BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A14

Length=476
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK48495.1|AF259983_1  putative cysteine protease                    250   8e-78   Ipomoea batatas [batate]
ref|XP_011069730.1|  PREDICTED: low-temperature-induced cysteine ...    192   2e-55   Sesamum indicum [beniseed]
dbj|BAF46304.1|  cysteine proteinase precursor                          185   1e-52   Ipomoea nil [qian niu]
emb|CDP01294.1|  unnamed protein product                                181   3e-51   Coffea canephora [robusta coffee]
gb|AGV15823.1|  cysteine protease CP15                                  179   2e-50   Nicotiana tabacum [American tobacco]
ref|XP_003545327.1|  PREDICTED: cysteine proteinase RD21a-like          179   2e-50   
ref|XP_009775102.1|  PREDICTED: low-temperature-induced cysteine ...    178   4e-50   Nicotiana sylvestris
ref|XP_011074404.1|  PREDICTED: low-temperature-induced cysteine ...    177   5e-50   Sesamum indicum [beniseed]
ref|XP_009604895.1|  PREDICTED: low-temperature-induced cysteine ...    176   2e-49   Nicotiana tomentosiformis
dbj|BAE80740.1|  cysteine proteinase                                    176   2e-49   Platycodon grandiflorus [balloon-flower]
ref|XP_004238129.1|  PREDICTED: low-temperature-induced cysteine ...    175   4e-49   Solanum lycopersicum
ref|XP_006354848.1|  PREDICTED: cysteine proteinase RD21a-like          175   5e-49   
ref|XP_006434711.1|  hypothetical protein CICLE_v100010541mg            166   6e-49   
ref|XP_009613155.1|  PREDICTED: low-temperature-induced cysteine ...    174   9e-49   Nicotiana tomentosiformis
ref|XP_009769754.1|  PREDICTED: low-temperature-induced cysteine ...    174   1e-48   Nicotiana sylvestris
ref|NP_001234324.1|  low-temperature-induced cysteine proteinase ...    174   1e-48   Solanum lycopersicum
gb|KCW66364.1|  hypothetical protein EUGRSUZ_F00184                     173   3e-48   Eucalyptus grandis [rose gum]
ref|XP_010059895.1|  PREDICTED: low-temperature-induced cysteine ...    173   3e-48   Eucalyptus grandis [rose gum]
gb|KHN22488.1|  Cysteine proteinase RD21a                               172   5e-48   Glycine soja [wild soybean]
ref|XP_003550321.1|  PREDICTED: cysteine proteinase RD21a-like          172   5e-48   Glycine max [soybeans]
ref|XP_007160879.1|  hypothetical protein PHAVU_001G024500g             172   9e-48   Phaseolus vulgaris [French bean]
emb|CAB17076.1|  cysteine proteinase precursor                          171   1e-47   Phaseolus vulgaris [French bean]
ref|XP_006342644.1|  PREDICTED: low-temperature-induced cysteine ...    171   1e-47   Solanum tuberosum [potatoes]
ref|NP_001274877.1|  low-temperature-induced cysteine proteinase-...    171   1e-47   Solanum tuberosum [potatoes]
gb|EYU36326.1|  hypothetical protein MIMGU_mgv1a005614mg                169   1e-46   Erythranthe guttata [common monkey flower]
ref|XP_011029381.1|  PREDICTED: cysteine proteinase RD21a               169   1e-46   Populus euphratica
gb|EPS63305.1|  hypothetical protein M569_11479                         168   1e-46   Genlisea aurea
ref|XP_006473275.1|  PREDICTED: cysteine proteinase RD21a-like          167   5e-46   Citrus sinensis [apfelsine]
gb|AFO83614.1|  papain-like cysteine protease                           166   8e-46   Fagopyrum esculentum
gb|AAL14614.1|AF417109_1  cysteine proteinase precursor                 159   1e-45   Vasconcellea cundinamarcensis
gb|AAU81594.1|  cysteine proteinase                                     158   1e-45   Petunia x hybrida [garden petunia]
gb|KJB14609.1|  hypothetical protein B456_002G133800                    166   1e-45   Gossypium raimondii
ref|XP_008393776.1|  PREDICTED: low-temperature-induced cysteine ...    166   2e-45   
ref|XP_002284973.1|  PREDICTED: low-temperature-induced cysteine ...    165   3e-45   Vitis vinifera
emb|CAN61026.1|  hypothetical protein VITISV_001146                     165   3e-45   Vitis vinifera
gb|ABG33750.1|  cysteine protease                                       164   3e-45   Hevea brasiliensis [jebe]
gb|AAX84673.1|  cysteine protease CP1                                   165   4e-45   Manihot esculenta [manioc]
ref|XP_006374886.1|  cysteine proteinase                                164   9e-45   Populus trichocarpa [western balsam poplar]
ref|XP_003589134.1|  Cysteine proteinase                                160   1e-44   
ref|XP_007017153.1|  Granulin repeat cysteine protease family pro...    163   1e-44   Theobroma cacao [chocolate]
gb|KDP41692.1|  hypothetical protein JCGZ_16099                         163   2e-44   Jatropha curcas
ref|XP_009359945.1|  PREDICTED: low-temperature-induced cysteine ...    162   3e-44   Pyrus x bretschneideri [bai li]
gb|KHG05637.1|  Cysteinease RD21a -like protein                         162   3e-44   Gossypium arboreum [tree cotton]
gb|KJB14610.1|  hypothetical protein B456_002G133800                    162   3e-44   Gossypium raimondii
ref|XP_009354165.1|  PREDICTED: low-temperature-induced cysteine ...    161   1e-43   Pyrus x bretschneideri [bai li]
gb|AJA74414.1|  cysteine protease                                       160   2e-43   Cicer arietinum [garbanzo]
ref|XP_003589135.1|  Cysteine proteinase                                159   3e-43   
gb|AER60490.1|  cysteine proteases                                      158   3e-43   Gossypium hirsutum [American cotton]
dbj|BAD29957.1|  cysteine protease                                      159   3e-43   Daucus carota [carrots]
ref|XP_003589133.1|  Cysteine proteinase                                159   4e-43   Medicago truncatula
ref|XP_008236565.1|  PREDICTED: cysteine proteinase RD21a-like          159   5e-43   Prunus mume [ume]
gb|KHG12125.1|  Cysteinease RD21a -like protein                         160   5e-43   Gossypium arboreum [tree cotton]
gb|ABQ10204.1|  cysteine protease Cp6                                   159   6e-43   Actinidia deliciosa [Chinese gooseberry]
ref|XP_010270819.1|  PREDICTED: cysteine proteinase RD21a-like          159   8e-43   Nelumbo nucifera [Indian lotus]
ref|XP_007222885.1|  hypothetical protein PRUPE_ppa005199mg             158   1e-42   Prunus persica
gb|KJB48623.1|  hypothetical protein B456_008G078300                    152   1e-42   Gossypium raimondii
ref|XP_002510170.1|  cysteine protease, putative                        158   1e-42   Ricinus communis
gb|KJB48624.1|  hypothetical protein B456_008G078300                    154   2e-42   Gossypium raimondii
gb|KJB48626.1|  hypothetical protein B456_008G078300                    153   2e-42   Gossypium raimondii
ref|XP_008220266.1|  PREDICTED: low-temperature-induced cysteine ...    157   2e-42   Prunus mume [ume]
ref|XP_006494485.1|  PREDICTED: cysteine proteinase RD21a-like          155   2e-42   Citrus sinensis [apfelsine]
gb|KDO79088.1|  hypothetical protein CISIN_1g017419mg                   155   2e-42   Citrus sinensis [apfelsine]
ref|XP_004291075.1|  PREDICTED: cysteine proteinase RD21a               155   8e-42   Fragaria vesca subsp. vesca
gb|AEZ65083.1|  cysteine protease                                       155   8e-42   Carica papaya [mamon]
gb|ABQ10200.1|  cysteine protease Cp2                                   154   1e-41   Actinidia deliciosa [Chinese gooseberry]
gb|KJB48622.1|  hypothetical protein B456_008G078300                    153   2e-41   Gossypium raimondii
gb|KJB48625.1|  hypothetical protein B456_008G078300                    153   2e-41   Gossypium raimondii
ref|XP_008365104.1|  PREDICTED: low-temperature-induced cysteine ...    154   2e-41   
ref|XP_004499026.1|  PREDICTED: cysteine proteinase RD21a-like          154   2e-41   Cicer arietinum [garbanzo]
dbj|BAD29960.1|  cysteine protease                                      154   3e-41   Daucus carota [carrots]
ref|XP_004230752.1|  PREDICTED: cysteine proteinase RD21a-like          154   3e-41   Solanum lycopersicum
ref|XP_008342944.1|  PREDICTED: cysteine proteinase RD21a-like          154   5e-41   
ref|XP_011088223.1|  PREDICTED: low-temperature-induced cysteine ...    153   6e-41   Sesamum indicum [beniseed]
ref|XP_006346518.1|  PREDICTED: cysteine proteinase RD21a-like          153   6e-41   Solanum tuberosum [potatoes]
emb|CAE54307.1|  cysteine proteinase                                    151   6e-41   Gossypium hirsutum [American cotton]
ref|XP_010094652.1|  Cysteine proteinase RD21a                          153   8e-41   Morus notabilis
ref|XP_009772520.1|  PREDICTED: cysteine proteinase RD21a-like          152   1e-40   Nicotiana sylvestris
ref|XP_007199820.1|  hypothetical protein PRUPE_ppa005328mg             152   1e-40   
ref|XP_006425969.1|  hypothetical protein CICLE_v10025887mg             150   2e-40   Citrus clementina [clementine]
gb|KJB58559.1|  hypothetical protein B456_009G214900                    151   2e-40   Gossypium raimondii
gb|EYU25464.1|  hypothetical protein MIMGU_mgv1a006201mg                151   2e-40   Erythranthe guttata [common monkey flower]
gb|KJB58557.1|  hypothetical protein B456_009G214900                    151   3e-40   Gossypium raimondii
gb|KJB58558.1|  hypothetical protein B456_009G214900                    151   4e-40   Gossypium raimondii
ref|XP_009591184.1|  PREDICTED: cysteine proteinase RD21a-like          150   5e-40   Nicotiana tomentosiformis
dbj|BAD29958.1|  cysteine protease                                      151   5e-40   Daucus carota [carrots]
emb|CDO97206.1|  unnamed protein product                                150   5e-40   Coffea canephora [robusta coffee]
gb|KDP31986.1|  hypothetical protein JCGZ_12447                         149   6e-40   Jatropha curcas
gb|KHN04480.1|  Cysteine proteinase RD21a                               149   7e-40   Glycine soja [wild soybean]
ref|XP_010244238.1|  PREDICTED: cysteine proteinase RD21a-like          150   1e-39   Nelumbo nucifera [Indian lotus]
emb|CAA46863.1|  thiolprotease                                          150   1e-39   Pisum sativum [garden pea]
dbj|BAC75923.1|  cysteine protease-1                                    149   1e-39   Helianthus annuus
gb|KHG00992.1|  Cysteinease RD21a -like protein                         148   2e-39   Gossypium arboreum [tree cotton]
ref|XP_010556436.1|  PREDICTED: cysteine proteinase RD21a-like          149   2e-39   Tarenaya hassleriana [spider flower]
gb|KJB63901.1|  hypothetical protein B456_010G022700                    149   2e-39   Gossypium raimondii
gb|ABQ10202.1|  cysteine protease Cp4                                   149   2e-39   Actinidia deliciosa [Chinese gooseberry]
emb|CAQ00115.1|  papain-like cysteine proteinase                        142   3e-39   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008361440.1|  PREDICTED: cysteine proteinase RD21a-like          145   3e-39   
ref|XP_009335016.1|  PREDICTED: cysteine proteinase RD21a-like is...    148   4e-39   Pyrus x bretschneideri [bai li]
ref|XP_009335017.1|  PREDICTED: cysteine proteinase RD21a-like is...    148   5e-39   Pyrus x bretschneideri [bai li]
ref|XP_010549252.1|  PREDICTED: cysteine proteinase RD21a-like          148   5e-39   Tarenaya hassleriana [spider flower]
ref|NP_001242660.1|  uncharacterized protein LOC100807362 precursor     146   6e-39   Glycine max [soybeans]
ref|XP_011097243.1|  PREDICTED: cysteine proteinase COT44               146   7e-39   Sesamum indicum [beniseed]
ref|XP_002863697.1|  hypothetical protein ARALYDRAFT_917391             147   9e-39   Arabidopsis lyrata subsp. lyrata
gb|AAQ62999.1|  oil palm polygalacturonase allergen PEST472             148   9e-39   Elaeis guineensis
ref|XP_002524912.1|  cysteine protease, putative                        145   1e-38   
ref|XP_008377786.1|  PREDICTED: cysteine proteinase RD21a-like          145   1e-38   
ref|NP_568620.1|  Granulin repeat cysteine protease family protein      147   1e-38   Arabidopsis thaliana [mouse-ear cress]
ref|XP_007042494.1|  Granulin repeat cysteine protease family pro...    147   2e-38   
ref|XP_010494270.1|  PREDICTED: cysteine proteinase RD21a-like          146   3e-38   Camelina sativa [gold-of-pleasure]
ref|XP_006280322.1|  hypothetical protein CARUB_v10026245mg             146   4e-38   
gb|KJB43804.1|  hypothetical protein B456_007G216900                    142   5e-38   Gossypium raimondii
ref|XP_003603086.1|  Cysteine proteinase                                145   5e-38   Medicago truncatula
ref|XP_010540378.1|  PREDICTED: cysteine proteinase RD21a-like          145   5e-38   Tarenaya hassleriana [spider flower]
ref|XP_010070600.1|  PREDICTED: cysteine proteinase COT44-like          144   6e-38   Eucalyptus grandis [rose gum]
ref|XP_010481911.1|  PREDICTED: cysteine proteinase RD21a               145   8e-38   Camelina sativa [gold-of-pleasure]
ref|XP_010061721.1|  PREDICTED: low-temperature-induced cysteine ...    144   1e-37   Eucalyptus grandis [rose gum]
ref|XP_008799871.1|  PREDICTED: oryzain alpha chain-like isoform X1     144   1e-37   
gb|KCW68708.1|  hypothetical protein EUGRSUZ_F02310                     144   1e-37   Eucalyptus grandis [rose gum]
ref|XP_011000919.1|  PREDICTED: cysteine proteinase RD21a-like          144   1e-37   Populus euphratica
gb|ABR19827.1|  cysteine proteinase                                     144   2e-37   Elaeis guineensis
ref|XP_010906541.1|  PREDICTED: oryzain alpha chain-like                144   2e-37   Elaeis guineensis
gb|KJB14608.1|  hypothetical protein B456_002G133800                    141   4e-37   Gossypium raimondii
ref|XP_009618803.1|  PREDICTED: cysteine proteinase COT44-like          141   4e-37   Nicotiana tomentosiformis
gb|KJB43805.1|  hypothetical protein B456_007G216900                    141   4e-37   Gossypium raimondii
gb|KJB43803.1|  hypothetical protein B456_007G216900                    141   4e-37   Gossypium raimondii
ref|XP_007047371.1|  Granulin repeat cysteine protease family pro...    141   5e-37   
ref|XP_009395501.1|  PREDICTED: oryzain alpha chain-like                142   5e-37   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACB87490.1|  mucunain                                                142   5e-37   Mucuna pruriens
ref|XP_002518705.1|  cysteine protease, putative                        142   6e-37   Ricinus communis
ref|XP_010928366.1|  PREDICTED: oryzain alpha chain-like                142   6e-37   Elaeis guineensis
gb|AAK07730.1|  CPR1-like cysteine proteinase                           141   7e-37   Nicotiana tabacum [American tobacco]
ref|XP_009784112.1|  PREDICTED: cysteine proteinase COT44-like          140   1e-36   Nicotiana sylvestris
ref|XP_010442084.1|  PREDICTED: cysteine proteinase RD21a-like          141   1e-36   Camelina sativa [gold-of-pleasure]
gb|ABQ10198.1|  actinidin Act4b                                         140   2e-36   Actinidia eriantha
ref|XP_002313136.2|  hypothetical protein POPTR_0009s10090g             141   2e-36   
ref|XP_002310708.2|  hypothetical protein POPTR_0007s10650g             140   2e-36   Populus trichocarpa [western balsam poplar]
gb|EYU34557.1|  hypothetical protein MIMGU_mgv1a007408mg                140   2e-36   Erythranthe guttata [common monkey flower]
ref|XP_006595983.1|  PREDICTED: cysteine proteinase RD21a-like          137   2e-36   
ref|XP_004136967.1|  PREDICTED: cysteine proteinase RD21a-like          141   2e-36   Cucumis sativus [cucumbers]
emb|CDX71540.1|  BnaC04g17750D                                          140   3e-36   
ref|XP_008813817.1|  PREDICTED: low-temperature-induced cysteine ...    140   3e-36   Phoenix dactylifera
gb|AAL60579.1|AF454957_1  senescence-associated cysteine protease       140   3e-36   Brassica oleracea
ref|XP_004171356.1|  PREDICTED: cysteine proteinase RD21a-like          134   3e-36   
ref|XP_002285299.1|  PREDICTED: cysteine proteinase RD21a-like          140   3e-36   Vitis vinifera
ref|XP_002306486.2|  hypothetical protein POPTR_0005s18520g             139   3e-36   
ref|XP_002283263.1|  PREDICTED: cysteine proteinase COT44               139   3e-36   Vitis vinifera
gb|EYU37647.1|  hypothetical protein MIMGU_mgv1a005905mg                140   4e-36   Erythranthe guttata [common monkey flower]
gb|KFK31760.1|  hypothetical protein AALP_AA6G155800                    140   4e-36   Arabis alpina [alpine rockcress]
ref|XP_006343212.1|  PREDICTED: cysteine proteinase RD21a-like          139   4e-36   
ref|XP_007205396.1|  hypothetical protein PRUPE_ppa007467mg             138   5e-36   Prunus persica
gb|ACU18172.1|  unknown                                                 138   5e-36   Glycine max [soybeans]
emb|CAB16317.1|  cysteine proteinase precursor                          138   6e-36   Nicotiana tabacum [American tobacco]
gb|KHN27075.1|  Cysteine proteinase RD21a                               138   6e-36   Glycine soja [wild soybean]
ref|XP_003550041.1|  PREDICTED: cysteine proteinase RD21a-like          138   6e-36   Glycine max [soybeans]
ref|XP_006307278.1|  hypothetical protein CARUB_v10008893mg             140   7e-36   
ref|XP_008350332.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    139   7e-36   
ref|XP_009358749.1|  PREDICTED: cysteine proteinase RD21a-like          139   7e-36   Pyrus x bretschneideri [bai li]
emb|CDY22370.1|  BnaA06g36920D                                          139   9e-36   Brassica napus [oilseed rape]
ref|XP_009101816.1|  PREDICTED: cysteine proteinase RD21a               139   9e-36   Brassica rapa
ref|XP_010028205.1|  PREDICTED: cysteine proteinase COT44-like          137   1e-35   Eucalyptus grandis [rose gum]
ref|XP_011000142.1|  PREDICTED: cysteine proteinase RD21a-like          139   1e-35   Populus euphratica
ref|XP_008454976.1|  PREDICTED: low-temperature-induced cysteine ...    139   1e-35   Cucumis melo [Oriental melon]
gb|ACU13684.1|  unknown                                                 134   1e-35   Glycine max [soybeans]
gb|ABQ10192.1|  actinidin Act2a                                         137   2e-35   Actinidia deliciosa [Chinese gooseberry]
ref|XP_002298740.2|  hypothetical protein POPTR_0001s30950g             138   2e-35   
gb|KHG18408.1|  Cysteinease RD21a -like protein                         137   2e-35   Gossypium arboreum [tree cotton]
gb|KDP47124.1|  hypothetical protein JCGZ_22120                         134   2e-35   Jatropha curcas
ref|XP_009390984.1|  PREDICTED: oryzain alpha chain-like                138   2e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KFK44641.1|  hypothetical protein AALP_AA1G285100                    137   3e-35   Arabis alpina [alpine rockcress]
gb|KHN22490.1|  Cysteine proteinase RD21a                               136   3e-35   Glycine soja [wild soybean]
gb|AAL60580.1|AF454958_1  senescence-associated cysteine protease       138   3e-35   Brassica oleracea
ref|XP_010691718.1|  PREDICTED: cysteine proteinase RD21a-like          137   7e-35   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009398671.1|  PREDICTED: oryzain alpha chain-like                137   7e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006393620.1|  hypothetical protein EUTSA_v10011464mg             136   1e-34   Eutrema salsugineum [saltwater cress]
ref|XP_008344336.1|  PREDICTED: probable cysteine proteinase At3g...    129   1e-34   
tpg|DAA35450.1|  TPA: cysteine protease 1                               136   1e-34   
ref|XP_006403303.1|  hypothetical protein EUTSA_v10003205mg             136   1e-34   Eutrema salsugineum [saltwater cress]
gb|ABQ10191.1|  actinidin Act1c                                         134   2e-34   Actinidia eriantha
ref|XP_004234718.1|  PREDICTED: cysteine proteinase COT44-like          134   2e-34   
gb|KHN30007.1|  Cysteine proteinase RD21a                               134   2e-34   Glycine soja [wild soybean]
gb|AEZ65082.1|  cysteine protease                                       135   3e-34   Carica papaya [mamon]
ref|XP_008238897.1|  PREDICTED: cysteine proteinase COT44               134   3e-34   Prunus mume [ume]
ref|XP_002894032.1|  F2G19.31/F2G19.31                                  134   3e-34   
ref|NP_001150196.1|  cysteine protease 1 precursor                      134   4e-34   Zea mays [maize]
ref|XP_003547817.1|  PREDICTED: cysteine proteinase RD21a               133   4e-34   Glycine max [soybeans]
ref|XP_008357550.1|  PREDICTED: probable cysteine proteinase At3g...    128   5e-34   
gb|ABQ10196.1|  actinidin Act3a                                         133   6e-34   Actinidia eriantha
ref|XP_006422960.1|  hypothetical protein CICLE_v10028338mg             134   6e-34   Citrus clementina [clementine]
ref|XP_008452589.1|  PREDICTED: low-temperature-induced cysteine ...    134   6e-34   
gb|ABQ10195.1|  actinidin Act2d                                         132   1e-33   Actinidia eriantha
ref|XP_004960236.1|  PREDICTED: oryzain beta chain-like isoform X1      134   1e-33   
ref|XP_011008779.1|  PREDICTED: cysteine proteinase COT44               132   1e-33   Populus euphratica
dbj|BAG16371.1|  cysteine protease                                      133   1e-33   Brassica oleracea var. italica [asparagus broccoli]
gb|ABQ10193.1|  actinidin Act2b                                         132   1e-33   Actinidia eriantha
ref|XP_004231872.1|  PREDICTED: zingipain-2-like                        132   1e-33   Solanum lycopersicum
emb|CDY17093.1|  BnaC06g00260D                                          133   1e-33   Brassica napus [oilseed rape]
ref|XP_008668054.1|  PREDICTED: cysteine protease 1 isoform X1          133   2e-33   Zea mays [maize]
dbj|BAD16614.1|  cysteine proteinase                                    133   2e-33   Dianthus caryophyllus [carnation]
gb|ACR34204.1|  unknown                                                 133   2e-33   Zea mays [maize]
ref|XP_010107858.1|  Cysteine proteinase RD21a                          133   2e-33   Morus notabilis
ref|NP_001150266.1|  cysteine protease 1 precursor                      132   2e-33   
gb|ABQ10197.1|  actinidin Act4a                                         132   2e-33   Actinidia eriantha
gb|KDO36580.1|  hypothetical protein CISIN_1g037262mg                   125   2e-33   Citrus sinensis [apfelsine]
ref|XP_004304028.1|  PREDICTED: cysteine proteinase RD21a-like          132   2e-33   Fragaria vesca subsp. vesca
gb|KEH31479.1|  papain family cysteine protease                         131   3e-33   Medicago truncatula
ref|XP_006339859.1|  PREDICTED: cysteine proteinase RD21a-like          131   3e-33   Solanum tuberosum [potatoes]
dbj|BAD95392.1|  cysteine proteinase RD21A                              132   3e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AEV41024.1|  putative oryzain beta chain precursor                   132   3e-33   Oryza minuta
ref|NP_564497.1|  cysteine proteinase RD21a                             132   4e-33   Arabidopsis thaliana [mouse-ear cress]
gb|AAK62661.1|  F2G19.31/F2G19.31                                       132   4e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009367558.1|  PREDICTED: cysteine proteinase COT44-like          130   5e-33   
dbj|BAH20463.1|  cysteine protease                                      131   6e-33   Spinacia oleracea
ref|XP_010093524.1|  Germination-specific cysteine protease 1           130   6e-33   
ref|XP_009123448.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    131   6e-33   
dbj|BAG16377.1|  cysteine protease                                      130   7e-33   Brassica rapa var. perviridis [kabuna]
emb|CDY06760.1|  BnaA10g05390D                                          130   9e-33   
gb|AFK47737.1|  unknown                                                 129   9e-33   Medicago truncatula
gb|KHN12823.1|  Cysteine proteinase RD21a                               130   9e-33   Glycine soja [wild soybean]
ref|XP_010919166.1|  PREDICTED: oryzain alpha chain-like                126   9e-33   
ref|NP_001242584.1|  uncharacterized protein LOC100804015 precursor     129   1e-32   Glycine max [soybeans]
ref|XP_008338342.1|  PREDICTED: cysteine proteinase COT44-like          129   1e-32   
ref|XP_009396268.1|  PREDICTED: oryzain alpha chain-like                130   1e-32   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010028191.1|  PREDICTED: cysteine proteinase COT44-like          129   1e-32   Eucalyptus grandis [rose gum]
ref|XP_010461511.1|  PREDICTED: cysteine proteinase RD21a-like          130   2e-32   Camelina sativa [gold-of-pleasure]
ref|XP_010500237.1|  PREDICTED: cysteine proteinase RD21a-like          130   2e-32   Camelina sativa [gold-of-pleasure]
emb|CDY17044.1|  BnaA08g04080D                                          129   3e-32   Brassica napus [oilseed rape]
ref|XP_007136708.1|  hypothetical protein PHAVU_009G067300g             128   4e-32   Phaseolus vulgaris [French bean]
ref|XP_010688590.1|  PREDICTED: low-temperature-induced cysteine ...    129   4e-32   Beta vulgaris subsp. vulgaris [field beet]
