V +
Sbjct  77   LSLQTVELKVGMCCTGCERVVKNALLKLRGVDSVEVDLELEKVTVTGYVDRNKVLKEVRR  136

Query  240  TGKKT*FW  263
            +GKK  FW
Sbjct  137  SGKKAEFW  144



>ref|XP_003552099.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Glycine max]
 gb|KHN31351.1| hypothetical protein glysoja_023005 [Glycine soja]
Length=157

 Score = 68.9 bits (167),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV LKV M C GCV  V++ L  ++GVES +IN ++QKVTV G V+P++VL+    TGK
Sbjct  31   QTVELKVMMDCDGCVLKVRKTLSSLDGVESVEINRKQQKVTVTGYVEPNKVLKKAKSTGK  90

Query  249  KT*FW  263
            K   W
Sbjct  91   KAEIW  95



>ref|XP_010044169.1| PREDICTED: heavy metal-associated isoprenylated plant protein 
26-like [Eucalyptus grandis]
 gb|KCW86205.1| hypothetical protein EUGRSUZ_B02894 [Eucalyptus grandis]
Length=146

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV +KV M C GC   VK V+  M+GV+S ++N ++ +VTV+G+V+P++VLQ V  TGK
Sbjct  24   QTVEIKVKMDCDGCERRVKSVVSSMKGVKSVEVNRKQSRVTVRGHVEPNKVLQRVKSTGK  83

Query  249  KT*FW  263
            K   W
Sbjct  84   KAELW  88



>gb|KHN44322.1| hypothetical protein glysoja_014363 [Glycine soja]
Length=155

 Score = 68.6 bits (166),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/65 (52%), Positives = 45/65 (69%), Gaps = 0/65 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            QTV LKV M C GCV  VK+ L  ++GV+S +IN ++QKVTV G V+P++VL+    TGK
Sbjct  29   QTVELKVMMDCDGCVLKVKKALSSLDGVKSVEINRKQQKVTVTGYVEPNKVLKKAKSTGK  88

Query  249  KT*FW  263
            K   W
Sbjct  89   KAEIW  93



>ref|XP_006660117.1| PREDICTED: uncharacterized protein LOC102713206 [Oryza brachyantha]
Length=136

 Score = 68.2 bits (165),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 31/60 (52%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +3

Query  69   QTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTKTGK  248
            Q VV+KV + CQGC G V++ + KMEGV SF I++E +KVTV G+V P  VL++++K  K
Sbjct  71   QVVVMKVAIHCQGCAGKVRKHISKMEGVTSFSIDLESKKVTVMGHVSPAGVLESISKVKK  130



>gb|KDN47548.1| putative ATX1-antioxidant protein and metal homeostasis factor 
[Tilletiaria anomala UBC 951]
Length=72

 Score = 66.6 bits (161),  Expect = 3e-11, Method: Compositional matrix adjust.
 Identities = 32/64 (50%), Positives = 43/64 (67%), Gaps = 0/64 (0%)
 Frame = +3

Query  60   MSSQTVVLKVGMSCQGCVGAVKRVLGKMEGVESFDINIEEQKVTVKGNVQPDEVLQTVTK  239
            MS      +V M+C GC GAV RVL K+EGV SFD+++E+Q V VKG    + VL+ + K
Sbjct  1    MSEHEYKFEVVMTCSGCSGAVTRVLSKLEGVSSFDVSLEKQSVVVKGTAPYETVLEKIKK  60

Query  240  TGKK  251
            TGK+
Sbjct  61   TGKE  64



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 788578232940