gb|AEV41117.1|  putative oryzain beta chain precursor                   129   4e-32   Oryza officinalis
ref|XP_006652996.1|  PREDICTED: oryzain beta chain-like                 129   4e-32   Oryza brachyantha
gb|AEV41071.1|  putative oryzain beta chain precursor                   129   4e-32   Oryza minuta
emb|CDY63586.1|  BnaCnng42340D                                          129   4e-32   Brassica napus [oilseed rape]
ref|XP_008340386.1|  PREDICTED: cysteine proteinase COT44-like          127   5e-32   
pir||TAGB  actinidain (EC 3.4.22.14) precursor - kiwi fruit             127   6e-32
gb|ADQ85986.1|  actinidin                                               127   6e-32   Actinidia chinensis
sp|A5HII1.1|ACTN_ACTDE  RecName: Full=Actinidain; Short=Actinidin...    127   7e-32   Actinidia deliciosa [Chinese gooseberry]
ref|XP_009372437.1|  PREDICTED: cysteine proteinase COT44-like          127   7e-32   Pyrus x bretschneideri [bai li]
gb|AEV40973.1|  putative oryzain beta chain precursor                   128   7e-32   Oryza punctata
gb|KDO59789.1|  hypothetical protein CISIN_1g012022mg                   128   7e-32   Citrus sinensis [apfelsine]
ref|XP_006487026.1|  PREDICTED: cysteine proteinase RD21a-like          128   8e-32   Citrus sinensis [apfelsine]
gb|ABQ10194.1|  actinidin Act2c                                         127   1e-31   Actinidia arguta
gb|ADQ85985.1|  actinidin                                               127   1e-31   Actinidia chinensis
dbj|BAC75927.1|  cysteine protease-5                                    126   1e-31   Helianthus annuus
ref|XP_004960237.1|  PREDICTED: oryzain beta chain-like isoform X2      127   2e-31   Setaria italica
emb|CDY25228.1|  BnaC02g30040D                                          127   2e-31   Brassica napus [oilseed rape]
ref|XP_009400290.1|  PREDICTED: oryzain alpha chain-like                126   3e-31   Musa acuminata subsp. malaccensis [pisang utan]
gb|KHN08598.1|  Cysteine proteinase RD21a                               126   4e-31   Glycine soja [wild soybean]
emb|CAA34486.1|  unnamed protein product                                125   4e-31   Actinidia deliciosa [Chinese gooseberry]
ref|XP_004169515.1|  PREDICTED: cysteine proteinase RD21a-like          126   4e-31   
gb|KGN55227.1|  hypothetical protein Csa_4G641600                       126   5e-31   Cucumis sativus [cucumbers]
ref|XP_010479116.1|  PREDICTED: cysteine proteinase RD21a               126   5e-31   Camelina sativa [gold-of-pleasure]
ref|XP_004141271.1|  PREDICTED: cysteine proteinase RD21a-like          125   5e-31   
dbj|BAD29954.1|  cysteine protease                                      125   8e-31   Daucus carota [carrots]
ref|XP_002448736.1|  hypothetical protein SORBIDRAFT_06g032320          125   8e-31   Sorghum bicolor [broomcorn]
ref|XP_004496965.1|  PREDICTED: cysteine proteinase RD21a-like is...    125   9e-31   Cicer arietinum [garbanzo]
ref|XP_004496966.1|  PREDICTED: cysteine proteinase RD21a-like is...    125   9e-31   
ref|XP_010906543.1|  PREDICTED: ervatamin-B-like                        124   1e-30   Elaeis guineensis
sp|P00785.4|ACTN_ACTCH  RecName: Full=Actinidain; Short=Actinidin...    124   1e-30   Actinidia chinensis
ref|XP_010548429.1|  PREDICTED: germination-specific cysteine pro...    124   1e-30   Tarenaya hassleriana [spider flower]
emb|CAB17074.1|  cysteine proteinase precursor                          123   2e-30   Phaseolus vulgaris [French bean]
gb|AFO83613.1|  papain-like cysteine protease                           123   2e-30   Fagopyrum esculentum
emb|CAA53377.1|  cysteine protease                                      122   4e-30   Vicia sativa [spring vetch]
gb|KEH44128.1|  papain family cysteine protease                         123   4e-30   Medicago truncatula
gb|AIE88288.1|  hypothetical protein OG_BBa0063K01.19                   123   5e-30   Oryza glaberrima
gb|ABK24233.1|  unknown                                                 123   5e-30   Picea sitchensis
gb|ABQ10190.1|  actinidin Act1b                                         122   6e-30   Actinidia arguta
dbj|BAJ92693.1|  predicted protein                                      120   8e-30   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|EMS56635.1|  Oryzain alpha chain                                     122   8e-30   Triticum urartu
gb|AAB68374.1|  cysteine endopeptidase 1                                121   1e-29   Phaseolus vulgaris [French bean]
gb|AAC49455.1|  Pseudotzain                                             122   1e-29   Pseudotsuga menziesii
dbj|BAJ85145.1|  predicted protein                                      121   2e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AFR11773.1|  cysteine protease                                       120   2e-29   Fragaria x ananassa
emb|CAQ00105.1|  papain-like cysteine proteinase                        121   3e-29   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_004289205.2|  PREDICTED: cysteine proteinase COT44               120   3e-29   Fragaria vesca subsp. vesca
ref|XP_009396437.1|  PREDICTED: oryzain alpha chain-like                120   3e-29   Musa acuminata subsp. malaccensis [pisang utan]
gb|AHY28813.1|  cysteine protease                                       116   4e-29   Pinus elliottii [American pitch pine]
gb|AHY28814.1|  cysteine protease                                       116   4e-29   Pinus palustris [longleaf pine]
ref|XP_003579458.1|  PREDICTED: oryzain beta chain-like                 120   4e-29   Brachypodium distachyon [annual false brome]
gb|AAW66796.1|  cysteine protease                                       116   5e-29   Pinus taeda
ref|XP_010555986.1|  PREDICTED: LOW QUALITY PROTEIN: probable cys...    120   5e-29   
gb|ABS83496.1|  cysteine protease                                       116   5e-29   
ref|XP_007155893.1|  hypothetical protein PHAVU_003G240800g             119   5e-29   
ref|XP_004141903.1|  PREDICTED: germination-specific cysteine pro...    119   6e-29   
gb|AIF75887.1|  cysteine protease                                       115   6e-29   
gb|AIF75886.1|  cysteine protease                                       115   7e-29   
ref|NP_001054087.2|  Os04g0650000                                       114   8e-29   
gb|ABZ69059.1|  cysteine protease                                       115   8e-29   
gb|AAW66797.1|  cysteine protease                                       115   9e-29   
gb|AAW66794.1|  cysteine protease                                       115   9e-29   
gb|AAW66801.1|  cysteine protease                                       115   9e-29   
gb|EPS64955.1|  cysteine protease                                       114   1e-28   
ref|XP_006283942.1|  hypothetical protein CARUB_v10005061mg             119   1e-28   
gb|AAW66804.1|  cysteine protease                                       115   1e-28   
gb|ABK24495.1|  unknown                                                 119   2e-28   
ref|XP_003580684.2|  PREDICTED: oryzain alpha chain-like                119   2e-28   
gb|ABZ69061.1|  cysteine protease                                       115   2e-28   
ref|XP_006855225.1|  hypothetical protein AMTR_s00051p00208220          119   2e-28   
ref|XP_008440309.1|  PREDICTED: cysteine proteinase COT44-like          117   2e-28   
emb|CDY17193.1|  BnaA05g09950D                                          117   2e-28   
ref|NP_001054211.2|  Os04g0670200                                       118   3e-28   
gb|AIF75890.1|  cysteine protease                                       114   3e-28   
dbj|BAA14403.1|  oryzain beta precursor                                 118   3e-28   
gb|AAW66799.1|  cysteine protease                                       114   3e-28   
gb|EPS63179.1|  hypothetical protein M569_11610                         115   3e-28   
ref|XP_010487882.1|  PREDICTED: probable cysteine proteinase At3g...    116   4e-28   
ref|XP_010679531.1|  PREDICTED: cysteine proteinase COT44-like          117   5e-28   
dbj|BAF02546.1|  triticain alpha                                        117   7e-28   
gb|EMT10408.1|  Oryzain alpha chain                                     117   7e-28   
emb|CDX99227.1|  BnaC05g33420D                                          117   8e-28   
ref|XP_010507701.1|  PREDICTED: probable cysteine proteinase At3g...    117   8e-28   
ref|XP_006652923.1|  PREDICTED: oryzain alpha chain-like                117   8e-28   
ref|NP_974341.1|  putative cysteine proteinase                          115   1e-27   
ref|XP_008796668.1|  PREDICTED: oryzain alpha chain-like                116   1e-27   
ref|XP_008796470.1|  PREDICTED: oryzain alpha chain-like                116   1e-27   
ref|XP_010466084.1|  PREDICTED: probable cysteine proteinase At3g...    116   2e-27   
ref|XP_010466085.1|  PREDICTED: probable cysteine proteinase At3g...    116   2e-27   
gb|EPS71857.1|  senescence-associated cysteine protease                 114   2e-27   
gb|KFK39253.1|  hypothetical protein AALP_AA3G220200                    115   3e-27   
ref|NP_001266166.1|  uncharacterized protein LOC101492472               114   3e-27   
emb|CAQ00106.1|  papain-like cysteine proteinase                        115   4e-27   
dbj|BAC43113.1|  putative cysteine proteinase RD21A precursor           114   4e-27   
tpg|DAA35682.1|  TPA: cysteine proteinase Mir3                          114   5e-27   
emb|CAE04498.2|  OSJNBb0059K02.8                                        114   5e-27   
ref|NP_566634.2|  putative cysteine proteinase                          114   5e-27   
sp|P25776.2|ORYA_ORYSJ  RecName: Full=Oryzain alpha chain; Flags:...    114   6e-27   
dbj|BAA14402.1|  oryzain alpha precursor                                114   6e-27   
dbj|BAN33745.1|  cysteine protease a                                    114   6e-27   
gb|EEE61807.1|  hypothetical protein OsJ_16426                          114   6e-27   
emb|CDY50154.1|  BnaA01g26140D                                          114   6e-27   
ref|NP_001105993.1|  cysteine protease component of protease-inhi...    114   6e-27   
emb|CDY46179.1|  BnaA05g20660D                                          114   6e-27   
ref|XP_009111878.1|  PREDICTED: probable cysteine proteinase At3g...    114   7e-27   
ref|XP_009111886.1|  PREDICTED: probable cysteine proteinase At3g...    114   7e-27   
ref|NP_195406.2|  cysteine proteinase1                                  114   8e-27   
dbj|BAF00916.1|  cysteine proteinase                                    113   8e-27   
ref|XP_009137836.1|  PREDICTED: cysteine proteinase COT44               113   8e-27   
dbj|BAN33746.1|  cysteine protease a2                                   113   1e-26   
emb|CDX75633.1|  BnaA01g00690D                                          113   1e-26   
ref|XP_002868998.1|  cysteine proteinase                                113   1e-26   
gb|ABU51882.1|  ervatamin-C precursor                                   113   1e-26   
gb|AAL60578.1|AF454956_1  senescence-associated cysteine protease       113   1e-26   
dbj|BAH11164.1|  cysteine protease                                      113   1e-26   
ref|NP_001104879.1|  cysteine proteinase Mir3 precursor                 113   1e-26   
emb|CAJ86180.1|  H0212B02.7                                             113   1e-26   
sp|Q94B08.2|GCP1_ARATH  RecName: Full=Germination-specific cystei...    112   2e-26   
ref|XP_006297656.1|  hypothetical protein CARUB_v10013678mg             113   2e-26   
gb|EEC78138.1|  hypothetical protein OsI_17694                          113   2e-26   
emb|CDX95456.1|  BnaC01g33480D                                          112   2e-26   
ref|XP_002877310.1|  hypothetical protein ARALYDRAFT_484828             112   2e-26   
ref|XP_009145796.1|  PREDICTED: probable cysteine proteinase At3g...    112   2e-26   
ref|NP_566633.1|  Granulin repeat cysteine protease family protein      112   3e-26   
ref|NP_001148706.1|  cysteine protease 1 precursor                      112   4e-26   
ref|XP_009109364.1|  PREDICTED: cysteine proteinase COT44-like          111   4e-26   
ref|XP_010437247.1|  PREDICTED: germination-specific cysteine pro...    111   5e-26   
emb|CDY44047.1|  BnaA08g15590D                                          111   5e-26   
ref|XP_002883178.1|  hypothetical protein ARALYDRAFT_479457             111   8e-26   
emb|CDY50157.1|  BnaA01g26170D                                          111   9e-26   
emb|CDY22445.1|  BnaC03g61580D                                          110   9e-26   
gb|AEV41073.1|  putative cysteine protease                              111   1e-25   
gb|AFW59666.1|  hypothetical protein ZEAMMB73_680472                    107   1e-25   
gb|ACI00280.1|  triticain beta 2                                        111   1e-25   
dbj|BAK03074.1|  predicted protein                                      111   1e-25   
gb|AAP41847.1|  senescence-associated cysteine protease                 110   1e-25   
ref|NP_566867.1|  putative cysteine proteinase                          110   2e-25   
gb|AEV41119.1|  putative cysteine protease                              110   2e-25   
ref|XP_010432076.1|  PREDICTED: germination-specific cysteine pro...    110   2e-25   
ref|XP_010932205.1|  PREDICTED: oryzain alpha chain-like                110   2e-25   
ref|XP_006406504.1|  hypothetical protein EUTSA_v10020714mg             110   2e-25   
emb|CDX69285.1|  BnaC01g01680D                                          109   2e-25   
ref|XP_008678577.1|  PREDICTED: oryzain alpha chain-like                109   3e-25   
emb|CDX95457.1|  BnaC01g33490D                                          109   3e-25   
gb|ACO57104.1|  cysteine protease                                       104   3e-25   
ref|NP_567686.2|  putative cysteine proteinase                          108   4e-25   
emb|CAA20473.1|  cysteine proteinase-like protein                       108   4e-25   
ref|XP_004977049.1|  PREDICTED: oryzain alpha chain-like                109   4e-25   
ref|XP_010487883.1|  PREDICTED: probable cysteine proteinase At3g...    108   5e-25   
gb|EMS68758.1|  Oryzain beta chain                                      109   5e-25   
ref|XP_010446685.1|  PREDICTED: germination-specific cysteine pro...    108   5e-25   
ref|XP_006411912.1|  hypothetical protein EUTSA_v10025483mg             108   6e-25   
gb|AFW59667.1|  hypothetical protein ZEAMMB73_680472                    107   8e-25   
ref|XP_007145379.1|  hypothetical protein PHAVU_007G234100g             108   8e-25   
ref|XP_009420643.1|  PREDICTED: oryzain alpha chain-like                108   9e-25   
ref|XP_009412959.1|  PREDICTED: oryzain alpha chain-like                107   1e-24   
gb|AAM65468.1|  cysteine proteinase                                     107   1e-24   
ref|NP_001149658.1|  cysteine protease 1 precursor                      108   1e-24   
gb|AFW59668.1|  LOW QUALITY PROTEIN: cysteine protease 1                107   2e-24   
dbj|BAE46567.1|  cysteine proteinase                                    102   2e-24   
gb|KFK30309.1|  hypothetical protein AALP_AA7G245200                    106   3e-24   
gb|AJA74416.1|  cysteine protease                                       105   5e-24   
dbj|BAF93840.1|  triticain beta 2                                       106   7e-24   
ref|XP_006415023.1|  hypothetical protein EUTSA_v10007931mg             105   7e-24   
gb|KFK39254.1|  hypothetical protein AALP_AA3G220300                    104   8e-24   
ref|XP_006291187.1|  hypothetical protein CARUB_v10017312mg             105   8e-24   
emb|CDX95451.1|  BnaC01g33430D                                          105   1e-23   
ref|XP_009388208.1|  PREDICTED: oryzain alpha chain-like                104   1e-23   
ref|XP_006415025.1|  hypothetical protein EUTSA_v10007664mg             105   1e-23   
ref|XP_006297986.1|  hypothetical protein CARUB_v10014028mg             104   1e-23   
ref|XP_002867702.1|  hypothetical protein ARALYDRAFT_329301             104   2e-23   
gb|EPS57317.1|  cysteine proteinase                                   98.6    2e-23   
ref|XP_010466086.1|  PREDICTED: probable cysteine proteinase At3g...    103   3e-23   
dbj|BAF02547.1|  triticain beta                                         104   3e-23   
gb|AAB41816.1|  NTH1                                                    103   3e-23   
gb|AEV41026.1|  putative cysteine protease                              103   4e-23   
gb|AEV40975.1|  putative cysteine protease                              103   6e-23   
ref|XP_002447300.1|  hypothetical protein SORBIDRAFT_06g032360          103   7e-23   
ref|XP_010927504.1|  PREDICTED: oryzain alpha chain-like                103   7e-23   
ref|NP_001054213.1|  Os04g0670500                                       103   9e-23   
emb|CAH67695.1|  H0624F09.3                                             103   9e-23   
dbj|BAG50406.1|  peptidase                                            98.2    2e-22   
dbj|BAJ33895.1|  unnamed protein product                                100   3e-22   
ref|XP_006396922.1|  hypothetical protein EUTSA_v10028681mg             101   3e-22   
ref|XP_010433893.1|  PREDICTED: zingipain-2-like                        100   5e-22   
ref|XP_009128675.1|  PREDICTED: probable cysteine proteinase At4g...    100   6e-22   
emb|CAR31335.1|  pro-asclepain f                                      99.8    6e-22   
ref|XP_010503064.1|  PREDICTED: probable cysteine proteinase At3g...    100   6e-22   
ref|XP_010448692.1|  PREDICTED: zingipain-2-like                      99.8    7e-22   
gb|EPS58726.1|  cysteine proteinase                                   96.7    8e-22   
ref|XP_006287995.1|  hypothetical protein CARUB_v10001228mg           99.4    9e-22   
gb|AAW34136.1|  cysteine protease gp3a                                  100   1e-21   
ref|XP_010435084.1|  PREDICTED: probable cysteine proteinase At4g...  99.4    1e-21   
ref|XP_010445171.1|  PREDICTED: zingipain-2-like                      98.6    1e-21   
ref|XP_006396923.1|  hypothetical protein EUTSA_v10028733mg           98.6    2e-21   
ref|XP_010422086.1|  PREDICTED: probable cysteine proteinase At4g...  98.6    2e-21   
gb|AAB23155.1|  COT44=cysteine proteinase homolog                     98.2    2e-21   
sp|P25251.1|CYSP4_BRANA  RecName: Full=Cysteine proteinase COT44;...  98.2    2e-21   
emb|CDY50156.1|  BnaA01g26160D                                        97.8    2e-21   
ref|XP_009145795.1|  PREDICTED: probable cysteine proteinase At3g...  98.6    2e-21   
gb|EPS62067.1|  cysteine proteinase                                   97.8    3e-21   
emb|CDY46178.1|  BnaA05g20650D                                        98.2    3e-21   
ref|XP_010412496.1|  PREDICTED: probable cysteine proteinase At3g...  98.2    3e-21   
ref|XP_004292313.1|  PREDICTED: xylem cysteine proteinase 1           97.8    3e-21   
ref|XP_010422085.1|  PREDICTED: probable cysteine proteinase At4g...  97.8    4e-21   
dbj|BAD29956.1|  cysteine protease                                    97.8    5e-21   
emb|CDY63262.1|  BnaCnng41770D                                        96.3    6e-21   
ref|XP_010455538.1|  PREDICTED: probable cysteine proteinase At4g...  96.7    9e-21   
ref|XP_010435073.1|  PREDICTED: probable cysteine proteinase At4g...  96.7    9e-21   
ref|XP_010455537.1|  PREDICTED: probable cysteine proteinase At4g...  96.3    1e-20   
ref|XP_010427118.1|  PREDICTED: probable cysteine proteinase At3g...  96.3    1e-20   
ref|XP_006285150.1|  hypothetical protein CARUB_v10006494mg           95.1    3e-20   
ref|XP_007043092.1|  Xylem cysteine peptidase 1                       95.1    3e-20   
gb|AIE88271.1|  hypothetical protein OG_BBa0063K01.2                  96.3    3e-20   
gb|ACC91281.1|  putative cysteine proteinase                          94.7    3e-20   
ref|XP_002872576.1|  hypothetical protein ARALYDRAFT_489965           94.7    4e-20   
gb|KDP47019.1|  hypothetical protein JCGZ_10746                       94.4    4e-20   
gb|KFK31907.1|  hypothetical protein AALP_AA6G174500                  94.7    4e-20   
ref|XP_006289222.1|  hypothetical protein CARUB_v10002678mg           94.4    5e-20   
ref|XP_009128676.1|  PREDICTED: probable cysteine proteinase At4g...  94.4    5e-20   
ref|XP_004963406.1|  PREDICTED: cysteine protease 1-like              95.1    8e-20   
gb|KCW66366.1|  hypothetical protein EUGRSUZ_F00186                   91.7    8e-20   
ref|XP_004971418.1|  PREDICTED: xylem cysteine proteinase 2-like      93.6    9e-20   
ref|XP_009384829.1|  PREDICTED: xylem cysteine proteinase 1-like      93.6    9e-20   
ref|XP_002989790.1|  hypothetical protein SELMODRAFT_184826           93.6    9e-20   
ref|XP_009115337.1|  PREDICTED: probable cysteine proteinase At4g...  93.6    1e-19   
ref|XP_006384862.1|  XYLEM CYSTEINE PEPTIDASE 1 family protein        93.6    1e-19   
ref|NP_567377.1|  putative cysteine proteinase                        93.6    1e-19   
gb|EAZ32361.1|  hypothetical protein OsJ_16571                        94.0    1e-19   
ref|XP_009137125.1|  PREDICTED: zingipain-2                           93.2    1e-19   
gb|KJB77459.1|  hypothetical protein B456_012G138700                  92.8    2e-19   
ref|XP_002990132.1|  hypothetical protein SELMODRAFT_428615           92.8    2e-19   
ref|XP_002980210.1|  hypothetical protein SELMODRAFT_153766           94.0    2e-19   
ref|XP_002963113.1|  hypothetical protein SELMODRAFT_270344           93.6    3e-19   
ref|XP_011040826.1|  PREDICTED: xylem cysteine proteinase 1           91.7    4e-19   
ref|XP_010240524.1|  PREDICTED: oryzain alpha chain-like isoform X2   91.7    4e-19   
emb|CDY37617.1|  BnaCnng08320D                                        91.7    5e-19   
ref|XP_003580686.1|  PREDICTED: oryzain alpha chain-like isoform X1   91.7    5e-19   
emb|CDY01351.1|  BnaA07g11240D                                        91.7    5e-19   
ref|XP_010928427.1|  PREDICTED: xylem cysteine proteinase 2-like      91.7    5e-19   
gb|AAA79915.1|  cysteine proteinase                                   92.4    5e-19   
ref|XP_002437487.1|  hypothetical protein SORBIDRAFT_10g027980        91.3    6e-19   
ref|XP_010231852.1|  PREDICTED: xylem cysteine proteinase 1-like      91.3    7e-19   
gb|EMT08475.1|  Oryzain alpha chain                                   91.3    7e-19   
emb|CDY31861.1|  BnaC07g15110D                                        90.5    1e-18   
ref|XP_006413545.1|  hypothetical protein EUTSA_v10027165mg           90.5    1e-18   
gb|KCW70346.1|  hypothetical protein EUGRSUZ_F03589                   89.7    1e-18   
ref|XP_002872575.1|  hypothetical protein ARALYDRAFT_911472           90.5    2e-18   
ref|XP_006492717.1|  PREDICTED: xylem cysteine proteinase 1-like      90.1    2e-18   
ref|XP_009103325.1|  PREDICTED: xylem cysteine proteinase 2           90.1    2e-18   
gb|ACR34737.1|  unknown                                               91.3    2e-18   
ref|XP_008451198.1|  PREDICTED: xylem cysteine proteinase 1-like      89.7    2e-18   
ref|XP_010090710.1|  Xylem cysteine proteinase 1                      89.7    2e-18   
ref|XP_009390652.1|  PREDICTED: xylem cysteine proteinase 1-like      89.7    2e-18   
ref|XP_008799257.1|  PREDICTED: xylem cysteine proteinase 1-like      89.7    2e-18   
ref|XP_010690568.1|  PREDICTED: xylem cysteine proteinase 2           89.7    2e-18   
gb|KDO85216.1|  hypothetical protein CISIN_1g0186492mg                89.4    2e-18   
ref|XP_008381869.1|  PREDICTED: protein TIFY 9-like                   87.8    2e-18   
ref|XP_009102734.1|  PREDICTED: xylem cysteine proteinase 1           89.7    3e-18   
gb|AAM13065.1|  drought-inducible cysteine proteinase RD21A precu...  89.4    3e-18   
emb|CDX75496.1|  BnaA01g02060D                                        89.4    3e-18   
ref|NP_567376.1|  putative cysteine proteinase                        89.4    3e-18   
ref|XP_004144898.1|  PREDICTED: xylem cysteine proteinase 1-like      89.4    3e-18   
ref|XP_004161017.1|  PREDICTED: xylem cysteine proteinase 1-like      89.4    3e-18   
emb|CAQ00103.1|  papain-like cysteine proteinase                      89.0    4e-18   
ref|XP_007018686.1|  Xylem cysteine peptidase 1                       89.0    4e-18   
ref|XP_009391873.1|  PREDICTED: xylem cysteine proteinase 1-like      89.0    4e-18   
ref|XP_010063152.1|  PREDICTED: xylem cysteine proteinase 2           89.0    4e-18   
ref|XP_006849990.1|  hypothetical protein AMTR_s00022p00165270        89.0    4e-18   
ref|XP_010436251.1|  PREDICTED: xylem cysteine proteinase 1-like      88.6    4e-18   
gb|EMT26055.1|  Xylem cysteine proteinase 1                           89.0    5e-18   
ref|NP_974687.1|  xylem cysteine proteinase 1                         88.6    5e-18   
ref|XP_006422409.1|  hypothetical protein CICLE_v10028739mg           88.6    5e-18   



>gb|AAK48495.1|AF259983_1 putative cysteine protease [Ipomoea batatas]
Length=462

 Score =   250 bits (638),  Expect = 8e-78, Method: Compositional matrix adjust.
 Identities = 119/123 (97%), Positives = 121/123 (98%), Gaps = 0/123 (0%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDEEHPAKGLSR+DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID
Sbjct  23   DMSIITYDEEHPAKGLSRSDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQNSR DR+YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK GGSLPDS
Sbjct  83   EQNSRGDRSYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKAGGSLPDS  142

Query  467  IDW  475
            IDW
Sbjct  143  IDW  145



>ref|XP_011069730.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=471

 Score =   192 bits (487),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/123 (74%), Positives = 106/123 (86%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H   G  R+DEEVM++YESW+V+HGKSYN LG EK+KRFEIFKDNLRYI+
Sbjct  29   DMSIISYDESHGGPGFVRSDEEVMSMYESWMVKHGKSYNALG-EKEKRFEIFKDNLRYIE  87

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQN+  +R YKLGLNRFADL+NEEYR TY+G +TDA+RR +K KSD RYAPKVG SLPDS
Sbjct  88   EQNAMPNRTYKLGLNRFADLSNEEYRRTYMGTRTDAKRRFSKVKSD-RYAPKVGDSLPDS  146

Query  467  IDW  475
            IDW
Sbjct  147  IDW  149



>dbj|BAF46304.1| cysteine proteinase precursor [Ipomoea nil]
Length=474

 Score =   185 bits (469),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/123 (72%), Positives = 107/123 (87%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYD++HPAKGL R+++EV  ++ESWLV+HGKSYN +  EKDKRF+IF+DNL+YID
Sbjct  24   DMSIITYDQQHPAKGLVRSEDEVKEMFESWLVKHGKSYNAVD-EKDKRFKIFRDNLKYID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E+NS E+R+YKLGLNRFAD+TNEEYR+ YLGAK DA R + K+KSD RYAP  G SLPDS
Sbjct  83   EKNSLENRSYKLGLNRFADITNEEYRTGYLGAKRDASRNMVKSKSD-RYAPVAGDSLPDS  141

Query  467  IDW  475
            IDW
Sbjct  142  IDW  144



>emb|CDP01294.1| unnamed protein product [Coffea canephora]
Length=465

 Score =   181 bits (459),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 92/124 (74%), Positives = 102/124 (82%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++Y   +    G  RTDEEVMALYE WLV+HGKSYNGLG EKDKRFEIFKDNLRYI
Sbjct  20   DMSILSYGNANLKTSGSGRTDEEVMALYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLRYI  78

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DEQNS   R Y+LGLNRFADL+NEEYRSTYLG + D +RR+AKT SD RY PKVG SLP+
Sbjct  79   DEQNSLPSRTYQLGLNRFADLSNEEYRSTYLGTRPDPKRRLAKTSSD-RYRPKVGDSLPN  137

Query  464  SIDW  475
            SIDW
Sbjct  138  SIDW  141



>gb|AGV15823.1| cysteine protease CP15 [Nicotiana tabacum]
Length=474

 Score =   179 bits (454),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  86

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            YIDEQNS  +++YKLGL +FADLTNEEY+S YLG K D R R++ T+SD RYAPKVG SL
Sbjct  87   YIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSD-RYAPKVGDSL  145

Query  458  PDSIDW  475
            PDS+DW
Sbjct  146  PDSVDW  151



>ref|XP_003545327.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=496

 Score =   179 bits (455),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H A   SR+DEE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+ID
Sbjct  55   DMSIISYDNAHAAT--SRSDEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFID  111

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + NS+EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LP+S
Sbjct  112  DHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPES  170

Query  467  IDW  475
            +DW
Sbjct  171  VDW  173



>ref|XP_009775102.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=473

 Score =   178 bits (451),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 89/126 (71%), Positives = 102/126 (81%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  28   DMSIISYNEKHHTNGESTVWRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  86

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            YIDE NS  D++YKLGL +FADLTNEEY+S YLG K D R R+  T+SD RYAPKVG SL
Sbjct  87   YIDEHNSVPDKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLLNTQSD-RYAPKVGDSL  145

Query  458  PDSIDW  475
            PDS+DW
Sbjct  146  PDSVDW  151



>ref|XP_011074404.1| PREDICTED: low-temperature-induced cysteine proteinase [Sesamum 
indicum]
Length=469

 Score =   177 bits (450),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 90/124 (73%), Positives = 103/124 (83%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSIITYDE  H A    R+ +EVM++YESWL++HGKSYN LG EK++RFEIFKDNLRYI
Sbjct  26   DMSIITYDENNHLAGPGLRSHDEVMSMYESWLMKHGKSYNALG-EKERRFEIFKDNLRYI  84

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DEQN+   R YKLGLNRFADLTNEEYR T+LGA+ D +RR+  TKSD RYAPKVG SLPD
Sbjct  85   DEQNALGGRTYKLGLNRFADLTNEEYRKTFLGARPDGKRRLTSTKSD-RYAPKVGESLPD  143

Query  464  SIDW  475
            SIDW
Sbjct  144  SIDW  147



>ref|XP_009604895.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
Length=473

 Score =   176 bits (447),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 87/126 (69%), Positives = 104/126 (83%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+Y+E+H   G S   RTD+E+++LYESWLVEH K YN LG EKDKRF+IFKDNLR
Sbjct  27   DMSIISYNEKHHTNGESTVWRTDDEIVSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLR  85

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            YIDEQNS  +++YKLGL +FADLTNEEY+S YLG K D R R++ T+SD RYAPKVG SL
Sbjct  86   YIDEQNSAPEKSYKLGLTQFADLTNEEYKSIYLGTKPDGRSRLSYTQSD-RYAPKVGDSL  144

Query  458  PDSIDW  475
            PDS+DW
Sbjct  145  PDSVDW  150



>dbj|BAE80740.1| cysteine proteinase [Platycodon grandiflorus]
Length=462

 Score =   176 bits (446),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/123 (70%), Positives = 105/123 (85%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD  H +K   RTD+EVMA+YESWLV+HGKSYN LG EK+KRF+IFKDNLR+ID
Sbjct  24   DMSIINYDATHASKSSWRTDDEVMAMYESWLVKHGKSYNALG-EKEKRFQIFKDNLRFID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+ E+ +YK+GLNRFADLTNEEYRSTYLGAK+  + +++K KSD RYAP+VG SLP+S
Sbjct  83   EHNAEENLSYKVGLNRFADLTNEEYRSTYLGAKS--KPKLSKVKSD-RYAPRVGDSLPES  139

Query  467  IDW  475
            +DW
Sbjct  140  VDW  142



>ref|XP_004238129.1| PREDICTED: low-temperature-induced cysteine proteinase [Solanum 
lycopersicum]
Length=472

 Score =   175 bits (444),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+E+H   G  RTD+EVM++YESWLVEH K YN LG EKDKRF+IFKDNL+YID
Sbjct  29   DMSIISYNEKHHTIGAGRTDDEVMSMYESWLVEHKKVYNALG-EKDKRFQIFKDNLKYID  87

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +++YKLGL +FADLTNEEYRS YLG K DA RR++  +SD RYAPKVG  LP+S
Sbjct  88   EHNAMPEKSYKLGLTKFADLTNEEYRSVYLGTKPDASRRLSSRQSD-RYAPKVGDRLPES  146

Query  467  IDW  475
            +DW
Sbjct  147  VDW  149



>ref|XP_006354848.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=471

 Score =   175 bits (443),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 84/123 (68%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+E+H   G  RTD+EVM+LYESWLVEH K YN LG EKDKRF+IFKDNL+YID
Sbjct  28   DMSIISYNEKHHKIGAGRTDDEVMSLYESWLVEHKKVYNALG-EKDKRFQIFKDNLKYID  86

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +++YKLGL +FADLTNEEYRS YLG K DA RR++  +SD RYAPKVG  LP+S
Sbjct  87   EHNAMPEKSYKLGLTKFADLTNEEYRSIYLGTKPDAGRRLSSRQSD-RYAPKVGDRLPES  145

Query  467  IDW  475
            +DW
Sbjct  146  VDW  148



>ref|XP_006434711.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
 gb|ESR47951.1| hypothetical protein CICLE_v100010541mg, partial [Citrus clementina]
Length=160

 Score =   166 bits (421),  Expect = 6e-49, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVM ++E+W V+HGK+YN LG EK+KRFEIFKDNLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMGMFEAWFVKHGKAYNALG-EKEKRFEIFKDNLRFI  82

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE NS E+R YK+GLNRFADLTNEEYRS YLGA+  A+R   K+K   RY P+VG +LPD
Sbjct  83   DEHNS-ENRTYKVGLNRFADLTNEEYRSMYLGARFGAKRTSLKSKRSDRYLPRVGEALPD  141

Query  464  SIDW  475
            S+DW
Sbjct  142  SVDW  145



>ref|XP_009613155.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
tomentosiformis]
 gb|AGV15820.1| cysteine protease CP6 [Nicotiana tabacum]
Length=466

 Score =   174 bits (442),  Expect = 9e-49, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+TYDE        RTD+EVM+LYESWLVEHGKSYN L  EKDKRF+IFK+NLRYID
Sbjct  28   DMSILTYDENQHF----RTDDEVMSLYESWLVEHGKSYNALD-EKDKRFQIFKENLRYID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQNS  +++YKLGL +FADLTNEEYRS YLG KT  RRR+ K KSD RY PKVG SLPDS
Sbjct  83   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSD-RYLPKVGDSLPDS  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_009769754.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Nicotiana 
sylvestris]
Length=470

 Score =   174 bits (441),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 89/123 (72%), Positives = 100/123 (81%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+TYDE        RTD+EVM+LYESWL+EHGKSYN L  EKDKRF+IFKDNLRYID
Sbjct  32   DMSILTYDENQHF----RTDDEVMSLYESWLLEHGKSYNALD-EKDKRFQIFKDNLRYID  86

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQNS  +++YKLGL +FADLTNEEYRS YLG KT  RRR+ K KSD RY PKVG SLPDS
Sbjct  87   EQNSVPNKSYKLGLTKFADLTNEEYRSMYLGTKTSDRRRLLKNKSD-RYLPKVGDSLPDS  145

Query  467  IDW  475
            +DW
Sbjct  146  VDW  148



>ref|NP_001234324.1| low-temperature-induced cysteine proteinase precursor [Solanum 
lycopersicum]
 gb|AAD48496.1|AF172856_1 cysteine protease TDI-65 [Solanum lycopersicum]
 emb|CAA05894.1| CYP1 [Solanum lycopersicum]
 emb|CEL26633.1| cysteine protease [Solanum lycopersicum]
Length=466

 Score =   174 bits (440),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 103/124 (83%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +   RTD+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNLRYID
Sbjct  26   DMSIISYDETHIHR---RTDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLRYID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  463
            EQNS  +++YKLGL +FADLTNEEYRS YLG K+   R++++K KSD RY PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRKKLSKNKSD-RYLPKVGDSLPE  140

Query  464  SIDW  475
            SIDW
Sbjct  141  SIDW  144



>gb|KCW66364.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN LG EK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNALG-EKERRFDIFKDNLRFID  85

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  +R Y LGLNRFADLTNEEYRSTYLG + DA RR+ K++S RRY P++G  LP+S
Sbjct  86   EHNSG-NRTYTLGLNRFADLTNEEYRSTYLGTRPDASRRLTKSRSSRRYEPRLGEQLPES  144

Query  467  IDW  475
            +DW
Sbjct  145  VDW  147



>ref|XP_010059895.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW66363.1| hypothetical protein EUGRSUZ_F00184 [Eucalyptus grandis]
Length=470

 Score =   173 bits (438),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 99/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD EVMALYESWLV+HGK+YN LG EK++RF+IFKDNLR+ID
Sbjct  27   DMSIISYDRAHGGDPGQRTDAEVMALYESWLVKHGKAYNALG-EKERRFDIFKDNLRFID  85

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  +R Y LGLNRFADLTNEEYRSTYLG + DA RR+ K++S RRY P++G  LP+S
Sbjct  86   EHNS-GNRTYTLGLNRFADLTNEEYRSTYLGTRPDASRRLTKSRSSRRYEPRLGEQLPES  144

Query  467  IDW  475
            +DW
Sbjct  145  VDW  147



>gb|KHN22488.1| Cysteine proteinase RD21a [Glycine soja]
Length=464

 Score =   172 bits (436),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 101/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD  H A   + RT+EE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+I
Sbjct  20   DMSIISYDNAHAATAATLRTEEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFI  78

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            D+ NS+EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LP+
Sbjct  79   DDHNSQEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPE  137

Query  464  SIDW  475
            S+DW
Sbjct  138  SVDW  141



>ref|XP_003550321.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
 gb|KHN12811.1| Cysteine proteinase RD21a [Glycine soja]
Length=476

 Score =   172 bits (437),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 84/124 (68%), Positives = 100/124 (81%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD  H  K  + RT+EE+M++YE WLV+HGK YN LG EK+KRF+IFKDNLR+I
Sbjct  32   DMSIISYDSAHADKAATLRTEEELMSMYEQWLVKHGKVYNALG-EKEKRFQIFKDNLRFI  90

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            D+ NS EDR YKLGLNRFADLTNEEYR+ YLG K D  RR+ KT S+ RYAP+VG  LPD
Sbjct  91   DDHNSAEDRTYKLGLNRFADLTNEEYRAKYLGTKIDPNRRLGKTPSN-RYAPRVGDKLPD  149

Query  464  SIDW  475
            S+DW
Sbjct  150  SVDW  153



>ref|XP_007160879.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
 gb|ESW32873.1| hypothetical protein PHAVU_001G024500g [Phaseolus vulgaris]
Length=466

 Score =   172 bits (435),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN LG EKDKRF+IFKDNLR+ID
Sbjct  25   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNALG-EKDKRFQIFKDNLRFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            +QN+ E+R YKLGLNRFADLTNEEYR+ YLG K D  RR+ +T S+ RYAP+VG +LPDS
Sbjct  84   QQNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDPNRRLGRTPSN-RYAPRVGETLPDS  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>emb|CAB17076.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=455

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 85/123 (69%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   RTDEEV +LYE WLV+HGK YN LG EKDKRF+IFKDNLR+ID
Sbjct  14   DMSIISYDNAHQDKATWRTDEEVNSLYEEWLVKHGKLYNALG-EKDKRFQIFKDNLRFID  72

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            +QN+ E+R YKLGLNRFADLTNEEYR+ YLG K D  RR+ +T S+ RYAP+VG +LPDS
Sbjct  73   QQNA-ENRTYKLGLNRFADLTNEEYRARYLGTKIDPNRRLGRTPSN-RYAPRVGETLPDS  130

Query  467  IDW  475
            +DW
Sbjct  131  VDW  133



>ref|XP_006342644.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Solanum 
tuberosum]
Length=466

 Score =   171 bits (434),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/124 (70%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      RTD+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RTDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLKYID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  463
            EQNS  +++YKLGL +FADLT EEYRS YLG K+   RRR++K KSD RY PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTTEEYRSIYLGTKSSGDRRRLSKNKSD-RYLPKVGDSLPE  140

Query  464  SIDW  475
            S+DW
Sbjct  141  SVDW  144



>ref|NP_001274877.1| low-temperature-induced cysteine proteinase-like precursor [Solanum 
tuberosum]
 emb|CAB53515.1| cysteine protease [Solanum tuberosum]
Length=466

 Score =   171 bits (433),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 86/124 (69%), Positives = 102/124 (82%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      R+D+EV ALYESWL+EHGKSYN LG EKDKRF+IFKDNL+YID
Sbjct  26   DMSIISYDETHIHH---RSDDEVSALYESWLIEHGKSYNALG-EKDKRFQIFKDNLKYID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKSDRRYAPKVGGSLPD  463
            EQNS  +++YKLGL +FADLTNEEYRS YLG K+   RR+++K KSD RY PKVG SLP+
Sbjct  82   EQNSVPNQSYKLGLTKFADLTNEEYRSIYLGTKSSGDRRKLSKNKSD-RYLPKVGDSLPE  140

Query  464  SIDW  475
            S+DW
Sbjct  141  SVDW  144



>gb|EYU36326.1| hypothetical protein MIMGU_mgv1a005614mg [Erythranthe guttata]
Length=477

 Score =   169 bits (428),  Expect = 1e-46, Method: Composition-based stats.
 Identities = 84/127 (66%), Positives = 105/127 (83%), Gaps = 8/127 (6%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII+YD ++    PA GL R+ +EV++++ESW+ EHGKSYN +G EK+KR EIFKDNL
Sbjct  32   DMSIISYDRKNNLAVPA-GL-RSHDEVVSMHESWMAEHGKSYNAVG-EKEKRLEIFKDNL  88

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            RYIDEQN+ E+R YKLGLNRFADLTN+EYR T+LG++ D +RR+   KSD RYAPKVG +
Sbjct  89   RYIDEQNAIENRTYKLGLNRFADLTNDEYRKTFLGSRPDGKRRLTGRKSD-RYAPKVGDA  147

Query  455  LPDSIDW  475
            LPDSIDW
Sbjct  148  LPDSIDW  154



>ref|XP_011029381.1| PREDICTED: cysteine proteinase RD21a [Populus euphratica]
Length=465

 Score =   169 bits (427),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYDQTHVTKSSWRTDDEVMAMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLMFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + NS E+R YK+GLNRFADLTNEEYRS YLG +T  ++R+ KT    RYAP+VG SLPDS
Sbjct  84   QHNS-ENRTYKVGLNRFADLTNEEYRSMYLGTRTGHKKRLPKTSD--RYAPRVGDSLPDS  140

Query  467  IDW  475
            +DW
Sbjct  141  VDW  143



>gb|EPS63305.1| hypothetical protein M569_11479, partial [Genlisea aurea]
Length=453

 Score =   168 bits (426),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 101/123 (82%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y E    +   R++EE M+LYESW+VEHG+SYN LG EK++RFEIFKDNLRYID
Sbjct  24   DMSIVSYGESRGHRTPLRSEEEAMSLYESWIVEHGRSYNALG-EKERRFEIFKDNLRYID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQN+  +R Y+LGLNRFADLTN+EYR+T+LG + DA+RR+ K +SD RYA K G SLPDS
Sbjct  83   EQNAIGNRTYRLGLNRFADLTNKEYRTTFLGTRIDAKRRLLKARSD-RYAAKAGDSLPDS  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_006473275.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=468

 Score =   167 bits (422),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 103/124 (83%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVMA++E+WLV+HGK+YN LG EK+KRFEIFK+NLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNALG-EKEKRFEIFKENLRFI  82

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE NS E+R YK+GLNRFADLTNEEYRS +LGA+  A+R   K+K   RY P+VG +LPD
Sbjct  83   DEHNS-ENRTYKVGLNRFADLTNEEYRSMHLGARFGAKRTSLKSKRSNRYLPRVGEALPD  141

Query  464  SIDW  475
            S+DW
Sbjct  142  SVDW  145



>gb|AFO83614.1| papain-like cysteine protease [Fagopyrum esculentum]
Length=468

 Score =   166 bits (421),  Expect = 8e-46, Method: Compositional matrix adjust.
 Identities = 83/127 (65%), Positives = 105/127 (83%), Gaps = 7/127 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            D SII+YD  HP K  S    R+D+EVM+++ESWLV HGK+YN LG EK+KRF++FKDNL
Sbjct  27   DNSIISYDNTHPDKSSSSPNMRSDDEVMSMFESWLVHHGKNYNALG-EKEKRFQVFKDNL  85

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE NS E+R+YKLGLN+FADL+NEEYR+ YLGAKTDARRR++K +S  RYA + G S
Sbjct  86   RFIDEHNS-EERSYKLGLNKFADLSNEEYRNKYLGAKTDARRRLSKKRSS-RYAFRAGDS  143

Query  455  LPDSIDW  475
            LP+S+DW
Sbjct  144  LPESVDW  150



>gb|AAL14614.1|AF417109_1 cysteine proteinase precursor [Vasconcellea cundinamarcensis]
Length=179

 Score =   159 bits (401),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++YD++H  K   RTD+EVMA+YE+WLV+HGK YN L GEK+KRF+IFKDNLR+ID
Sbjct  51   DMSIVSYDQKHADKSSWRTDDEVMAMYEAWLVKHGKVYNAL-GEKEKRFDIFKDNLRFID  109

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  463
            E NS ++  Y+LGLNRFADLTNEEYRSTYLG K  A R   K      RYAP+ G +LPD
Sbjct  110  EHNS-QNLTYRLGLNRFADLTNEEYRSTYLGVKPGATRAARKVSGKSHRYAPRDGDALPD  168

Query  464  SIDW  475
            S DW
Sbjct  169  SFDW  172



>gb|AAU81594.1| cysteine proteinase, partial [Petunia x hybrida]
Length=167

 Score =   158 bits (399),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 80/116 (69%), Positives = 94/116 (81%), Gaps = 8/116 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H      RTD+E+M+LYE+WLV+HGKSYNGL  EKDKRF+IFKDNL YID
Sbjct  60   DMSIISYDKNH------RTDDEIMSLYEAWLVQHGKSYNGLQ-EKDKRFQIFKDNLNYID  112

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            EQNS  +++YKLGL +FADLTNEEY+STYLG KT   RR+ K KSD RY PKVG S
Sbjct  113  EQNSVPNKSYKLGLTKFADLTNEEYKSTYLGTKTGDLRRLLKNKSD-RYLPKVGDS  167



>gb|KJB14609.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=477

 Score =   166 bits (420),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRFQIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E +++K+GLNRFADLTNEEYR+ YLG K  A R++  +K+  RYA  +G  LP
Sbjct  82   IDEHNADESQSFKVGLNRFADLTNEEYRAIYLGIKK-ANRKV--SKASDRYAALLGEKLP  138

Query  461  DSIDW  475
            DS+DW
Sbjct  139  DSVDW  143



>ref|XP_008393776.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=475

 Score =   166 bits (419),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 11/131 (8%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      +  + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDN
Sbjct  26   DMSIISYDSNNHVGDSKSSGSWRTDDEVMSIYEGWLXEHGKAYNALG-EKERRFQIFKDN  84

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIA--KTKSDRRYAPK  442
            LRYIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLGAKT A+ +R++   TKSD RYAP+
Sbjct  85   LRYIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGAKTRAQMKRVSNRNTKSD-RYAPR  142

Query  443  VGGSLPDSIDW  475
            VG SLPDS+DW
Sbjct  143  VGDSLPDSVDW  153



>ref|XP_002284973.1| PREDICTED: low-temperature-induced cysteine proteinase [Vitis 
vinifera]
Length=467

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN L GEK++RF+IFKDNLR+ID
Sbjct  25   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL-GEKERRFQIFKDNLRFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+ E+R YK+GLNRFADLTNEEYRS YLG +T A+RR +   SD RYA +VG SLP+S
Sbjct  84   EHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSNKISD-RYAFRVGDSLPES  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>emb|CAN61026.1| hypothetical protein VITISV_001146 [Vitis vinifera]
Length=469

 Score =   165 bits (418),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/123 (67%), Positives = 100/123 (81%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H  K   RTDE+VMA+YE+WL +HGKSYN L GEK++RF+IFKDNLR+ID
Sbjct  27   DMSIIGYDETHGDKSSWRTDEDVMAVYEAWLAKHGKSYNAL-GEKERRFQIFKDNLRFID  85

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+ E+R YK+GLNRFADLTNEEYRS YLG +T A+RR +   SD RYA +VG SLP+S
Sbjct  86   EHNA-ENRTYKVGLNRFADLTNEEYRSMYLGTRTAAKRRSSNKISD-RYAFRVGDSLPES  143

Query  467  IDW  475
            +DW
Sbjct  144  VDW  146



>gb|ABG33750.1| cysteine protease [Hevea brasiliensis]
Length=457

 Score =   164 bits (416),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 81/123 (66%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D+SII+YD+ H  K   RTD+EVMA+YE WLV+HGK+YN L GEK++RFE+FKDNLR+ID
Sbjct  16   DLSIISYDQSHGTKSSWRTDDEVMAIYEDWLVKHGKAYNSL-GEKERRFEVFKDNLRFID  74

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS E+R Y++GLNRFADLTNEEYRS YLGA +  RR   +  SD RY P+VG SLPDS
Sbjct  75   EHNS-ENRTYRVGLNRFADLTNEEYRSMYLGALSGIRRNKLRKISD-RYTPRVGDSLPDS  132

Query  467  IDW  475
            +DW
Sbjct  133  VDW  135



>gb|AAX84673.1| cysteine protease CP1 [Manihot esculenta]
Length=467

 Score =   165 bits (417),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 82/123 (67%), Positives = 98/123 (80%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RTD+EVMA+YE WLV+ GK YN L GE++KRF++FKDNLR+ID
Sbjct  26   DMSIISYDQTHATKSSWRTDDEVMAIYEEWLVKQGKVYNAL-GEREKRFQVFKDNLRFID  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS E+R YKLGLN FADLTNEEYRSTYLGA+   +R   +  SD RYAP+VG SLPDS
Sbjct  85   EHNS-ENRTYKLGLNGFADLTNEEYRSTYLGARGGMKRNRLRKTSD-RYAPRVGESLPDS  142

Query  467  IDW  475
            +DW
Sbjct  143  VDW  145



>ref|XP_006374886.1| cysteine proteinase [Populus trichocarpa]
 gb|ABK95110.1| unknown [Populus trichocarpa]
 gb|ERP52683.1| cysteine proteinase [Populus trichocarpa]
Length=465

 Score =   164 bits (414),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 98/123 (80%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y + H  K   RTD+EVMA+YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  25   DMSIISYHQTHATKSSWRTDDEVMAMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLMFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + NS E+R Y +GLNRFADLTNEE+RS YLG +T  ++R+ KT    RYAP+VG SLPDS
Sbjct  84   QHNS-ENRTYTVGLNRFADLTNEEFRSMYLGTRTGHKKRLPKTSD--RYAPRVGDSLPDS  140

Query  467  IDW  475
            +DW
Sbjct  141  VDW  143



>ref|XP_003589134.1| Cysteine proteinase [Medicago truncatula]
Length=299

 Score =   160 bits (404),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  457
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  458  PDSIDW  475
            P+S+DW
Sbjct  146  PESVDW  151



>ref|XP_007017153.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOY14378.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=466

 Score =   163 bits (412),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 99/125 (79%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHP--AKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP  +K + RTD+EVMA+YE WLV+HGK+YNGLG EK++RFEIFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSIWRTDDEVMAMYEEWLVKHGKAYNGLG-EKERRFEIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ +  ++K+GLNRFADLTNEEYR+ YLG K   R+    +K   RYAP +G  LP
Sbjct  82   IDEHNADDSHSFKVGLNRFADLTNEEYRAMYLGTKKPERKV---SKRSDRYAPSLGEELP  138

Query  461  DSIDW  475
            DSIDW
Sbjct  139  DSIDW  143



>gb|KDP41692.1| hypothetical protein JCGZ_16099 [Jatropha curcas]
Length=466

 Score =   163 bits (412),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 99/123 (80%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H AK   RTD+EVMA+YE WL ++GK+YN L GEK++RF+IFKDNLR+ID
Sbjct  25   DMSIISYDQSHAAKSSWRTDDEVMAIYEEWLEKNGKAYNAL-GEKERRFQIFKDNLRFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS E+RAYK+ LNRFAD++NEEYRS YLGA+   RR   +  SD RY P+VG SLPDS
Sbjct  84   EHNS-ENRAYKVALNRFADISNEEYRSLYLGAQAGVRRNKLRKSSD-RYTPRVGESLPDS  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_009359945.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=474

 Score =   162 bits (411),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 86/131 (66%), Positives = 107/131 (82%), Gaps = 11/131 (8%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD  +      + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDN
Sbjct  25   DMSIISYDSNNHLGDSKSSGSWRTDDEVMSIYEGWLAEHGKAYNALG-EKERRFQIFKDN  83

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIA--KTKSDRRYAPK  442
            LRYIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLGAKT A+ +R++   TKSD RYAP+
Sbjct  84   LRYIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGAKTRAQMKRVSNRNTKSD-RYAPR  141

Query  443  VGGSLPDSIDW  475
            VG SLPDS+DW
Sbjct  142  VGDSLPDSVDW  152



>gb|KHG05637.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=457

 Score =   162 bits (410),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 79/125 (63%), Positives = 98/125 (78%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++R +IFKDNLR+
Sbjct  23   DMSIISYDEAHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRLQIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E  ++K+GLNRFADLTNEEYR+ YLG K   R+    +K+  RYAP +G  LP
Sbjct  82   IDEHNADESHSFKVGLNRFADLTNEEYRAIYLGIKKPNRKV---SKASDRYAPLLGQKLP  138

Query  461  DSIDW  475
            DS+DW
Sbjct  139  DSVDW  143



>gb|KJB14610.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=457

 Score =   162 bits (409),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 80/125 (64%), Positives = 101/125 (81%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRFQIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E +++K+GLNRFADLTNEEYR+ YLG K  A R++  +K+  RYA  +G  LP
Sbjct  82   IDEHNADESQSFKVGLNRFADLTNEEYRAIYLGIK-KANRKV--SKASDRYAALLGEKLP  138

Query  461  DSIDW  475
            DS+DW
Sbjct  139  DSVDW  143



>ref|XP_009354165.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Pyrus 
x bretschneideri]
Length=469

 Score =   161 bits (407),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 85/129 (66%), Positives = 106/129 (82%), Gaps = 9/129 (7%)
 Frame = +2

Query  107  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSI++YD    +  + G  RTD+EVM++YE WL EHGK+YN LG EK++RF+IFKDNLR
Sbjct  25   DMSIVSYDNNLGDGKSTGSWRTDDEVMSMYEGWLAEHGKAYNALG-EKERRFQIFKDNLR  83

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIA--KTKSDRRYAPKVG  448
            YIDEQNS+ + +YKLGLNRFADL+NEEYR+TYLG KT A ++R++   TKSD RYAP+VG
Sbjct  84   YIDEQNSK-NLSYKLGLNRFADLSNEEYRNTYLGTKTRAQKKRLSNRNTKSD-RYAPRVG  141

Query  449  GSLPDSIDW  475
             SLPDSIDW
Sbjct  142  DSLPDSIDW  150



>gb|AJA74414.1| cysteine protease [Cicer arietinum]
Length=495

 Score =   160 bits (405),  Expect = 2e-43, Method: Composition-based stats.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGL GEKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGL-GEKDKRFDIFKDNLKFID  86

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  463
            E N   +  Y+LGL RFADLTNEEYR+ +LG + D  R+I K  S   RYAP+VG  LP+
Sbjct  87   EHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDKLPE  145

Query  464  SIDW  475
            S+DW
Sbjct  146  SVDW  149



>ref|XP_003589135.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59386.1| papain family cysteine protease [Medicago truncatula]
Length=457

 Score =   159 bits (403),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  457
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  458  PDSIDW  475
            P+S+DW
Sbjct  146  PESVDW  151



>gb|AER60490.1| cysteine proteases [Gossypium hirsutum]
Length=371

 Score =   158 bits (399),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 98/123 (80%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            +S +T ++ HP+    R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+IDE
Sbjct  20   ISTLTLNQNHPSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFIDE  78

Query  290  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDS  466
             NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPDS
Sbjct  79   HNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPDS  138

Query  467  IDW  475
            +DW
Sbjct  139  VDW  141



>dbj|BAD29957.1| cysteine protease [Daucus carota]
Length=437

 Score =   159 bits (402),  Expect = 3e-43, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 97/124 (78%), Gaps = 4/124 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD+ H    L RTD+EVM +Y SWLV+HGKSYN LG EK+ RF+IFKDNLRYID
Sbjct  24   DMSIINYDQTH-TNSLIRTDDEVMTMYNSWLVKHGKSYNALG-EKETRFQIFKDNLRYID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGGSLPD  463
              N+  DR+Y+LGLNRFADLTNEEYR+ YLG K+ ++R +++K  SD RYAP  G  LPD
Sbjct  82   NHNADPDRSYELGLNRFADLTNEEYRAKYLGTKSRESRPKLSKGPSD-RYAPVEGEELPD  140

Query  464  SIDW  475
            SIDW
Sbjct  141  SIDW  144



>ref|XP_003589133.1| Cysteine proteinase [Medicago truncatula]
 gb|ABD32628.1| Granulin; Peptidase C1A, papain [Medicago truncatula]
 gb|AES59384.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   159 bits (402),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 80/126 (63%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ HP K  S RT++EV+ +YE WLV+HGKSYNGLG EKDKRFEIFKDNL++I
Sbjct  28   DMSIISYDKTHPDKSTSKRTNKEVLTMYEEWLVKHGKSYNGLG-EKDKRFEIFKDNLKFI  86

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR--RYAPKVGGSL  457
            DE N   +  Y+LGL RFADLTNEEYRS +LG K D  RR+ K    +  RYAP+VG  L
Sbjct  87   DEHNGL-NSTYRLGLTRFADLTNEEYRSKFLGTKIDPNRRMKKLGGSKSNRYAPRVGDKL  145

Query  458  PDSIDW  475
            P+S+DW
Sbjct  146  PESVDW  151



>ref|XP_008236565.1| PREDICTED: cysteine proteinase RD21a-like [Prunus mume]
Length=476

 Score =   159 bits (402),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 78/124 (63%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YDE+H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR++
Sbjct  30   DMSIIDYDEKHGMGVPSDRTEAEVKALYESWLVKHRKNYNALG-EKERRFEIFKDNLRFV  88

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N ++ R+YK+GLNRFADLTNEEYRS YLGAK D R R++ ++   RYA + G  LP+
Sbjct  89   DEHN-KQSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSGSRKSNRYAYRAGDELPE  147

Query  464  SIDW  475
            S+DW
Sbjct  148  SVDW  151



>gb|KHG12125.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=615

 Score =   160 bits (405),  Expect = 5e-43, Method: Composition-based stats.
 Identities = 78/125 (62%), Positives = 96/125 (77%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNANESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  461  DSIDW  475
             SIDW
Sbjct  139  ASIDW  143



>gb|ABQ10204.1| cysteine protease Cp6 [Actinidia deliciosa]
Length=461

 Score =   159 bits (401),  Expect = 6e-43, Method: Compositional matrix adjust.
 Identities = 75/107 (70%), Positives = 90/107 (84%), Gaps = 2/107 (2%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            SRTD+EVMA+YESWLV+HGKSYN +G EK+KRF+IFKDNLR+IDE N+ E R YK+GLNR
Sbjct  36   SRTDDEVMAMYESWLVKHGKSYNAIG-EKEKRFQIFKDNLRFIDEHNA-ESRTYKVGLNR  93

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            FADLTN+EYRS YLGA+T +RRR++  K   RY P  G SLPDS+DW
Sbjct  94   FADLTNDEYRSMYLGARTGSRRRLSTQKRSDRYVPVAGESLPDSVDW  140



>ref|XP_010270819.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=474

 Score =   159 bits (401),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 79/123 (64%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ YDEEH  K   R+D+EV  LYESWLV HGK+YN L GEK++RFEIFKDNLR+ID
Sbjct  30   DMSIVKYDEEHGMKTGWRSDQEVRGLYESWLVTHGKAYNAL-GEKERRFEIFKDNLRFID  88

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  +R YK+GLNRFADLTN+EYR+ YLG K +  RR ++ KS+ RYA + G +LPDS
Sbjct  89   EHNS-GNRTYKVGLNRFADLTNDEYRAMYLGTKLNPNRRASRPKSN-RYAFQAGDALPDS  146

Query  467  IDW  475
            +DW
Sbjct  147  VDW  149



>ref|XP_007222885.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
 gb|EMJ24084.1| hypothetical protein PRUPE_ppa005199mg [Prunus persica]
Length=472

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 108/129 (84%), Gaps = 9/129 (7%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGLG EK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLG-EKERRFQIFKDNLR  83

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIA--KTKSDRRYAPKVG  448
            YID+ N++ + +YKLGLNRFADL+N+EYRST+LG KT A +RR++   TKSD RYAP+VG
Sbjct  84   YIDDHNAK-NLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKRRLSNRNTKSD-RYAPRVG  141

Query  449  GSLPDSIDW  475
             SLPDS+DW
Sbjct  142  DSLPDSVDW  150



>gb|KJB48623.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=240

 Score =   152 bits (385),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>ref|XP_002510170.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52357.1| cysteine protease, putative [Ricinus communis]
Length=469

 Score =   158 bits (399),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 77/125 (62%), Positives = 101/125 (81%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY--NGLGGEKDKRFEIFKDNLRY  280
            DMSI++YD+ H  K   RTD+EVMA+YE WLV++GK++  N   GEK++RF++FKDNLR+
Sbjct  25   DMSIVSYDQTHLTKSSWRTDDEVMAIYEEWLVKNGKAHSNNNALGEKERRFQVFKDNLRF  84

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE NS E+R+YK+GLNRFADLTNEEYRS YLGA++ A+R    ++S  RY P+VG SLP
Sbjct  85   IDEHNS-ENRSYKVGLNRFADLTNEEYRSMYLGARSGAKRN-RLSRSSNRYLPRVGDSLP  142

Query  461  DSIDW  475
            DS+DW
Sbjct  143  DSVDW  147



>gb|KJB48624.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=314

 Score =   154 bits (389),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>gb|KJB48626.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=286

 Score =   153 bits (387),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>ref|XP_008220266.1| PREDICTED: low-temperature-induced cysteine proteinase [Prunus 
mume]
Length=472

 Score =   157 bits (397),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 82/129 (64%), Positives = 108/129 (84%), Gaps = 9/129 (7%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD+++    +K   RTDEEVM++YE WL +HGK+YNGLG EK++RF+IFKDNLR
Sbjct  25   DMSIISYDDKNVVGESKSSWRTDEEVMSIYEGWLAKHGKAYNGLG-EKERRFQIFKDNLR  83

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIA--KTKSDRRYAPKVG  448
            YID+ N++ + +YKLGLNRFADL+N+EYRST+LG KT A ++R++   TKSD RYAP+VG
Sbjct  84   YIDDHNAK-NLSYKLGLNRFADLSNDEYRSTFLGTKTRAQKKRLSNRNTKSD-RYAPRVG  141

Query  449  GSLPDSIDW  475
             SLPDS+DW
Sbjct  142  DSLPDSVDW  150



>ref|XP_006494485.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=372

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYACKAGDELPE  143

Query  464  SIDW  475
            S+DW
Sbjct  144  SVDW  147



>gb|KDO79088.1| hypothetical protein CISIN_1g017419mg [Citrus sinensis]
Length=372

 Score =   155 bits (392),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/124 (59%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL +HGK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKHGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYACKAGDELPE  143

Query  464  SIDW  475
            S+DW
Sbjct  144  SVDW  147



>ref|XP_004291075.1| PREDICTED: cysteine proteinase RD21a [Fragaria vesca subsp. vesca]
Length=469

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 80/124 (65%), Positives = 98/124 (79%), Gaps = 4/124 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDE-EVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD  H +   S   + EVM+LYE WL EHGK+YNGLG EK+KRF+IFKDNL++I
Sbjct  26   DMSIIAYDNNHASSSDSGRSDDEVMSLYERWLAEHGKAYNGLG-EKEKRFQIFKDNLKFI  84

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N+  + +YKLGLNRFADL+N+EYRST+LG K  A  R++KTKSD RYAP+VG  LPD
Sbjct  85   DEHNAL-NLSYKLGLNRFADLSNDEYRSTFLGTKPRAMNRLSKTKSD-RYAPRVGDQLPD  142

Query  464  SIDW  475
            S+DW
Sbjct  143  SVDW  146



>gb|AEZ65083.1| cysteine protease [Carica papaya]
Length=467

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 81/125 (65%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++YD+ H  K   RTD+EVMA+YE+WLV+HGK+YN L GEK+KRF IFKDNLR+ID
Sbjct  23   DMSIVSYDQRHADKSSWRTDDEVMAMYEAWLVKHGKAYNAL-GEKEKRFGIFKDNLRFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARR--RIAKTKSDRRYAPKVGGSLP  460
            E NS ++  Y+LGLNRFADLTNEEYRS YLG K  A R  R    KSD R+A +VG +LP
Sbjct  82   EHNS-QNLTYRLGLNRFADLTNEEYRSMYLGVKPGATRVTRKVSRKSD-RFAARVGDALP  139

Query  461  DSIDW  475
            D IDW
Sbjct  140  DFIDW  144



>gb|ABQ10200.1| cysteine protease Cp2 [Actinidia deliciosa]
Length=376

 Score =   154 bits (388),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 97/123 (79%), Gaps = 3/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII Y+     K  SRTDEEVM +Y  WL +HGK+YNG+G E+++RFEIFKDNL+++DE
Sbjct  22   MSIIDYNTNPNHKSSSRTDEEVMGIYAEWLAKHGKAYNGIG-ERERRFEIFKDNLKFVDE  80

Query  290  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDS  466
             NS E+R+YK+GLNRFADLTNEEYRS +LG KTD++RR  K+KS  RRYA +    LP+S
Sbjct  81   HNS-ENRSYKVGLNRFADLTNEEYRSMFLGTKTDSKRRFMKSKSASRRYAVQDSDMLPES  139

Query  467  IDW  475
            +DW
Sbjct  140  VDW  142



>gb|KJB48622.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>gb|KJB48625.1| hypothetical protein B456_008G078300 [Gossypium raimondii]
Length=372

 Score =   153 bits (387),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKVPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>ref|XP_008365104.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Malus 
domestica]
Length=472

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 103/129 (80%), Gaps = 9/129 (7%)
 Frame = +2

Query  107  DMSIITYDE---EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+ D    +  + G  RTD+EVM+ YE WL EHGK+YN LG EK++RF+IFKDNLR
Sbjct  25   DMSIISXDNXLGDGKSTGSWRTDDEVMSXYEGWLAEHGKAYNALG-EKERRFQIFKDNLR  83

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIA--KTKSDRRYAPKVG  448
            YIDEQNS+ + +YKLGLNRFADL+N EYR+TYLG KT A ++R++   TKSD RYAP+VG
Sbjct  84   YIDEQNSK-NLSYKLGLNRFADLSNXEYRNTYLGTKTRAQKKRLSNRNTKSD-RYAPRVG  141

Query  449  GSLPDSIDW  475
             SLPDSIDW
Sbjct  142  DSLPDSIDW  150



>ref|XP_004499026.1| PREDICTED: cysteine proteinase RD21a-like [Cicer arietinum]
Length=472

 Score =   154 bits (390),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 76/124 (61%), Positives = 94/124 (76%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  K   RT++EV+ LYE WLV+HGK YNGL GEKDKRF+IFKDNL++ID
Sbjct  28   DMSIISYDKTHTDKSSHRTEKEVLTLYEEWLVKHGKVYNGL-GEKDKRFDIFKDNLKFID  86

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  463
            E N   +  Y+LGL RFADLTNEEYR+ +LG + D  R+I K  S   RYAP+VG  LP+
Sbjct  87   EHNVL-NSTYRLGLTRFADLTNEEYRAKFLGTRVDPNRKIRKVNSPSNRYAPRVGDKLPE  145

Query  464  SIDW  475
            S+DW
Sbjct  146  SVDW  149



>dbj|BAD29960.1| cysteine protease [Daucus carota]
Length=460

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 77/123 (63%), Positives = 94/123 (76%), Gaps = 5/123 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYD+ H    +  TD+ +MA YESWLV+HGKSYN LG EK++RF+IFKDN  YID
Sbjct  21   DMSIITYDQTHA---VGSTDDVIMAAYESWLVKHGKSYNALG-EKEQRFQIFKDNFLYID  76

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQN+ +DR++KLGLNRFADLTNEEYRS Y G +T   R+    KS +RYA   G SLP+S
Sbjct  77   EQNAAKDRSFKLGLNRFADLTNEEYRSKYTGIRTKDSRKKVSGKS-QRYASLAGESLPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>ref|XP_004230752.1| PREDICTED: cysteine proteinase RD21a-like [Solanum lycopersicum]
Length=470

 Score =   154 bits (389),  Expect = 3e-41, Method: Compositional matrix adjust.
 Identities = 76/125 (61%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE+H   G +  RTD+EV  LYESW+V+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYDEKHADLGATNHRTDDEVKGLYESWIVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDEQN+ E R YKLGLNRF+DLTN+EYR+ ++G + D + R+ K     RYA K G  LP
Sbjct  81   IDEQNA-ETRPYKLGLNRFSDLTNDEYRALFVGGRFDKKTRLLKNPKSERYAFKAGEKLP  139

Query  461  DSIDW  475
            +S+DW
Sbjct  140  ESVDW  144



>ref|XP_008342944.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=473

 Score =   154 bits (388),  Expect = 5e-41, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI+ Y+E+H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDRTETEVKALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N+ + R YK+GLNRFADLTNEEYRS YLGAK D R R+  ++   RYA + G  LP+
Sbjct  90   DEHNN-QSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRSRLXGSRKSDRYAFRAGDKLPE  148

Query  464  SIDW  475
            S+DW
Sbjct  149  SVDW  152



>ref|XP_011088223.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Sesamum 
indicum]
Length=468

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 92/123 (75%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE H      R++ EVMALYESWL +HGK+YN +G EK+KRFEIFKDNL++ID
Sbjct  24   DMSIITYDENHKMGSPHRSENEVMALYESWLAKHGKAYNAIG-EKEKRFEIFKDNLKFID  82

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  DR+YKLGLNRFADLTNEEYR  ++  + D + ++   ++  RYA K G  LP S
Sbjct  83   EHNS-ADRSYKLGLNRFADLTNEEYRMLFVSGRVDRKTKLINRRASDRYAFKAGEELPQS  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_006346518.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=470

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 75/125 (60%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+Y E+H   G++  RTD+EV  LYESW+V+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYGEKHADLGVTSHRTDDEVKGLYESWIVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDEQN+ E R YKLGLNRF+DLTN+EYR+ ++G + D + R+ K     RYA K G  LP
Sbjct  81   IDEQNA-ETRPYKLGLNRFSDLTNDEYRAVFVGGRFDKKTRLLKNPKSERYAFKAGEELP  139

Query  461  DSIDW  475
            +S+DW
Sbjct  140  ESVDW  144



>emb|CAE54307.1| cysteine proteinase [Gossypium hirsutum]
Length=372

 Score =   151 bits (382),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 99/124 (80%), Gaps = 3/124 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            +S +T ++ HP+   S R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNLR+ID
Sbjct  20   ISTLTLNQNHPSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLRFID  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +LPD
Sbjct  79   EHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNLPD  138

Query  464  SIDW  475
            S++W
Sbjct  139  SVNW  142



>ref|XP_010094652.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXB56503.1| Cysteine proteinase RD21a [Morus notabilis]
Length=463

 Score =   153 bits (386),  Expect = 8e-41, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 97/123 (79%), Gaps = 9/123 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y+    +   SRTD+EVMA+YE+WLV+HGK YN LG EK+KRF+IFKDNLR+ID
Sbjct  27   DMSIVSYNLVDQSS--SRTDDEVMAIYEAWLVKHGKVYNALG-EKEKRFQIFKDNLRFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+ +DR YKLGLNRFADLTNEEYRSTYLG K   ++++++     RYAP+VG  LP  
Sbjct  84   EHNA-QDRPYKLGLNRFADLTNEEYRSTYLGTKIRGQKKVSQ-----RYAPRVGDDLPSF  137

Query  467  IDW  475
            +DW
Sbjct  138  VDW  140



>ref|XP_009772520.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana sylvestris]
Length=468

 Score =   152 bits (385),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 97/125 (78%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+Y+E+H   G +  RTD+EV  LYESWLV+HGK+YN +G EK+KRFEIFKDNLR+
Sbjct  22   DMSIISYNEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E+R+YKLGLNRF+DLTNEEYR+ ++G + D + R+ K     RY  + G  LP
Sbjct  81   IDEHNA-ENRSYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKNPKSDRYTFQAGEKLP  139

Query  461  DSIDW  475
            +S+DW
Sbjct  140  ESVDW  144



>ref|XP_007199820.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
 gb|EMJ01019.1| hypothetical protein PRUPE_ppa005328mg [Prunus persica]
Length=466

 Score =   152 bits (384),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 77/124 (62%), Positives = 97/124 (78%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD++H     S RT+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR++
Sbjct  20   DMSIINYDDKHGMGVPSDRTEAEVKALYESWLVKHRKNYNALG-EKERRFEIFKDNLRFV  78

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N ++ R+YK+GLNRFADLTNEEYRS YLGAK D R R++ ++   RYA + G  LP+
Sbjct  79   DEHN-KQSRSYKVGLNRFADLTNEEYRSIYLGAKVDRRFRLSWSRKSNRYAYRAGDELPE  137

Query  464  SIDW  475
            S+DW
Sbjct  138  SVDW  141



>ref|XP_006425969.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
 gb|ESR39209.1| hypothetical protein CICLE_v10025887mg [Citrus clementina]
Length=372

 Score =   150 bits (380),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 96/124 (77%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H      RTD+EVM +Y++WL + GK+ NG+G   +KRF+IFKDNLR+ID
Sbjct  26   DMSIISYDNNHDHSSSWRTDDEVMTIYQTWLAKRGKTSNGMG-HNEKRFQIFKDNLRFID  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E NS  +R YK+GLN+FADLTNEEYR+ YLG ++DA+RR+ K+K + +RYA K G  LP+
Sbjct  85   EHNSL-NRTYKVGLNKFADLTNEEYRAMYLGTRSDAKRRLMKSKVASQRYAFKAGDELPE  143

Query  464  SIDW  475
            S+DW
Sbjct  144  SVDW  147



>gb|KJB58559.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=437

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  461  DSIDW  475
             SIDW
Sbjct  139  ASIDW  143



>gb|EYU25464.1| hypothetical protein MIMGU_mgv1a006201mg [Erythranthe guttata]
Length=453

 Score =   151 bits (382),  Expect = 2e-40, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 99/124 (80%), Gaps = 5/124 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSY-NGLGGEKDKRFEIFKDNLRYI  283
            DMSI+++     ++   R+  E+++++ESW+V+HG+SY N   GEK++RFEIF+DNL YI
Sbjct  29   DMSILSHG---GSRSFLRSHSEMVSMHESWMVKHGRSYGNAAVGEKERRFEIFRDNLMYI  85

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DEQN+ + R +KLGLNRFADLTN EYR T+LG +TD +RR++K +SD RYAPKVG SLPD
Sbjct  86   DEQNAEDGRTHKLGLNRFADLTNAEYRKTFLGTRTDPKRRLSKVRSD-RYAPKVGDSLPD  144

Query  464  SIDW  475
            S+DW
Sbjct  145  SVDW  148



>gb|KJB58557.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=467

 Score =   151 bits (382),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  461  DSIDW  475
             SIDW
Sbjct  139  ASIDW  143



>gb|KJB58558.1| hypothetical protein B456_009G214900 [Gossypium raimondii]
Length=452

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 78/125 (62%), Positives = 95/125 (76%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVM +YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDEGHPDKSKSSWRTDDEVMVMYEEWLVKHGKAYNGLG-EKERRFKIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N  E  ++K+GLNRFADLTN+EYR+ YLG K  +      +K   RYAP+VG  LP
Sbjct  82   IDEHNVDESHSFKVGLNRFADLTNDEYRAMYLGTKKSSN---KVSKKSNRYAPRVGEELP  138

Query  461  DSIDW  475
             SIDW
Sbjct  139  ASIDW  143



>ref|XP_009591184.1| PREDICTED: cysteine proteinase RD21a-like [Nicotiana tomentosiformis]
Length=468

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 96/125 (77%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            D SII+YDE+H   G +  RTD+EV  LYESWLV+HGK+YN +G EK++RFEIF DNLR+
Sbjct  22   DKSIISYDEQHGQMGTTHHRTDDEVRGLYESWLVKHGKNYNAIG-EKERRFEIFNDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N+ E+R YKLGLNRF+DLTNEEYR+ ++G + D + R+ K+    RYA + G  LP
Sbjct  81   IDEHNA-ENRPYKLGLNRFSDLTNEEYRAMFVGGRLDRKTRLMKSPKSNRYAFQAGEKLP  139

Query  461  DSIDW  475
            +S+DW
Sbjct  140  ESVDW  144



>dbj|BAD29958.1| cysteine protease [Daucus carota]
Length=496

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 80/123 (65%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE H A G  +TD+E   L+ESWLV HGKSYN LG E++KRF+IFK+NLRYID
Sbjct  21   DMSIITYDETH-AVGF-KTDDEATTLFESWLVTHGKSYNALG-EEEKRFQIFKNNLRYID  77

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            EQN  EDR +KLGLN+FADLTNEEYRS Y G K+   R+    KS  RYA   G SLP+S
Sbjct  78   EQNLVEDRGFKLGLNKFADLTNEEYRSKYTGIKSKDLRKKVSAKSG-RYATLSGESLPES  136

Query  467  IDW  475
            +DW
Sbjct  137  VDW  139



>emb|CDO97206.1| unnamed protein product [Coffea canephora]
Length=462

 Score =   150 bits (380),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 95/123 (77%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD++H     S  D+EV ALYESWLV+HGK+YN LG EK+KRFEIFKDNLR+I 
Sbjct  22   DMSIIDYDKKHK----SSDDDEVKALYESWLVKHGKNYNALG-EKEKRFEIFKDNLRFIK  76

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+ +DR YKLGLNRFADLTN+EYRS ++G + D   R+   +S+ RYA + G SLP+S
Sbjct  77   EHNA-QDRPYKLGLNRFADLTNDEYRSMFVGGRMDRSTRLMNRRSNDRYALRAGDSLPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>gb|KDP31986.1| hypothetical protein JCGZ_12447 [Jatropha curcas]
Length=366

 Score =   149 bits (376),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H  +   R+D+EVM +Y  WL +H K+YN LG E+++RFEIFK+NLR+ID
Sbjct  22   DMSIISYDDHHNHQSGWRSDDEVMDMYNWWLAKHQKAYNKLG-ERERRFEIFKNNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS E+ +YKLGL +FADLTNEEYR+ +LG + D +RR+   K  RRYA KVG  LP+S
Sbjct  81   EHNS-ENHSYKLGLTKFADLTNEEYRAMFLGTRVDVKRRLMTKKPSRRYAFKVGDELPES  139

Query  467  IDW  475
            +DW
Sbjct  140  VDW  142



>gb|KHN04480.1| Cysteine proteinase RD21a [Glycine soja]
Length=360

 Score =   149 bits (375),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 72/123 (59%), Positives = 95/123 (77%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  19   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAVE-EKEKRFQIFKDNLNFIE  77

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +R YK+GLNRF+DL+NEEYRS YLG K D RR +A+    RRY+P+V  +LP+S
Sbjct  78   EHNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPRRMMARPS--RRYSPRVADNLPES  134

Query  467  IDW  475
            +DW
Sbjct  135  VDW  137



>ref|XP_010244238.1| PREDICTED: cysteine proteinase RD21a-like [Nelumbo nucifera]
Length=475

 Score =   150 bits (379),  Expect = 1e-39, Method: Composition-based stats.
 Identities = 73/123 (59%), Positives = 94/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y++EH      RT+E+V ALYE+WLV HGK+YN L GEK+KRFEIFKDNL++ID
Sbjct  30   DMSIISYNKEHGLTSGGRTNEQVKALYETWLVRHGKAYNAL-GEKEKRFEIFKDNLKFID  88

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS ++  Y+LGLNRFADLTN EYR+ YLG K +  +R ++ KS+ RYA +    LP S
Sbjct  89   EHNS-QNHTYRLGLNRFADLTNAEYRALYLGKKPNPNKRDSRAKSN-RYAFQADDDLPSS  146

Query  467  IDW  475
            +DW
Sbjct  147  VDW  149



>emb|CAA46863.1| thiolprotease [Pisum sativum]
Length=464

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 72/124 (58%), Positives = 95/124 (77%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DM II+YD+ HP K   RT+++V+ +YE WLV+HGK+YN L GEK+KRFEIFKDNL +ID
Sbjct  21   DMCIISYDKTHPDKSTPRTNDQVLTMYEEWLVKHGKNYNAL-GEKEKRFEIFKDNLGFID  79

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPD  463
            E NS+ + +++LGLNRFADLTNEEYR+ +LG + +  RR  K  S   RYA +VG  LP+
Sbjct  80   EHNSK-NLSFRLGLNRFADLTNEEYRTRFLGTRINPNRRNRKVNSQTNRYATRVGDKLPE  138

Query  464  SIDW  475
            S+DW
Sbjct  139  SVDW  142



>dbj|BAC75923.1| cysteine protease-1 [Helianthus annuus]
Length=461

 Score =   149 bits (377),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 82/128 (64%), Positives = 98/128 (77%), Gaps = 8/128 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS----RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII YD  H +   S    RTD+EV ALYESWLV+HGK+YN LG EKD+RF+IFKDNL
Sbjct  22   DMSIINYDATHMSSSSSSAPLRTDDEVNALYESWLVKHGKTYNALG-EKDRRFQIFKDNL  80

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKT-DARRRIAKTKSDRRYAPKVGG  451
            R+IDE NS  D  YKLGLN+FADLTNEEYR TY G KT D +++++K KSD RYA + G 
Sbjct  81   RFIDEHNSG-DHTYKLGLNKFADLTNEEYRMTYTGIKTIDDKKKLSKMKSD-RYAYRSGD  138

Query  452  SLPDSIDW  475
            SLP+ +DW
Sbjct  139  SLPEYVDW  146



>gb|KHG00992.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=375

 Score =   148 bits (373),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 98/126 (78%), Gaps = 5/126 (4%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLMF  79

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSL  457
            +DE NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    RYA + G +L
Sbjct  80   VDEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRYAHRAGDNL  139

Query  458  PDSIDW  475
            PDS++W
Sbjct  140  PDSVNW  145



>ref|XP_010556436.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=459

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/123 (62%), Positives = 92/123 (75%), Gaps = 5/123 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DM+I +Y + H AK   RTDEE MA+YE+WLV+HGK YN L GEK+KR EIFKDNLR+ID
Sbjct  23   DMTITSYGQSHVAKTDWRTDEEAMAMYEAWLVKHGKIYNEL-GEKEKRLEIFKDNLRFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  +R Y+LGLNRFADLTNEEYRS YLG     R+ +   K+  RY P+VG  LP+S
Sbjct  82   EHNSV-NRTYRLGLNRFADLTNEEYRSMYLGLGKPKRKPL---KTTNRYMPRVGDDLPES  137

Query  467  IDW  475
            +DW
Sbjct  138  VDW  140



>gb|KJB63901.1| hypothetical protein B456_010G022700 [Gossypium raimondii]
Length=467

 Score =   149 bits (376),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 100/126 (79%), Gaps = 7/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMS+++YD+ HP + +S  RT +E+MA+YE WLV+HGK YNGLG EK+KRFEIFKDNLR+
Sbjct  23   DMSVVSYDKSHPDRSMSSWRTFDEIMAMYEDWLVKHGKVYNGLG-EKEKRFEIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVG-GSL  457
            IDE NS E  ++KLGLN+FADLTNEEYR T+LG K    ++++K +SD RY   +G  +L
Sbjct  82   IDEHNSEETHSFKLGLNQFADLTNEEYRFTFLGVKK-PNKKVSK-RSD-RYVQLLGEAAL  138

Query  458  PDSIDW  475
            PDS+DW
Sbjct  139  PDSVDW  144



>gb|ABQ10202.1| cysteine protease Cp4 [Actinidia deliciosa]
Length=463

 Score =   149 bits (375),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ HP +   RTD E MA+YE WL  HGK+YN +G EK++RFEIFKDNLR++D
Sbjct  24   DMSIISYDQTHPPQ---RTDAEAMAIYEKWLTTHGKAYNAIG-EKERRFEIFKDNLRFVD  79

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+    +Y++GLNRFADLTNEEYRS +LG   + + R A TKSD RYA + G  LP S
Sbjct  80   EHNAVAG-SYRVGLNRFADLTNEEYRSMFLGGNMEMKERSASTKSD-RYAFRAGDKLPGS  137

Query  467  IDW  475
            +DW
Sbjct  138  VDW  140



>emb|CAQ00115.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=190

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 67/126 (53%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLS---RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            +S +T ++ HP+   S   R+D+EVM LY+SW+++HGK+YNG+G E++KRFEIFKDNL +
Sbjct  21   ISTLTLNQNHPSSSSSSSWRSDDEVMGLYKSWVIQHGKAYNGIG-EEEKRFEIFKDNLMF  79

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSL  457
            +DE NS  +  YKLGLN+FADLTN+EYR+ +LG +TD RRR+ K+K    R A +   +L
Sbjct  80   VDEHNSNNNTTYKLGLNKFADLTNQEYRAKFLGTRTDPRRRLMKSKIPSSRNAHRAADNL  139

Query  458  PDSIDW  475
            PDS++W
Sbjct  140  PDSVNW  145



>ref|XP_008361440.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=289

 Score =   145 bits (366),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 11/131 (8%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN LG EK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALG-EKERSFQIFKDN  83

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIA--KTKSDRRYAPK  442
            LRYIDE+NS+ + +YKLGLNRF DL NEEYR+TYLGAKT A+ +R++    KSD RYAP 
Sbjct  84   LRYIDEKNSK-NLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSD-RYAPH  141

Query  443  VGGSLPDSIDW  475
            VG SL DS+DW
Sbjct  142  VGDSLLDSVDW  152



>ref|XP_009335016.1| PREDICTED: cysteine proteinase RD21a-like isoform X1 [Pyrus x 
bretschneideri]
Length=474

 Score =   148 bits (374),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI+ Y+E+H     S  T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDPTETEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRR--IAKTKSDRRYAPKVGGSL  457
            DE N ++ R YK+GLNRFADLTNEEYRS YLGAK D RRR  ++ ++   RYA +VG  L
Sbjct  90   DEHN-KQSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  458  PDSIDW  475
            P+ +DW
Sbjct  149  PELVDW  154



>ref|XP_009335017.1| PREDICTED: cysteine proteinase RD21a-like isoform X2 [Pyrus x 
bretschneideri]
Length=474

 Score =   148 bits (374),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 77/126 (61%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI+ Y+E+H     S  T+ EV ALYESWLV+H K+YN LG EK++RFEIFKDNLR+I
Sbjct  31   DMSIVDYNEKHGMPASSDPTEPEVRALYESWLVKHAKNYNALG-EKERRFEIFKDNLRFI  89

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRR--IAKTKSDRRYAPKVGGSL  457
            DE N ++ R YK+GLNRFADLTNEEYRS YLGAK D RRR  ++ ++   RYA +VG  L
Sbjct  90   DEHN-KQSRTYKVGLNRFADLTNEEYRSVYLGAKVDRRRRSGLSGSRKSDRYAFRVGDKL  148

Query  458  PDSIDW  475
            P+ +DW
Sbjct  149  PELVDW  154



>ref|XP_010549252.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=458

 Score =   148 bits (373),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 92/123 (75%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE+H   G  R++ E   +YE+WLV+HGK YN L GEKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEKHHVSGGGRSEAETEEMYEAWLVKHGKFYNAL-GEKDRRFEIFKDNLRFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+R +  Y+LGL RFADLTN+EYRS YLGAK   R      ++  RY P+VG ++PDS
Sbjct  82   EHNAR-NLTYRLGLTRFADLTNDEYRSMYLGAKPHKR----TLRTSDRYLPRVGDAIPDS  136

Query  467  IDW  475
            +DW
Sbjct  137  VDW  139



>ref|NP_001242660.1| uncharacterized protein LOC100807362 precursor [Glycine max]
 gb|ACU18666.1| unknown [Glycine max]
Length=367

 Score =   146 bits (369),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 94/123 (76%), Gaps = 4/123 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD  H  K   ++DEEVM++YE WLV+HGK YN +  EK+KRF+IFKDNL +I+
Sbjct  26   DMSIISYDRSHADKSGWKSDEEVMSIYEEWLVKHGKVYNAV-EEKEKRFQIFKDNLNFIE  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +R YK+GLNRF+DL+NEEYRS YLG K D  R +A+    RRY+P+V  +LP+S
Sbjct  85   EHNAV-NRTYKVGLNRFSDLSNEEYRSKYLGTKIDPSRMMARPS--RRYSPRVADNLPES  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_011097243.1| PREDICTED: cysteine proteinase COT44 [Sesamum indicum]
Length=371

 Score =   146 bits (369),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 73/125 (58%), Positives = 97/125 (78%), Gaps = 5/125 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D SI+ Y+ +H A    R++E+V  LYE WL +HGK+YNG+G EKD+RF+IFKDNL+++D
Sbjct  22   DFSILDYNNKHAASN-PRSEEQVKGLYERWLAKHGKAYNGIG-EKDRRFQIFKDNLKFVD  79

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVG-GSLP  460
            E NS  +R YK+GLNRFADLTNEE+RS YLG +TDA+RR  K+K + RRYA + G   LP
Sbjct  80   EHNS-GNRTYKVGLNRFADLTNEEFRSVYLGTRTDAKRRFVKSKNASRRYAFRAGDDELP  138

Query  461  DSIDW  475
            +S+DW
Sbjct  139  ESVDW  143



>ref|XP_002863697.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH39956.1| hypothetical protein ARALYDRAFT_917391 [Arabidopsis lyrata subsp. 
lyrata]
Length=463

 Score =   147 bits (371),  Expect = 9e-39, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 96/127 (76%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  274
            DMSII+YDE H    +S R+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHISTVSSRSDAEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            RYIDE N++ + +YKLGL RFADLTN+EYRS YLGAK    +R+ KT    RY  +VG +
Sbjct  83   RYIDEHNTK-NLSYKLGLTRFADLTNDEYRSMYLGAK--PVKRVLKTSD--RYEARVGDA  137

Query  455  LPDSIDW  475
            LPDS+DW
Sbjct  138  LPDSVDW  144



>gb|AAQ62999.1| oil palm polygalacturonase allergen PEST472 [Elaeis guineensis]
Length=525

 Score =   148 bits (373),  Expect = 9e-39, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N L GEK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNAL-GEKERRFEIFKDNVRFID  82

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +  + RR A+  SD RY    G  L
Sbjct  83   AHNAAADSGHRSFRLGLNRFADMTNEEYRTVYLGTRPASHRRRARLGSD-RYRYNAGEEL  141

Query  458  PDSIDW  475
            P+S+DW
Sbjct  142  PESVDW  147



>ref|XP_002524912.1| cysteine protease, putative [Ricinus communis]
 gb|EEF37409.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score =   145 bits (367),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 96/124 (77%), Gaps = 2/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++++  H  +   R+D EV+++Y  WL +H K+YN LG E++KRFEIFK+NLR+ID
Sbjct  22   DMSILSHNHGHHHQSSWRSDNEVISMYNWWLAKHSKTYNKLG-EREKRFEIFKNNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPD  463
            E N+ ++R YK+GL RFADLTNEEYR+ +LG K+D +RR+ K+K+  +RYA K G  LP+
Sbjct  81   EHNNSKNRTYKVGLTRFADLTNEEYRAKFLGTKSDPKRRLMKSKNPSQRYAFKAGDVLPE  140

Query  464  SIDW  475
            SIDW
Sbjct  141  SIDW  144



>ref|XP_008377786.1| PREDICTED: cysteine proteinase RD21a-like [Malus domestica]
Length=349

 Score =   145 bits (366),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 80/131 (61%), Positives = 100/131 (76%), Gaps = 11/131 (8%)
 Frame = +2

Query  107  DMSIITYDE-----EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSII+YD      ++ + G  RTD  VM++YE WL EHGK+YN LG EK++ F+IFKDN
Sbjct  25   DMSIISYDSNNHLGDNKSLGSWRTDNVVMSIYEGWLAEHGKAYNALG-EKERSFQIFKDN  83

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR-RRIA--KTKSDRRYAPK  442
            LRYIDE+NS+ + +YKLGLNRF DL NEEYR+TYLGAKT A+ +R++    KSD RYAP 
Sbjct  84   LRYIDEKNSK-NLSYKLGLNRFVDLLNEEYRNTYLGAKTRAQMKRVSNRNIKSD-RYAPH  141

Query  443  VGGSLPDSIDW  475
            VG SL DS+DW
Sbjct  142  VGDSLLDSVDW  152



>ref|NP_568620.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
 dbj|BAB08269.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAL32686.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AAM47980.1| cysteine protease component of protease-inhibitor complex [Arabidopsis 
thaliana]
 gb|AED94905.1| Granulin repeat cysteine protease family protein [Arabidopsis 
thaliana]
Length=463

 Score =   147 bits (370),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 78/127 (61%), Positives = 95/127 (75%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKG-LSRTDEEVMALYESWLVEHGK---SYNGLGGEKDKRFEIFKDNL  274
            DMSII+YDE H      SR+D EV  +YE+W+VEHGK   + NGLG EKD+RFEIFKDNL
Sbjct  23   DMSIISYDENHHITTETSRSDSEVERIYEAWMVEHGKKKMNQNGLGAEKDQRFEIFKDNL  82

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK    +R+ KT    RY  +VG +
Sbjct  83   RFIDEHNTK-NLSYKLGLTRFADLTNEEYRSMYLGAK--PTKRVLKTSD--RYQARVGDA  137

Query  455  LPDSIDW  475
            LPDS+DW
Sbjct  138  LPDSVDW  144



>ref|XP_007042494.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX98325.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=579

 Score =   147 bits (372),  Expect = 2e-38, Method: Composition-based stats.
 Identities = 70/126 (56%), Positives = 95/126 (75%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YD +H  +   RT+ ++  +YE+WLV+HGK+YNGL GEK+KRFEIFKDNL++I+
Sbjct  134  DMSIIDYDLKHGGQQQKRTETQIRRMYETWLVKHGKAYNGL-GEKEKRFEIFKDNLKFIE  192

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR---RRIAKTKSDRRYAPKVGGSL  457
            E NS  +  YK+GLNRFADLTNEEY++ YLGA+ D +    R+A  +  +RY  +VG  L
Sbjct  193  EHNS-VNGTYKVGLNRFADLTNEEYKAMYLGARLDGKTVSHRLAGKEKSQRYVFRVGDKL  251

Query  458  PDSIDW  475
            P+S+DW
Sbjct  252  PESVDW  257



>ref|XP_010494270.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=467

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 96/131 (73%), Gaps = 13/131 (10%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIF  262
            DMSII+YDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIISYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQKNVLGAEKDQRFEIF  82

Query  263  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  442
            KDNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RYA +
Sbjct  83   KDNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAKPS--KRVLKTSD--RYAAR  137

Query  443  VGGSLPDSIDW  475
            VG SLPDS+DW
Sbjct  138  VGDSLPDSVDW  148



>ref|XP_006280322.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
 gb|EOA13220.1| hypothetical protein CARUB_v10026245mg, partial [Capsella rubella]
Length=511

 Score =   146 bits (368),  Expect = 4e-38, Method: Composition-based stats.
 Identities = 79/133 (59%), Positives = 98/133 (74%), Gaps = 13/133 (10%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKS---YNGL-GGEKDK-RFE  256
            DMSII+YD+ H          SR+D EV  +Y+SWLVEHGK     NGL G +KD+ RFE
Sbjct  63   DMSIISYDKNHHITTTTTTVTSRSDAEVERIYDSWLVEHGKKKEKMNGLLGSDKDQERFE  122

Query  257  IFKDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYA  436
            IFKDNLR+IDE N++++ +YKLGLNRFADLTNEEYRS YLGAK +  +R+ K  SD RY 
Sbjct  123  IFKDNLRFIDEHNNKKNLSYKLGLNRFADLTNEEYRSMYLGAKPN--KRVLKKTSD-RYE  179

Query  437  PKVGGSLPDSIDW  475
             +VG +LPDS+DW
Sbjct  180  ARVGDALPDSVDW  192



>gb|KJB43804.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=277

 Score =   142 bits (357),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DW
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDW  134



>ref|XP_003603086.1| Cysteine proteinase [Medicago truncatula]
 gb|AES73337.1| papain family cysteine protease [Medicago truncatula]
Length=474

 Score =   145 bits (367),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 76/126 (60%), Positives = 93/126 (74%), Gaps = 4/126 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGL-GGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H  K   R+D+EV  +YE W V+HGK  N + G EKDKRFEIFKDNL++I
Sbjct  27   DMSIISYDKTHSDKSSRRSDKEVKNIYEEWRVKHGKLNNNIDGSEKDKRFEIFKDNLKFI  86

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDA-RRRIAKTKS-DRRYAPKVGGSL  457
            DE N+ E+R YK+GLNRFADL+NEEYRS YLG K D     +A+TK+   RYAP VG  L
Sbjct  87   DEHNA-ENRTYKVGLNRFADLSNEEYRSRYLGTKIDPIGMMMARTKTRSNRYAPSVGDKL  145

Query  458  PDSIDW  475
            P S+DW
Sbjct  146  PKSVDW  151



>ref|XP_010540378.1| PREDICTED: cysteine proteinase RD21a-like [Tarenaya hassleriana]
Length=460

 Score =   145 bits (366),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 81/160 (51%), Positives = 102/160 (64%), Gaps = 28/160 (18%)
 Frame = +2

Query  2    FPFLFTTVITLSSPDMakllilslfvlaavsaaaaDMSIITYDEEH--PAKGLSRTDEEV  175
               LF TVI+LSS                      DMSII+YDE+H     G  R++ + 
Sbjct  8    LAILFLTVISLSSA--------------------MDMSIISYDEKHHVSGGGGGRSEVDT  47

Query  176  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNE  355
             ALYE+WLV+HGK YN LG EKD+RFEIFK+NLR+IDE N++ + +Y+LGL RFADLTNE
Sbjct  48   AALYEAWLVKHGKFYNALG-EKDRRFEIFKENLRFIDEHNAK-NLSYRLGLTRFADLTNE  105

Query  356  EYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            EYRS YLGAK   R      ++  RY P+V  +LPDS+DW
Sbjct  106  EYRSMYLGAKPHKR----TLRTSDRYQPRVSDALPDSVDW  141



>ref|XP_010070600.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW59473.1| hypothetical protein EUGRSUZ_H02220 [Eucalyptus grandis]
Length=386

 Score =   144 bits (362),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 66/122 (54%), Positives = 92/122 (75%), Gaps = 2/122 (2%)
 Frame = +2

Query  113  SIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQ  292
            SII Y  +       RTD EV+ +YE WL  HGK+YNGLG E++ RF++FKDNLR+IDE 
Sbjct  28   SIIDYAAKGRTASAPRTDGEVVEMYELWLARHGKAYNGLG-EREMRFQVFKDNLRFIDEH  86

Query  293  NSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSI  469
            NS ++R Y LGLN+FADLTN+EYR+ YLG +++A+RR+ K++ + RRYA + G  LP+++
Sbjct  87   NSSQNRTYTLGLNKFADLTNDEYRAMYLGTRSEAKRRVMKSRNASRRYAVRAGDRLPEAV  146

Query  470  DW  475
            DW
Sbjct  147  DW  148



>ref|XP_010481911.1| PREDICTED: cysteine proteinase RD21a [Camelina sativa]
Length=467

 Score =   145 bits (365),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 79/131 (60%), Positives = 95/131 (73%), Gaps = 13/131 (10%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIF  262
            DMSIITYDE+H         SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIF
Sbjct  23   DMSIITYDEKHHITTTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIF  82

Query  263  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  442
            KDNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RY  +
Sbjct  83   KDNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAK--PTKRVLKTSD--RYEAR  137

Query  443  VGGSLPDSIDW  475
            VG SLPDS+DW
Sbjct  138  VGDSLPDSVDW  148



>ref|XP_010061721.1| PREDICTED: low-temperature-induced cysteine proteinase [Eucalyptus 
grandis]
 gb|KCW68707.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   144 bits (364),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/129 (57%), Positives = 96/129 (74%), Gaps = 8/129 (6%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN LG EK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALG-EKEKRFQVFKDN  87

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVG  448
            LR+ID+ N+  DR Y +GLN+FADLTNEEYRS YLGA+ D + RR+ + +SD RYA   G
Sbjct  88   LRFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSD-RYAVAAG  146

Query  449  GSLPDSIDW  475
              LP S+DW
Sbjct  147  EELPASVDW  155



>ref|XP_008799871.1| PREDICTED: oryzain alpha chain-like isoform X1 [Phoenix dactylifera]
 ref|XP_008799878.1| PREDICTED: oryzain alpha chain-like isoform X2 [Phoenix dactylifera]
Length=473

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+R+ID
Sbjct  27   DMSIISYDEAHGVRGLERSEEEMRLLYEGWLAKHGRAYNAL-GEKERRFEIFKDNVRFID  85

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D    +++LGLNRFAD+TNEEYR+ YLG +    RR A+  SD RY    G  L
Sbjct  86   AHNAEADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARFGSD-RYRYNAGEEL  144

Query  458  PDSIDW  475
            P+S+DW
Sbjct  145  PESVDW  150



>gb|KCW68708.1| hypothetical protein EUGRSUZ_F02310 [Eucalyptus grandis]
Length=478

 Score =   144 bits (364),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 74/129 (57%), Positives = 96/129 (74%), Gaps = 8/129 (6%)
 Frame = +2

Query  107  DMSIITYDEEH-----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDN  271
            DMSI++YD  H      +    R+D+EVMA+YESWL +HGK+YN LG EK+KRF++FKDN
Sbjct  29   DMSIVSYDRAHGDRSSSSSSSWRSDDEVMAVYESWLAKHGKAYNALG-EKEKRFQVFKDN  87

Query  272  LRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVG  448
            LR+ID+ N+  DR Y +GLN+FADLTNEEYRS YLGA+ D + RR+ + +SD RYA   G
Sbjct  88   LRFIDDHNAGGDRTYTVGLNQFADLTNEEYRSMYLGARMDRSGRRLGRARSD-RYAVAAG  146

Query  449  GSLPDSIDW  475
              LP S+DW
Sbjct  147  EELPASVDW  155



>ref|XP_011000919.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=488

 Score =   144 bits (364),  Expect = 1e-37, Method: Composition-based stats.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E + LYE WLVEHGK+YN LG EK++RFEIFKDNL+++D
Sbjct  35   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVEHGKAYNALG-EKERRFEIFKDNLKFVD  92

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + NS  + +YKLGLN+FADL+NEEYR+ YLG + D +RR+       RY  K G  LP+S
Sbjct  93   QHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMDGKRRLLGGPKSARYLFKDGDDLPES  152

Query  467  IDW  475
            +DW
Sbjct  153  VDW  155



>gb|ABR19827.1| cysteine proteinase [Elaeis guineensis]
Length=470

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNAL-GEKERRFEIFKDNVLFID  82

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +    RR A+  SD RY    G  L
Sbjct  83   AHNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSD-RYRYNAGEDL  141

Query  458  PDSIDW  475
            P+S+DW
Sbjct  142  PESVDW  147



>ref|XP_010906541.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=470

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 92/126 (73%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++YN L GEK++RFEIFKDN+ +ID
Sbjct  24   DMSIISYDEAHGVRGLERSEEEMRILYEGWLAKHGRAYNAL-GEKERRFEIFKDNVLFID  82

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +    RR A+  SD RY    G  L
Sbjct  83   AHNAAADAGHRSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSD-RYRYNAGEDL  141

Query  458  PDSIDW  475
            P+S+DW
Sbjct  142  PESVDW  147



>gb|KJB14608.1| hypothetical protein B456_002G133800 [Gossypium raimondii]
Length=341

 Score =   141 bits (355),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 81/93 (87%), Gaps = 3/93 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE HP K  S  RTD+EVMA+YE WLV+HGK+YNGLG EK++RF+IFKDNLR+
Sbjct  23   DMSIISYDETHPDKSTSSWRTDDEVMAMYEEWLVKHGKTYNGLG-EKERRFQIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLG  379
            IDE N+ E +++K+GLNRFADLTNEEYR+ YLG
Sbjct  82   IDEHNADESQSFKVGLNRFADLTNEEYRAIYLG  114



>ref|XP_009618803.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana tomentosiformis]
Length=376

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 70/128 (55%), Positives = 90/128 (70%), Gaps = 6/128 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSR----TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII Y        + +     DEEV  +YE WL EHGK+YN LG EK+KRFEIFKDNL
Sbjct  22   DMSIIDYKNNQHVGNMKKWTWQNDEEVKGIYELWLAEHGKAYNALG-EKEKRFEIFKDNL  80

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGG  451
            ++I+E N+  +R YK+GLN+FADLTNEEYR+ YLG ++DARRR  K+K+   RYA +   
Sbjct  81   KFIEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTRSDARRRFVKSKNPSHRYASRPNE  140

Query  452  SLPDSIDW  475
             +P S+DW
Sbjct  141  LMPHSVDW  148



>gb|KJB43805.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=366

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DW
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDW  134



>gb|KJB43803.1| hypothetical protein B456_007G216900 [Gossypium raimondii]
Length=367

 Score =   141 bits (356),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 91/107 (85%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R+D+EVM+LY++WLV+HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLVKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G SLP+S+DW
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDSLPESVDW  134



>ref|XP_007047371.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
 gb|EOX91528.1| Granulin repeat cysteine protease family protein [Theobroma cacao]
Length=384

 Score =   141 bits (356),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 89/105 (85%), Gaps = 2/105 (2%)
 Frame = +2

Query  164  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFAD  343
            D+EV +LY+SWLV+HGK+YNG+G E++ RF+IFKDNL++IDE NS  +R YKLGLN+FAD
Sbjct  50   DDEVRSLYKSWLVKHGKAYNGIG-EEEMRFDIFKDNLKFIDEHNSNNNRTYKLGLNKFAD  108

Query  344  LTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            LTN+EYRS +LG ++D RRR+ K+K+  +RYA + G SLP+S+DW
Sbjct  109  LTNQEYRSKFLGTRSDPRRRVMKSKNPSQRYAFRAGDSLPESVDW  153



>ref|XP_009395501.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 92/124 (74%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDEEH A+GL R++EEV  +Y++W+ EHG+ +N L GE+++RFE+FKDNLR+ID
Sbjct  25   DMSIISYDEEHGARGLERSEEEVRRMYDAWVAEHGRVHNAL-GEREQRFEVFKDNLRFID  83

Query  287  EQNS-REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+  E   + LGLNRFADLTNEEYR+TYLG +     R  +  SD RY  + G  LP+
Sbjct  84   AHNADAEAYGFSLGLNRFADLTNEEYRATYLGTRAGGTARRLRAPSD-RYRHEAGDELPE  142

Query  464  SIDW  475
            S+DW
Sbjct  143  SVDW  146



>gb|ACB87490.1| mucunain [Mucuna pruriens]
Length=422

 Score =   142 bits (358),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 68/101 (67%), Positives = 84/101 (83%), Gaps = 3/101 (3%)
 Frame = +2

Query  176  MALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNE  355
            M+LYE WLV+HGK+YN LG EKDKRF+IFKDNLR+ID+ N+ ++R YKLGLNRFADLTNE
Sbjct  1    MSLYEQWLVKHGKAYNALG-EKDKRFDIFKDNLRFIDDHNA-DNRTYKLGLNRFADLTNE  58

Query  356  EYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDW  475
            EYR+ YLG + D  RR  KTK+   RYAP+VG +LP+S+DW
Sbjct  59   EYRARYLGTRIDPNRRFVKTKTQSNRYAPRVGDNLPESVDW  99



>ref|XP_002518705.1| cysteine protease, putative [Ricinus communis]
 gb|EEF43630.1| cysteine protease, putative [Ricinus communis]
Length=471

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 93/123 (76%), Gaps = 3/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ Y+ +H  K   RTD +V  +YE WLVEHGK+YN LG EK+KRFEIFKDNLR+ID
Sbjct  25   DMSIVDYNIKHGTKYPLRTDSQVRRMYEMWLVEHGKAYNALG-EKEKRFEIFKDNLRFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  DR+YK+GLNRFADLTNEEY++ +LG K + + R   T+S +RY  K G  LP++
Sbjct  84   EHNSV-DRSYKVGLNRFADLTNEEYKAMFLGTKMERKNRFLGTRS-QRYLFKDGDDLPEN  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_010928366.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=465

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++EE+  LYE WL +HG++ N L GEK++RFEIFKDN+R+ID
Sbjct  24   DMSIISYDEAHGVQGLERSEEEMRLLYEGWLAKHGRADNAL-GEKERRFEIFKDNVRFID  82

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D   R+++LGLNRFAD+TNEEYR+ YLG +  + RR A+  SD RY    G  L
Sbjct  83   AHNAAADSGHRSFRLGLNRFADMTNEEYRAVYLGTRPASHRRRARLGSD-RYRYNAGEEL  141

Query  458  PDSIDW  475
            P+S+DW
Sbjct  142  PESVDW  147



>gb|AAK07730.1| CPR1-like cysteine proteinase [Nicotiana tabacum]
Length=374

 Score =   141 bits (355),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 92/126 (73%), Gaps = 4/126 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            I+E N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  458  PDSIDW  475
            P S+DW
Sbjct  141  PHSVDW  146



>ref|XP_009784112.1| PREDICTED: cysteine proteinase COT44-like [Nicotiana sylvestris]
Length=374

 Score =   140 bits (354),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 71/126 (56%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A    L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYASKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            I+E N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEEHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  458  PDSIDW  475
            P S+DW
Sbjct  141  PHSVDW  146



>ref|XP_010442084.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=466

 Score =   141 bits (356),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 77/130 (59%), Positives = 94/130 (72%), Gaps = 12/130 (9%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGK----SYNGLGGEKDKRFEIFK  265
            DMSII+YDE+H        SR+D EV  +Y++WLVEHGK      N LG EKD+RFEIFK
Sbjct  23   DMSIISYDEKHHITTTTVTSRSDAEVERIYDAWLVEHGKKKMNQNNVLGAEKDQRFEIFK  82

Query  266  DNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKV  445
            DNLR+IDE N++ + +YKLGLNRFADLTN+EYRS YLGAK    +R+ KT    RY  +V
Sbjct  83   DNLRFIDEHNTK-NLSYKLGLNRFADLTNQEYRSMYLGAKPS--KRVLKTSD--RYEARV  137

Query  446  GGSLPDSIDW  475
            G SLP S+DW
Sbjct  138  GDSLPGSVDW  147



>gb|ABQ10198.1| actinidin Act4b [Actinidia eriantha]
Length=379

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 73/123 (59%), Positives = 91/123 (74%), Gaps = 9/123 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D SIITY +    K   RT++EVMA++ESWLVE+GKSYN LG EK++RFEIFKDNLR++D
Sbjct  26   DASIITYAK----KWEQRTNDEVMAMFESWLVEYGKSYNALG-EKERRFEIFKDNLRFVD  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +R+YK+GLN+F+DLT EEY S YLG K D R     T    RY P+VG  LP+S
Sbjct  81   EHNADVNRSYKVGLNQFSDLTLEEYSSIYLGTKFDMRM----TNVSDRYEPRVGDQLPNS  136

Query  467  IDW  475
            IDW
Sbjct  137  IDW  139



>ref|XP_002313136.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
 gb|EEE87091.2| hypothetical protein POPTR_0009s10090g [Populus trichocarpa]
Length=477

 Score =   141 bits (356),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 66/123 (54%), Positives = 90/123 (73%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E + LYE WLV++GK+YN LG EK++RFEIFKDNL+++D
Sbjct  24   DMSIIDYNLKH-GQVPERTEAETLRLYEMWLVKYGKAYNALG-EKERRFEIFKDNLKFVD  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + NS  + +YKLGLN+FADL+NEEYR+ YLG + D +RR+       RY  K G  LP+S
Sbjct  82   QHNSVGNPSYKLGLNKFADLSNEEYRAAYLGTRMDGKRRLLGGPKSARYLFKDGDDLPES  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_002310708.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
 gb|EEE91158.2| hypothetical protein POPTR_0007s10650g [Populus trichocarpa]
Length=376

 Score =   140 bits (352),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI  +D+ H +   S  R+D+EVM++Y+ WL +HGK+YN LG EK KRFEIFK+NLR+
Sbjct  20   DMSIFNHDDNHLSHDQSSWRSDDEVMSIYKWWLQKHGKAYNRLG-EKAKRFEIFKNNLRF  78

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            IDE NS ++R YK+GL +FADLTN+EYR+ +LG ++D +RR+ K+K+   RYA K G  L
Sbjct  79   IDEHNS-QNRTYKVGLTKFADLTNQEYRAMFLGTRSDPKRRLMKSKNPSERYAYKAGDKL  137

Query  458  PDSIDW  475
            P+S+DW
Sbjct  138  PESVDW  143



>gb|EYU34557.1| hypothetical protein MIMGU_mgv1a007408mg [Erythranthe guttata]
Length=408

 Score =   140 bits (353),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 88/107 (82%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTDE+V  LYESWL +HGK+YNG+G EKD+RF+IFKDNL+++D+ NS  +R Y++GLN+F
Sbjct  36   RTDEQVKGLYESWLAKHGKAYNGIG-EKDRRFDIFKDNLKFVDDHNSG-NRTYEVGLNKF  93

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            ADLTNEEYRSTYLG ++D  RR  K+K+  RRYA + G  LP+S+DW
Sbjct  94   ADLTNEEYRSTYLGTRSDPTRRFVKSKNPSRRYALRSGEMLPESVDW  140



>ref|XP_006595983.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=250

 Score =   137 bits (344),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T     Y P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKS  136

Query  467  IDW  475
            +DW
Sbjct  137  VDW  139



>ref|XP_004136967.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
 gb|KGN43904.1| Cysteine protease [Cucumis sativus]
Length=479

 Score =   141 bits (355),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 81/106 (76%), Gaps = 3/106 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R DEEV ALYESWLV HGK+YN +G EK++RFEIFKDNLR+IDE N RE R YK+GL RF
Sbjct  53   RPDEEVAALYESWLVHHGKAYNAIG-EKERRFEIFKDNLRFIDEHN-RESRTYKVGLTRF  110

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYR+ +LG +   + R++  KS  RYA  +G  LPD +DW
Sbjct  111  ADLTNEEYRARFLGGRFSRKPRLSAAKSG-RYAAALGDDLPDDVDW  155



>emb|CDX71540.1| BnaC04g17750D [Brassica napus]
Length=460

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK+  ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKS--KKRVLKTSD--RYQPRVGDA  136

Query  455  LPDSIDW  475
            +PDS+DW
Sbjct  137  IPDSVDW  143



>ref|XP_008813817.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Phoenix 
dactylifera]
Length=469

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H  +GL R++E++  LYE WL +HG++YN L GEK++RFEIFKDN+R+ID
Sbjct  25   DMSIISYDETHGVRGLERSEEDMRLLYEGWLAKHGRAYNAL-GEKERRFEIFKDNVRFID  83

Query  287  EQNS-REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+     +++LGLNRFAD+TNEEYR+ YLG +    RR A+  SD RY    G  LP+
Sbjct  84   AHNADAGHHSFRLGLNRFADMTNEEYRAVYLGTRPAGHRRRARVGSD-RYRYDAGDVLPE  142

Query  464  SIDW  475
            S+DW
Sbjct  143  SVDW  146



>gb|AAL60579.1|AF454957_1 senescence-associated cysteine protease [Brassica oleracea]
Length=460

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 97/127 (76%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITAENERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK+  ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKS--KKRVLKTSD--RYQPRVGDA  136

Query  455  LPDSIDW  475
            +PDS+DW
Sbjct  137  IPDSVDW  143



>ref|XP_004171356.1| PREDICTED: cysteine proteinase RD21a-like, partial [Cucumis sativus]
Length=168

 Score =   134 bits (337),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 81/107 (76%), Gaps = 3/107 (3%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
             R DEEV ALYESWLV HGK+YN +G EK++RFEIFKDNLR+IDE N RE R YK+GL R
Sbjct  52   QRPDEEVAALYESWLVHHGKAYNAIG-EKERRFEIFKDNLRFIDEHN-RESRTYKVGLTR  109

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            FADLTNEEYR+ +LG +   + R++  KS  RYA  +G  LPD +DW
Sbjct  110  FADLTNEEYRARFLGGRFSRKPRLSAAKSG-RYAAALGDDLPDDVDW  155



>ref|XP_002285299.1| PREDICTED: cysteine proteinase RD21a-like [Vitis vinifera]
Length=469

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 71/123 (58%), Positives = 93/123 (76%), Gaps = 6/123 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y +        RTD EVMA+YE+WLV+HGKSYN LG E+++RFEIFKDNLR+I+
Sbjct  32   DMSIISYGDRLE----KRTDAEVMAVYEAWLVKHGKSYNALG-ERERRFEIFKDNLRFIE  86

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N+  +R YK+GLNRFADLTNEEYRS YLG + + RR +  ++   RY+ + G  LP+S
Sbjct  87   EHNAV-NRTYKVGLNRFADLTNEEYRSRYLGRRDETRRGLRASRVSDRYSFRAGEDLPES  145

Query  467  IDW  475
            +DW
Sbjct  146  VDW  148



>ref|XP_002306486.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
 gb|EEE93482.2| hypothetical protein POPTR_0005s18520g [Populus trichocarpa]
Length=396

 Score =   139 bits (351),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 97/126 (77%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+T ++  P    S  R+D+EVM++Y+ WL +HGK+YN LG E+ +RFEIFK+NLR+
Sbjct  20   DMSILTSNDNQPNHDRSSWRSDDEVMSMYKWWLAKHGKAYNRLG-EEAERFEIFKNNLRF  78

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            IDE NS ++  YK+GL +FADLTNEEYR+ +LG ++DA+RR+ K+KS   RYA K G  L
Sbjct  79   IDEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDAKRRLMKSKSPSERYAFKAGDKL  137

Query  458  PDSIDW  475
            P+S+DW
Sbjct  138  PESVDW  143



>ref|XP_002283263.1| PREDICTED: cysteine proteinase COT44 [Vitis vinifera]
Length=374

 Score =   139 bits (350),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 66/107 (62%), Positives = 87/107 (81%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R++EEVM +Y+ W+ +HGK+YNGLG EK+KRFEIFKDNL++IDE N+ ++R YK+GLNRF
Sbjct  37   RSEEEVMGMYQWWMAKHGKAYNGLG-EKEKRFEIFKDNLKFIDEHNA-QNRTYKVGLNRF  94

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYR+ YLG ++D +RR AK K +  RYA   G  LP+S+DW
Sbjct  95   ADLTNEEYRAIYLGTRSDPKRRFAKLKNASPRYAVMPGEVLPESVDW  141



>gb|EYU37647.1| hypothetical protein MIMGU_mgv1a005905mg [Erythranthe guttata]
Length=465

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 91/123 (74%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSIITYDE+H      R++ + MA+YESWLV+HGK+YN +G EK+KRF+IFKDNL +++
Sbjct  25   DMSIITYDEKH-----QRSEGDAMAMYESWLVKHGKAYNAIG-EKEKRFQIFKDNLMFVE  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  DR YK+G+NRFADLTNEEYRS ++  + D   R+   ++  RYA K G  LP+ 
Sbjct  79   EHNS-ADRPYKVGMNRFADLTNEEYRSMFVRGRLDRNARLMNRRASDRYALKAGEKLPEF  137

Query  467  IDW  475
            +DW
Sbjct  138  VDW  140



>gb|KFK31760.1| hypothetical protein AALP_AA6G155800 [Arabis alpina]
Length=468

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 75/131 (57%), Positives = 93/131 (71%), Gaps = 12/131 (9%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGL----SRTDEEVMALYESWLVEHGKSYNG----LGGEKDKRFEIF  262
            DMSII+YDE H         SRTD EV ++YE+WLV+HGK+ N     L GE  +RFEIF
Sbjct  23   DMSIISYDENHHITTTTTVNSRTDAEVASIYEAWLVKHGKNKNKNDLLLVGETKQRFEIF  82

Query  263  KDNLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPK  442
            KDNLRYIDE N+ ++ +YKLGL RFADLTNEEYRS YLGAK    +R+ KT    RY  +
Sbjct  83   KDNLRYIDEHNNNKNLSYKLGLTRFADLTNEEYRSIYLGAK--PTKRVFKTSD--RYEAR  138

Query  443  VGGSLPDSIDW  475
            VG +LP+++DW
Sbjct  139  VGDALPETVDW  149



>ref|XP_006343212.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=366

 Score =   139 bits (349),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 83/105 (79%), Gaps = 2/105 (2%)
 Frame = +2

Query  164  DEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFAD  343
            DEEV  +YE WLVEHGK YNGLG EK KRFEIFKDNLR+I+E N+ +++ Y LGLNRFAD
Sbjct  34   DEEVKGIYEIWLVEHGKIYNGLG-EKGKRFEIFKDNLRFIEEHNNLKNQTYVLGLNRFAD  92

Query  344  LTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDW  475
            LTNEEYR+ +LG ++DARRR+ K+K +  RY  +    +P+S+DW
Sbjct  93   LTNEEYRTMFLGTRSDARRRLVKSKNASHRYVFRASDHVPESVDW  137



>ref|XP_007205396.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
 gb|EMJ06595.1| hypothetical protein PRUPE_ppa007467mg [Prunus persica]
Length=366

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 89/108 (82%), Gaps = 3/108 (3%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE NS +DR YK+GLN 
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNS-QDRPYKVGLNA  85

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDW  475
            FADLTN+EYR+ +LG ++D +RR+ K K S +RYA +VG +LP+S+DW
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKNSSQRYAFRVGEALPESVDW  133



>gb|ACU18172.1| unknown [Glycine max]
Length=355

 Score =   138 bits (348),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T    RY P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNRYVPRVGDTIPKS  136

Query  467  IDW  475
            +DW
Sbjct  137  VDW  139



>emb|CAB16317.1| cysteine proteinase precursor [Nicotiana tabacum]
Length=374

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 4/126 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAK--GLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII Y   H A+   L   +++V   YE WL EHG++YN LG EK+KRFEIFKDNLR+
Sbjct  22   DMSIIDYKNNHYARKWTLQSDEDQVKNRYEMWLAEHGRAYNALG-EKEKRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            I+  N+  +R YK+GLN+FADLTNEEYR+ YLG K+DARRR  K+K+  +RYA +    +
Sbjct  81   IEGHNNSGNRTYKVGLNQFADLTNEEYRTMYLGTKSDARRRFVKSKNPSQRYASRPNELM  140

Query  458  PDSIDW  475
            P S+DW
Sbjct  141  PHSVDW  146



>gb|KHN27075.1| Cysteine proteinase RD21a [Glycine soja]
Length=368

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TD EVM +YE WLV+H K YNGLG EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLG-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFA  90

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DW
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDW  136



>ref|XP_003550041.1| PREDICTED: cysteine proteinase RD21a-like [Glycine max]
Length=366

 Score =   138 bits (348),  Expect = 6e-36, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 79/106 (75%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TD EVM +YE WLV+H K YNGLG EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLG-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNKFA  90

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DW
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDW  136



>ref|XP_006307278.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
 gb|EOA40176.1| hypothetical protein CARUB_v10008893mg, partial [Capsella rubella]
Length=509

 Score =   140 bits (352),  Expect = 7e-36, Method: Composition-based stats.
 Identities = 74/126 (59%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE H       R+D EV ++YE+WLVEHGK  + N L GEKD RFEIFKDNLR
Sbjct  70   DMSIISYDETHGVSSTGGRSDAEVRSIYEAWLVEHGKVENKNTLLGEKD-RFEIFKDNLR  128

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            +ID+ N++ +  YKLGL RFADLTN+EYRS YLGAKT  +   ++ +S  RY   VG  L
Sbjct  129  FIDDHNAK-NLGYKLGLTRFADLTNDEYRSMYLGAKTHKK---SERRSSLRYKASVGDEL  184

Query  458  PDSIDW  475
            P+SIDW
Sbjct  185  PESIDW  190



>ref|XP_008350332.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Malus domestica]
Length=462

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            D+SII Y+++H     S RT+ E  ALYESWL++HGK+YN LG EK++RFEIFKDNLR+I
Sbjct  20   DVSIIDYNDKHGMTTPSDRTEPEAKALYESWLIKHGKNYNALG-EKERRFEIFKDNLRFI  78

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N  + R YK+GLNRFADLTNEEYRS YL AK D   R++ ++   RY  + G  LP+
Sbjct  79   DEHN-LQSRTYKVGLNRFADLTNEEYRSVYLVAKVDRGSRLSGSRKSDRYPFRAGNELPE  137

Query  464  SIDW  475
            S+ W
Sbjct  138  SVHW  141



>ref|XP_009358749.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
 ref|XP_009348984.1| PREDICTED: cysteine proteinase RD21a-like [Pyrus x bretschneideri]
Length=456

 Score =   139 bits (350),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 71/124 (57%), Positives = 91/124 (73%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            D+SII Y+++H     S  T+ E  ALYESWL++HGK+YN LG EK++RFEIFKDNLR+I
Sbjct  14   DLSIIDYNDKHGMTAPSDPTETEAKALYESWLIKHGKNYNALG-EKERRFEIFKDNLRFI  72

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N  + R  K+GLNRFADLTNEEYRS YLGAK D   R++ ++   RY  + G  LP+
Sbjct  73   DEHNI-QSRTSKVGLNRFADLTNEEYRSVYLGAKVDRGSRLSGSRKSDRYIFRAGDELPE  131

Query  464  SIDW  475
            S+DW
Sbjct  132  SVDW  135



>emb|CDY22370.1| BnaA06g36920D [Brassica napus]
Length=460

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK   ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKP--KKRVLKTSD--RYQPRVGDA  136

Query  455  LPDSIDW  475
            +PDS+DW
Sbjct  137  IPDSVDW  143



>ref|XP_009101816.1| PREDICTED: cysteine proteinase RD21a [Brassica rapa]
Length=460

 Score =   139 bits (350),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 75/127 (59%), Positives = 96/127 (76%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGL-GGEKDKRFEIFKDNL  274
            DMSII+YDE+H     + R+D EV  +YE+W+ +HGK    NGL G EKD+RFEIFKDNL
Sbjct  22   DMSIISYDEKHHITADNERSDAEVARIYEAWMEKHGKKAQSNGLVGEEKDQRFEIFKDNL  81

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R+IDE N++ + +YKLGL RFADLTNEEYRS YLGAK   ++R+ KT    RY P+VG +
Sbjct  82   RFIDEHNNK-NLSYKLGLTRFADLTNEEYRSIYLGAKP--KKRVLKTSD--RYQPRVGDA  136

Query  455  LPDSIDW  475
            +PDS+DW
Sbjct  137  IPDSVDW  143



>ref|XP_010028205.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54899.1| hypothetical protein EUGRSUZ_I00879 [Eucalyptus grandis]
Length=364

 Score =   137 bits (346),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 86/107 (80%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTDEEVM +YE WL +HGK+YNGLG E+++RFEIF+DNLR++DE N+  +R+Y LG+NRF
Sbjct  25   RTDEEVMGMYELWLAKHGKAYNGLG-ERERRFEIFRDNLRFVDEHNAL-NRSYTLGMNRF  82

Query  338  ADLTNEEYRSTYLGAKTDARRRIAK-TKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYR+ YLG ++D  RR+AK  ++  RYAP+    LP ++DW
Sbjct  83   ADLTNEEYRAVYLGTRSDPVRRVAKAARASGRYAPRPDDMLPAAVDW  129



>ref|XP_011000142.1| PREDICTED: cysteine proteinase RD21a-like [Populus euphratica]
Length=479

 Score =   139 bits (350),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 66/123 (54%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQIPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  + +YKLGLN FADL+N+EYRS YLG + D +RR+       RY  K G  LP++
Sbjct  82   EHNSVGNPSYKLGLNMFADLSNDEYRSVYLGTRMDRKRRLLSGPKSERYLFKEGDDLPET  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>ref|XP_008454976.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=480

 Score =   139 bits (349),  Expect = 1e-35, Method: Composition-based stats.
 Identities = 67/106 (63%), Positives = 80/106 (75%), Gaps = 3/106 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTDEEV ALYESWLV HGK+YN LG EK++RFEIFKDNL +IDE N RE R YK+GL RF
Sbjct  54   RTDEEVAALYESWLVHHGKAYNALG-EKERRFEIFKDNLMFIDEHN-RESRTYKVGLTRF  111

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYR+ +LG +   +  ++  KS  RYA  +G  LPD +DW
Sbjct  112  ADLTNEEYRARFLGGRFSRKPSLSAAKSG-RYAAALGDDLPDDVDW  156



>gb|ACU13684.1| unknown [Glycine max]
Length=229

 Score =   134 bits (337),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTKSD-RRYAPKVGGSLPDSIDW  475
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DW
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDW  136



>gb|ABQ10192.1| actinidin Act2a [Actinidia deliciosa]
Length=378

 Score =   137 bits (345),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/108 (63%), Positives = 83/108 (77%), Gaps = 6/108 (6%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  331
            + RT+++VMA+YESWLVEHGKSYN L  EK+ RFEIFK+NLR ID+ N+  +R+Y LGLN
Sbjct  31   VQRTNDQVMAMYESWLVEHGKSYNSLD-EKEMRFEIFKENLRIIDDHNADANRSYSLGLN  89

Query  332  RFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            RFADLT+EEYRSTYLG K     R  KT    +Y PKVG +LPD +DW
Sbjct  90   RFADLTDEEYRSTYLGLK-----RGPKTDVSNQYMPKVGDALPDYVDW  132



>ref|XP_002298740.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
 gb|EEE83545.2| hypothetical protein POPTR_0001s30950g [Populus trichocarpa]
Length=479

 Score =   138 bits (348),  Expect = 2e-35, Method: Composition-based stats.
 Identities = 65/123 (53%), Positives = 88/123 (72%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+ +H  +   RT+ E   +YE WLV+HG++YN LG EK++RFEIFKDNL++ID
Sbjct  24   DMSIIDYNIKH-GQVPERTEAETRRIYEMWLVKHGRAYNALG-EKERRFEIFKDNLKFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E NS  + +YKLGLN+FADL+N+EYRS YLG + D + R+       RY  K G  LP++
Sbjct  82   EHNSVGNPSYKLGLNKFADLSNDEYRSVYLGTRMDGKGRLLGGPKSERYLFKEGDDLPET  141

Query  467  IDW  475
            +DW
Sbjct  142  VDW  144



>gb|KHG18408.1| Cysteinease RD21a -like protein [Gossypium arboreum]
 gb|KHG29615.1| Cysteinease RD21a -like protein [Gossypium arboreum]
Length=367

 Score =   137 bits (344),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/107 (58%), Positives = 89/107 (83%), Gaps = 3/107 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R+D+EVM+LY++WL++HGK YNG+G E++ RF+IFKDNL++ID+ NS+ +  YKLGLN+F
Sbjct  30   RSDDEVMSLYQAWLIKHGKQYNGIG-EEENRFDIFKDNLKFIDQHNSK-NTTYKLGLNKF  87

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            ADLTN+EYRS +LG K+D +RR+ K+K+  +RYA + G  LP+S DW
Sbjct  88   ADLTNQEYRSMFLGTKSDPKRRVMKSKNPSQRYASRAGDRLPESFDW  134



>gb|KDP47124.1| hypothetical protein JCGZ_22120 [Jatropha curcas]
Length=242

 Score =   134 bits (337),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 89/124 (72%), Gaps = 3/124 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H      RTD  V  +YE WLV+HGK+YN L GEK+KRF+IFKDNL++ID
Sbjct  25   DMSIIDYNIRHGQNPEERTDANVRRIYEMWLVKHGKAYNAL-GEKEKRFQIFKDNLKFID  83

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI-AKTKSDRRYAPKVGGSLPD  463
            E NS  +R+YKLGLNRFADL+NEEYR+ +LG + + + R+ A   ++ RY  K G  LP+
Sbjct  84   EHNSV-NRSYKLGLNRFADLSNEEYRAMFLGTRMERKNRLGASMGTESRYLYKEGDDLPE  142

Query  464  SIDW  475
             +DW
Sbjct  143  KVDW  146



>ref|XP_009390984.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=469

 Score =   138 bits (347),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 69/126 (55%), Positives = 89/126 (71%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDEEH  KGL R+ EE+  +YE WL++HG++YN L GE ++RFEIFKDNLR+ID
Sbjct  23   DMSIISYDEEHGVKGLERSKEEMRRMYEGWLIKHGRTYNAL-GEMERRFEIFKDNLRFID  81

Query  287  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D     Y+LGLNRFADLTNEEYR+ ++G +     R  +  SD RY    G  L
Sbjct  82   AHNAEADAGLHRYRLGLNRFADLTNEEYRAGFIGTRPRGAARRNRVPSD-RYRLGDGEEL  140

Query  458  PDSIDW  475
            P+S+DW
Sbjct  141  PESVDW  146



>gb|KFK44641.1| hypothetical protein AALP_AA1G285100 [Arabis alpina]
Length=460

 Score =   137 bits (346),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 74/125 (59%), Positives = 91/125 (73%), Gaps = 8/125 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE H      RTD EV  +YE+WLV+HGK  S N L  EKD RFEIFKDNLR+
Sbjct  23   DMSIISYDETHGLAVGGRTDAEVAKIYEAWLVKHGKKMSENSLV-EKDPRFEIFKDNLRF  81

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE NS+ + +YKLGL RFADLTNEEYRS YLGAK   + +    ++ +RY  +VG S+P
Sbjct  82   IDEHNSK-NLSYKLGLTRFADLTNEEYRSKYLGAKMMKKEK----RTSQRYEARVGDSIP  136

Query  461  DSIDW  475
            +S+DW
Sbjct  137  ESVDW  141



>gb|KHN22490.1| Cysteine proteinase RD21a [Glycine soja]
Length=355

 Score =   136 bits (343),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 87/123 (71%), Gaps = 2/123 (2%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII++D  H  +   RTD+EVM+++E WLV+H K YN LG EK+KRF+IFK+NLR+ID
Sbjct  19   DMSIISHDNAHADRATRRTDDEVMSMFEEWLVKHDKVYNALG-EKEKRFQIFKNNLRFID  77

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E+NS  +R YKLGLN FADLTN EYR+ YL    D  R    T     Y P+VG ++P S
Sbjct  78   ERNSL-NRTYKLGLNVFADLTNAEYRAMYLRTWDDGPRLDLDTPPRNHYVPRVGDTIPKS  136

Query  467  IDW  475
            +DW
Sbjct  137  VDW  139



>gb|AAL60580.1|AF454958_1 senescence-associated cysteine protease [Brassica oleracea]
Length=485

 Score =   138 bits (347),  Expect = 3e-35, Method: Composition-based stats.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TKS  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKSSLRYEVRVGDAIPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>ref|XP_010691718.1| PREDICTED: cysteine proteinase RD21a-like [Beta vulgaris subsp. 
vulgaris]
Length=471

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 70/125 (56%), Positives = 93/125 (74%), Gaps = 4/125 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YD++H    +S  R+++EVM LYESWLV+H K+YN LG EK+KRF+IFKDNL++
Sbjct  30   DMSIISYDQDHHTNIVSSSRSEDEVMNLYESWLVKHRKNYNALG-EKEKRFQIFKDNLKF  88

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            ID+ NS + +++KLGLN+FADLTN+E+RS Y G K        K KSD RY  + G  LP
Sbjct  89   IDQHNSDDQQSFKLGLNKFADLTNDEFRSKYFGRKKKDSLLKMKVKSD-RYLFREGDQLP  147

Query  461  DSIDW  475
             S+DW
Sbjct  148  KSVDW  152



>ref|XP_009398671.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 64/126 (51%), Positives = 88/126 (70%), Gaps = 4/126 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI++Y+EEH  +GL R+++E+  +YE WL  HG++YN LG EK+ RFE+FKDNL ++D
Sbjct  26   DMSIVSYNEEHGVRGLERSEDEMRRIYEGWLARHGRAYNALG-EKEARFEVFKDNLHFVD  84

Query  287  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D     ++LGLNRFADLTNEE+R+ YLGAK     R ++  +DR      G  L
Sbjct  85   GHNAAADAGRQRFRLGLNRFADLTNEEFRALYLGAKGRGVARRSRVAADRYRYEGAGDVL  144

Query  458  PDSIDW  475
            PDS+DW
Sbjct  145  PDSVDW  150



>ref|XP_006393620.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
 gb|ESQ30906.1| hypothetical protein EUTSA_v10011464mg [Eutrema salsugineum]
Length=459

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 69/123 (56%), Positives = 90/123 (73%), Gaps = 5/123 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE H      R+D EV  LYE+WLV+HGK  N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDESHHTVSGGRSDAEVKRLYETWLVKHGKVQNSL-VEKDRRFEIFKDNLRFID  81

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            + N++ + +Y+LGL +FADLTN+EYRS YLGAK    R   + ++  RY  +VG +LP+S
Sbjct  82   DHNAK-NLSYRLGLTKFADLTNDEYRSIYLGAKMQKNR---ERRASTRYEARVGDALPES  137

Query  467  IDW  475
            +DW
Sbjct  138  VDW  140



>ref|XP_008344336.1| PREDICTED: probable cysteine proteinase At3g19400 [Malus domestica]
Length=150

 Score =   129 bits (325),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 90/120 (75%), Gaps = 4/120 (3%)
 Frame = +2

Query  119  ITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
             T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E ++RFEIFKDNL++IDE N+
Sbjct  17   FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EDERRFEIFKDNLKFIDEHNA  74

Query  299  REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR-RYAPKVGGSLPDSIDW  475
              DR YK+GLN FADLTN+EYR+ +LG ++D +RR+ K K+   RYA + G +LP+S+DW
Sbjct  75   L-DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRVMKAKNPSLRYAFRAGETLPESVDW  133



>tpg|DAA35450.1| TPA: cysteine protease 1 [Zea mays]
Length=522

 Score =   136 bits (343),  Expect = 1e-34, Method: Composition-based stats.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  84   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  142

Query  290  QNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  143  HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  202

Query  467  IDW  475
            +DW
Sbjct  203  VDW  205



>ref|XP_006403303.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
 gb|ESQ44756.1| hypothetical protein EUTSA_v10003205mg [Eutrema salsugineum]
Length=457

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 72/125 (58%), Positives = 94/125 (75%), Gaps = 8/125 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK-SYNGLGGEKDKRFEIFKDNLRY  280
            DMSII+YDE+H    ++ R++ EV  +YE W+ +HGK + NGL GE D RFEIFKDNLR+
Sbjct  22   DMSIISYDEKHHISAVNGRSEAEVAKIYEEWMAKHGKKTQNGLLGE-DHRFEIFKDNLRF  80

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            IDE N++ + +YKLGL RFADLTN+EYRS YLGAK   ++ + KT    RY P+VG +LP
Sbjct  81   IDEHNTK-NLSYKLGLTRFADLTNDEYRSIYLGAK--PKKSVLKTSD--RYLPRVGDALP  135

Query  461  DSIDW  475
            DS+DW
Sbjct  136  DSVDW  140



>gb|ABQ10191.1| actinidin Act1c [Actinidia eriantha]
Length=368

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RT++EV A+YESWL++HGKSYN LG E+++RFEIFK+ LR+IDE N+   R+YK+GLN+F
Sbjct  29   RTNDEVKAMYESWLIKHGKSYNSLG-ERERRFEIFKETLRFIDEHNADTSRSYKVGLNQF  87

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEE+RSTYLG      R   KTK   RY P+VG  LPD +DW
Sbjct  88   ADLTNEEFRSTYLGFT----RGSNKTKVSNRYEPRVGQVLPDYVDW  129



>ref|XP_004234718.1| PREDICTED: cysteine proteinase COT44-like [Solanum lycopersicum]
Length=379

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 82/106 (77%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TDEEV  +YE WL EHGK YNGLG E+ KRFEIFKDNLR+I+E N+ +++ Y LGLNRFA
Sbjct  34   TDEEVKRIYEIWLAEHGKIYNGLG-EQGKRFEIFKDNLRFIEEHNNSKNQTYVLGLNRFA  92

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDW  475
            DLTNEEYR+ +LG K+DARRR+ ++K +   Y  +   S+P S+DW
Sbjct  93   DLTNEEYRTIFLGTKSDARRRLVESKNASHHYDFRASDSVPKSVDW  138



>gb|KHN30007.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   134 bits (337),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DW
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDQLPVHVDW  136



>gb|AEZ65082.1| cysteine protease [Carica papaya]
Length=471

 Score =   135 bits (339),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 68/125 (54%), Positives = 89/125 (71%), Gaps = 5/125 (4%)
 Frame = +2

Query  110  MSIITYD-EEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            MSII YD    P +   RT+  +M +YE WLV+HGK+YN +G EK++RFEIFKDNLR++D
Sbjct  26   MSIIDYDLPADPLQSTERTEAHMMKMYEHWLVKHGKNYNAIG-EKERRFEIFKDNLRFVD  84

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGG--SLP  460
            EQNS   R YKLGL +FADLTNEEYR+ YLGAK + + ++ +T+  +RY  K G    LP
Sbjct  85   EQNSVPGRTYKLGLTKFADLTNEEYRAMYLGAKMEKKEKL-RTERSQRYLHKAGNDDDLP  143

Query  461  DSIDW  475
              +DW
Sbjct  144  SHVDW  148



>ref|XP_008238897.1| PREDICTED: cysteine proteinase COT44 [Prunus mume]
Length=366

 Score =   134 bits (336),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 62/108 (57%), Positives = 88/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            SR++ EV  +Y+ WLV+H K+YNG+G E+D+RFEIFKDNLR+IDE N+ +DR YK+GLN 
Sbjct  28   SRSEAEVKQIYQEWLVKHQKTYNGIG-EEDRRFEIFKDNLRFIDEHNA-QDRPYKVGLNA  85

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            FADLTN+EYR+ +LG ++D +RR+ K K+  +RYA + G +LP+S+DW
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRLMKAKNPSQRYAFRAGEALPESVDW  133



>ref|XP_002894032.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH70291.1| F2G19.31/F2G19.31 [Arabidopsis lyrata subsp. lyrata]
Length=455

 Score =   134 bits (338),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 94/125 (75%), Gaps = 6/125 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLG-GEKDKRFEIFKDNLRY  280
            DMSII+YDE+H       R+D EVM++YE+WLV+HGK+ N     EKD+RFEIFKDNLR+
Sbjct  16   DMSIISYDEKHGVSTTGGRSDAEVMSIYEAWLVKHGKAQNQNSLVEKDRRFEIFKDNLRF  75

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
            ID+ N +++ +Y+LGL RFADLTN+EYRS YLGAK + +    + ++ +RY  +VG  LP
Sbjct  76   IDDHN-KKNLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSQRYEARVGDELP  131

Query  461  DSIDW  475
            +SIDW
Sbjct  132  ESIDW  136



>ref|NP_001150196.1| cysteine protease 1 precursor [Zea mays]
 gb|ACF84983.1| unknown [Zea mays]
 gb|ACF86484.1| unknown [Zea mays]
 gb|ACG38208.1| cysteine protease 1 precursor [Zea mays]
 gb|AFW59827.1| cysteine protease 1 [Zea mays]
Length=470

 Score =   134 bits (338),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 66/126 (52%), Positives = 88/126 (70%), Gaps = 5/126 (4%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLG---GEKDKRFEIFKDNLRY  280
            MSIITY+EEH A+GL RT+ EV A+Y+ WL EHG++YN LG   GE+D+RF +F DNLR+
Sbjct  32   MSIITYNEEHGARGLERTEPEVRAMYDLWLAEHGRAYNALGEGEGERDRRFLVFWDNLRF  91

Query  281  IDEQNSRED-RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            +D  N R   R ++LG+N+FADLTN+E+R+ YLGA   A RR A      R+       L
Sbjct  92   VDAHNERAGARGFRLGMNQFADLTNDEFRAAYLGAMVPAARRGAVVGERYRH-DGAAEEL  150

Query  458  PDSIDW  475
            P+S+DW
Sbjct  151  PESVDW  156



>ref|XP_003547817.1| PREDICTED: cysteine proteinase RD21a [Glycine max]
Length=366

 Score =   133 bits (335),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 78/106 (74%), Gaps = 2/106 (2%)
 Frame = +2

Query  161  TDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFA  340
            TD EVM +YE WLV+H K YNGL  EKDKRF++FKDNL +I E N+ ++  YKLGLN+FA
Sbjct  32   TDNEVMTMYEEWLVKHQKVYNGLR-EKDKRFQVFKDNLGFIQEHNNNQNNTYKLGLNQFA  90

Query  341  DLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            D+TNEEYR  Y G K+DA+RR+ KTKS   RYA   G  LP  +DW
Sbjct  91   DMTNEEYRVMYFGTKSDAKRRLMKTKSTGHRYAYSAGDRLPVHVDW  136



>ref|XP_008357550.1| PREDICTED: probable cysteine proteinase At3g19400, partial [Malus 
domestica]
Length=148

 Score =   128 bits (321),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 89/120 (74%), Gaps = 4/120 (3%)
 Frame = +2

Query  119  ITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNS  298
             T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E ++RFEIFKDNL++IDE N+
Sbjct  17   FTLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EDERRFEIFKDNLKFIDEHNA  74

Query  299  REDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDR-RYAPKVGGSLPDSIDW  475
              DR YK+GLN FADLTN+EYR+ +LG ++D +RR  K K+   RYA + G +LP+S+DW
Sbjct  75   L-DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRXMKAKNPSLRYAFRAGETLPESVDW  133



>gb|ABQ10196.1| actinidin Act3a [Actinidia eriantha]
Length=380

 Score =   133 bits (335),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 65/106 (61%), Positives = 83/106 (78%), Gaps = 6/106 (6%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RT++EVMALYESWLV++GKSYN LG E++ R EIFK+NLR+IDE N+  +R+Y +GLN+F
Sbjct  33   RTNDEVMALYESWLVKYGKSYNSLG-EREMRIEIFKENLRFIDEHNADPNRSYTVGLNQF  91

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLT+EEYRSTYLG K+       K+K   RY P+VG  LPD +DW
Sbjct  92   ADLTDEEYRSTYLGFKSS-----LKSKVSNRYMPQVGEVLPDYVDW  132



>ref|XP_006422960.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
 gb|ESR36200.1| hypothetical protein CICLE_v10028338mg [Citrus clementina]
Length=479

 Score =   134 bits (337),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/127 (50%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG EK++RFEIFKDNL++++
Sbjct  27   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EKERRFEIFKDNLKFVN  85

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  454
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  86   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  144

Query  455  LPDSIDW  475
            LP+S+DW
Sbjct  145  LPESVDW  151



>ref|XP_008452589.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Cucumis 
melo]
Length=495

 Score =   134 bits (337),  Expect = 6e-34, Method: Composition-based stats.
 Identities = 63/106 (59%), Positives = 77/106 (73%), Gaps = 3/106 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTDEEVMALY+ W   HGK +N LG E + RF IFKDNL+YIDE N+ ++  Y+LGLN F
Sbjct  68   RTDEEVMALYDQWRANHGKLHNNLGAEPENRFHIFKDNLKYIDEINA-QNLPYRLGLNVF  126

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYRS YLG +  A  R  + ++  RY P++G  LPDSIDW
Sbjct  127  ADLTNEEYRSRYLGGRFAAGSR--RNRTSNRYLPRLGDELPDSIDW  170



>gb|ABQ10195.1| actinidin Act2d [Actinidia eriantha]
Length=381

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 83/108 (77%), Gaps = 6/108 (6%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  331
            + RT+++VMA+YESWLVE GKSYN L  EK+ RFEIFK+NLR ID+ N+  +R+Y LGLN
Sbjct  33   VQRTNDQVMAMYESWLVEQGKSYNSLD-EKEMRFEIFKENLRIIDDHNADANRSYSLGLN  91

Query  332  RFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            RFADLT+EEYRSTYLG K+  + +++      RY PKVG  LP+ +DW
Sbjct  92   RFADLTDEEYRSTYLGFKSGPKAKVSN-----RYVPKVGVVLPNYVDW  134



>ref|XP_004960236.1| PREDICTED: oryzain beta chain-like isoform X1 [Setaria italica]
Length=489

 Score =   134 bits (336),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A+Y+ WL EHG++YN L  E D+RF +F DNLR++D
Sbjct  27   DMSIISYNEEHGARGLERTEAEARAMYDLWLAEHGRAYNAL-DEHDRRFRVFWDNLRFVD  85

Query  287  EQNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+R  D  Y+LG+N+FADLTN+E+R+ YLGA+  AR       +  RY      +LP+
Sbjct  86   AHNARAGDHGYRLGMNQFADLTNDEFRAAYLGARLPARGD--DRAAGERYRHDGVEALPE  143

Query  464  SIDW  475
            ++DW
Sbjct  144  NVDW  147



>ref|XP_011008779.1| PREDICTED: cysteine proteinase COT44 [Populus euphratica]
Length=368

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 68/126 (54%), Positives = 96/126 (76%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS--RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRY  280
            DMSI+T ++       S  R+D+EVM++Y+ WL +HGK++N LG E+ +RFEIFK+NLR+
Sbjct  20   DMSILTSNDNQLNHDRSSWRSDDEVMSMYKWWLAKHGKTHNRLG-EEAERFEIFKNNLRF  78

Query  281  IDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSL  457
            IDE NS ++  YK+GL +FADLTNEEYR+ +LG ++DA+RR+ K+KS   RYA K G  L
Sbjct  79   IDEHNS-QNHTYKVGLTKFADLTNEEYRAMFLGTRSDAKRRLMKSKSPSERYAFKPGDKL  137

Query  458  PDSIDW  475
            P+S+DW
Sbjct  138  PESVDW  143



>dbj|BAG16371.1| cysteine protease [Brassica oleracea var. italica]
Length=441

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TKS  RY  +VG ++P+S
Sbjct  75   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKSSLRYEVRVGDAIPES  129

Query  467  IDW  475
            +DW
Sbjct  130  VDW  132



>gb|ABQ10193.1| actinidin Act2b [Actinidia eriantha]
Length=378

 Score =   132 bits (332),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 66/108 (61%), Positives = 80/108 (74%), Gaps = 6/108 (6%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  331
            + RT+++VMA+YESWLVE GKSYN L  EK+ RFEIFK+NLR ID+ N+  +R+Y LGLN
Sbjct  31   VQRTNDQVMAMYESWLVEQGKSYNSLD-EKEMRFEIFKENLRIIDDHNADANRSYSLGLN  89

Query  332  RFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            RFADLT+EEYRSTYLG K        KT     Y PKVG +LPD +DW
Sbjct  90   RFADLTDEEYRSTYLGLKMG-----PKTDVSNEYMPKVGEALPDYVDW  132



>ref|XP_004231872.1| PREDICTED: zingipain-2-like [Solanum lycopersicum]
Length=363

 Score =   132 bits (331),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 63/99 (64%), Positives = 79/99 (80%), Gaps = 2/99 (2%)
 Frame = +2

Query  182  LYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRFADLTNEEY  361
            LYE WL EHGK YN LG EK+KRFEIFKDNLR+I+E N+ E+R +K+GLN+FADLTN+EY
Sbjct  35   LYEKWLAEHGKIYNALG-EKEKRFEIFKDNLRFIEEYNASENRTFKVGLNQFADLTNDEY  93

Query  362  RSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPDSIDW  475
            R+ YLG K+DARRR+ K+K + +RYA      LP S+DW
Sbjct  94   RAVYLGTKSDARRRLVKSKNTSQRYASPPNELLPHSVDW  132



>emb|CDY17093.1| BnaC06g00260D [Brassica napus]
Length=457

 Score =   133 bits (334),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 70/123 (57%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE WLV+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDAEVSRLYEEWLVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TKS  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKSSLRYEVRVGDAIPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>ref|XP_008668054.1| PREDICTED: cysteine protease 1 isoform X1 [Zea mays]
Length=457

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  85

Query  290  QNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  86   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  145

Query  467  IDW  475
            +DW
Sbjct  146  VDW  148



>dbj|BAD16614.1| cysteine proteinase [Dianthus caryophyllus]
Length=459

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 71/125 (57%), Positives = 94/125 (75%), Gaps = 12/125 (10%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            D+SII        +  +R D+E+ +LYE+WLV+HGK+YNGLG EK  RF IFKDNLR++D
Sbjct  24   DLSIID-------RAFNRPDDEIASLYETWLVKHGKNYNGLG-EKQLRFNIFKDNLRFVD  75

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGA--KTDARRRIAKTKSDRRYAPKVGGSLP  460
            E+NS E+ ++KLGLNRFADLTNEEYRS YLG   ++ A  R  ++KSD RYA + G +LP
Sbjct  76   ERNS-ENLSFKLGLNRFADLTNEEYRSVYLGTRPRSVAVARSGRSKSD-RYAFRAGDTLP  133

Query  461  DSIDW  475
            +S+DW
Sbjct  134  ESVDW  138



>gb|ACR34204.1| unknown [Zea mays]
Length=465

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  27   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  85

Query  290  QNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  86   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPASRRRGTAVGERYRHGGGAEELPES  145

Query  467  IDW  475
            +DW
Sbjct  146  VDW  148



>ref|XP_010107858.1| Cysteine proteinase RD21a [Morus notabilis]
 gb|EXC17258.1| Cysteine proteinase RD21a [Morus notabilis]
Length=476

 Score =   133 bits (334),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 67/127 (53%), Positives = 89/127 (70%), Gaps = 9/127 (7%)
 Frame = +2

Query  107  DMSIITYDEEH----PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNL  274
            DMSII YD +H    P +   R++ E+ A+YESWLV H K+YN L  EK++RFEIFKDNL
Sbjct  30   DMSIIDYDAKHGIVVPTE---RSETEMRAMYESWLVIHAKAYNALR-EKERRFEIFKDNL  85

Query  275  RYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGS  454
            R++D  N+  +R +KLGLNRFADLTN+EYR+ +LG K D    +  ++   RYA + G  
Sbjct  86   RFVDAHNA-ANRTFKLGLNRFADLTNDEYRAGFLGVKIDRIGTLFGSRKSDRYAFRAGDE  144

Query  455  LPDSIDW  475
            LP+SIDW
Sbjct  145  LPESIDW  151



>ref|NP_001150266.1| cysteine protease 1 precursor [Zea mays]
 gb|ACG38442.1| cysteine protease 1 precursor [Zea mays]
Length=462

 Score =   132 bits (333),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/123 (50%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            MSII+Y+EEH A+GL RT+ E   LYE WL EHG++YN L GE+D+RF +F DNLR++D 
Sbjct  24   MSIISYNEEHAARGLERTEPEARTLYELWLAEHGRAYNAL-GERDRRFRVFWDNLRFVDA  82

Query  290  QNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
             N R  +  ++LG+N+FADLTN+E+R+ YLGA+  A RR      +R         LP+S
Sbjct  83   HNERAAEHGFRLGMNQFADLTNDEFRAAYLGARIPAARRRGTAVGERYRHGGGAEELPES  142

Query  467  IDW  475
            +DW
Sbjct  143  VDW  145



>gb|ABQ10197.1| actinidin Act4a [Actinidia eriantha]
Length=385

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 83/106 (78%), Gaps = 5/106 (5%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RT++EV+A++ESWLVE+GKSYN LG EK++RFEIFKDNLR++DE N+  +R+YK+GLN+F
Sbjct  39   RTNDEVIAMFESWLVEYGKSYNALG-EKERRFEIFKDNLRFVDEHNADVNRSYKVGLNQF  97

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            +DLT+ EY S YLG K + R     T    RY P+VG  LPDS+DW
Sbjct  98   SDLTDAEYSSIYLGTKFNIRM----TNVSDRYEPRVGDQLPDSVDW  139



>gb|KDO36580.1| hypothetical protein CISIN_1g037262mg, partial [Citrus sinensis]
Length=107

 Score =   125 bits (313),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 76/86 (88%), Gaps = 3/86 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSI++YD+ H +K  S RTD+EVMA++E+WLV+HGK+YN L GEK+KRFEIFK+NLR+I
Sbjct  24   DMSIVSYDKTHESKSSSWRTDDEVMAMFEAWLVKHGKAYNAL-GEKEKRFEIFKENLRFI  82

Query  284  DEQNSREDRAYKLGLNRFADLTNEEY  361
            DE NS E+R YK+GLNRFADLTNEEY
Sbjct  83   DEHNS-ENRTYKVGLNRFADLTNEEY  107



>ref|XP_004304028.1| PREDICTED: cysteine proteinase RD21a-like [Fragaria vesca subsp. 
vesca]
Length=476

 Score =   132 bits (333),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 69/124 (56%), Positives = 89/124 (72%), Gaps = 4/124 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGL-SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII YD +H    +  RT+ EV A+YESWLV+H K+YN LG E ++RFEIF DNLR++
Sbjct  32   DMSIIDYDNKHHMGVVPERTEAEVKAMYESWLVKHRKAYNALG-EMERRFEIFMDNLRFV  90

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            DE N + +R+YK+GLNRFAD+TN EYRS +LG K D   R+   +S  RY  +VG  LP 
Sbjct  91   DEHN-KVNRSYKVGLNRFADMTNLEYRSKFLGMKKDRSARLLGGESG-RYMYQVGDKLPA  148

Query  464  SIDW  475
            S+DW
Sbjct  149  SVDW  152



>gb|KEH31479.1| papain family cysteine protease [Medicago truncatula]
Length=359

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 81/108 (75%), Gaps = 4/108 (4%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R++EEVM +YE WLV+H K YNGLG EKD+RFEIFKDNL +IDE N+ ++  YK+GLN+F
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGLG-EKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTK--SDRRYAPKVGGSLPDSIDW  475
            AD+TNEEYR+ YLG K DA+R + K K  +  RYA   G  LP  +DW
Sbjct  84   ADMTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDW  131



>ref|XP_006339859.1| PREDICTED: cysteine proteinase RD21a-like [Solanum tuberosum]
Length=361

 Score =   131 bits (329),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 68/124 (55%), Positives = 88/124 (71%), Gaps = 14/124 (11%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y  +   +G+         +YE WL EHGK YN LG E +KRFEIFKDNLR+I+
Sbjct  22   DMSIIDYKNK---EGI---------IYEKWLAEHGKVYNALG-ENEKRFEIFKDNLRFIE  68

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTK-SDRRYAPKVGGSLPD  463
            E N+ E+R YK+GLN+FADLTN EYR+ YLG ++DARRR+ K+K + +RYA +    LP 
Sbjct  69   EYNNSENRTYKVGLNQFADLTNVEYRAMYLGTRSDARRRLVKSKNTSQRYASRPNELLPQ  128

Query  464  SIDW  475
            S+DW
Sbjct  129  SVDW  132



>dbj|BAD95392.1| cysteine proteinase RD21A [Arabidopsis thaliana]
Length=433

 Score =   132 bits (331),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 8/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  458  PDSIDW  475
            P+SIDW
Sbjct  138  PESIDW  143



>gb|AEV41024.1| putative oryzain beta chain precursor [Oryza minuta]
Length=493

 Score =   132 bits (332),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 63/125 (50%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE+++RF +F DNL+++D
Sbjct  23   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GERERRFRVFWDNLKFVD  81

Query  287  EQNSREDR--AYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
              N+R D    ++LG+NRFADLTN+E+R+T+LGAK   R R A      RY       LP
Sbjct  82   AHNARADEHGGFRLGMNRFADLTNDEFRATFLGAKFVERSRAA----GERYRHDGVEELP  137

Query  461  DSIDW  475
            +S+DW
Sbjct  138  ESVDW  142



>ref|NP_564497.1| cysteine proteinase RD21a [Arabidopsis thaliana]
 sp|P43297.1|RD21A_ARATH RecName: Full=Cysteine proteinase RD21a; Short=RD21; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAG50628.1|AC083835_13 cysteine protease, putative [Arabidopsis thaliana]
 dbj|BAA02374.1| thiol protease [Arabidopsis thaliana]
 gb|AAL59952.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AAM91715.1| putative cysteine proteinase RD21A [Arabidopsis thaliana]
 gb|AEE32135.1| cysteine proteinase RD21a [Arabidopsis thaliana]
Length=462

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 8/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  458  PDSIDW  475
            P+SIDW
Sbjct  138  PESIDW  143



>gb|AAK62661.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
 gb|AAL87383.1| F2G19.31/F2G19.31 [Arabidopsis thaliana]
Length=462

 Score =   132 bits (331),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 93/126 (74%), Gaps = 8/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H       R++ EVM++YE+WLV+HGK  S N L  EKD+RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSTTGGRSEAEVMSIYEAWLVKHGKAQSQNSLV-EKDRRFEIFKDNLR  81

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            ++DE N + + +Y+LGL RFADLTN+EYRS YLGAK + +    + ++  RY  +VG  L
Sbjct  82   FVDEHNEK-NLSYRLGLTRFADLTNDEYRSKYLGAKMEKK---GERRTSLRYEARVGDEL  137

Query  458  PDSIDW  475
            P+SIDW
Sbjct  138  PESIDW  143



>ref|XP_009367558.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   130 bits (328),  Expect = 5e-33, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 91/119 (76%), Gaps = 4/119 (3%)
 Frame = +2

Query  122  TYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E+++RFEIFKDNL++IDE N+ 
Sbjct  18   TLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EEERRFEIFKDNLKFIDEHNAL  75

Query  302  EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
             DR YK+GLN FADLTN+EYR+ +LG ++D +RR+ K K+   RYA + G +LP+S+DW
Sbjct  76   -DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRVMKAKNPSLRYAFRAGETLPESVDW  133



>dbj|BAH20463.1| cysteine protease [Spinacia oleracea]
Length=473

 Score =   131 bits (330),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 92/132 (70%), Gaps = 13/132 (10%)
 Frame = +2

Query  107  DMSIITYDEEH---PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YD  H   P+   SR+D+EVM +YESWLV+H K+YN LG EK+KRF IFKDNL 
Sbjct  26   DMSIISYDHNHNLLPSS--SRSDDEVMRIYESWLVQHRKNYNALG-EKEKRFAIFKDNLE  82

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLG------AKTDARRRIAKTKSDRRYAP  439
            +ID+ NS + + +K+GLN+FADLTNEE+RS YLG      +        +K KSD RY  
Sbjct  83   FIDQHNSDDSQTFKVGLNKFADLTNEEFRSVYLGRKKSSSSSPLLSSAKSKVKSD-RYLF  141

Query  440  KVGGSLPDSIDW  475
            K G  LP+++DW
Sbjct  142  KEGDELPEAVDW  153



>ref|XP_010093524.1| Germination-specific cysteine protease 1 [Morus notabilis]
 gb|EXB54190.1| Germination-specific cysteine protease 1 [Morus notabilis]
Length=361

 Score =   130 bits (326),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 60/123 (49%), Positives = 85/123 (69%), Gaps = 2/123 (2%)
 Frame = +2

Query  110  MSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDE  289
            M I+ +    P     R+D EV  +Y  W+  HG+++NGLG E++ RFEIFKDNLR++DE
Sbjct  7    MIILCFALSLPPLTSGRSDAEVREMYVKWMATHGRAHNGLG-EEETRFEIFKDNLRFVDE  65

Query  290  QNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDS  466
             N+ + R YK+G+NRFAD+TNEEYR   LG ++DA+R + K KS  RRYA +    LP++
Sbjct  66   HNAVQKRTYKVGMNRFADMTNEEYRREMLGTRSDAKRIVMKAKSPSRRYASRAADQLPET  125

Query  467  IDW  475
            +DW
Sbjct  126  VDW  128



>ref|XP_009123448.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD21a-like 
[Brassica rapa]
Length=461

 Score =   131 bits (329),  Expect = 6e-33, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TK+  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKTSLRYEARVGDAIPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>dbj|BAG16377.1| cysteine protease [Brassica rapa var. perviridis]
Length=431

 Score =   130 bits (328),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  17   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  74

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TK+  RY  +VG ++P+S
Sbjct  75   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKTSLRYEARVGDAIPES  129

Query  467  IDW  475
            +DW
Sbjct  130  VDW  132



>emb|CDY06760.1| BnaA10g05390D [Brassica napus]
Length=457

 Score =   130 bits (328),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 68/123 (55%), Positives = 90/123 (73%), Gaps = 7/123 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YD+ H     SR+D EV  LYE W+V+HGK+ N L  EKD+RFEIFKDNLR+ID
Sbjct  23   DMSIISYDKNHHTVS-SRSDVEVSRLYEEWVVKHGKAQNSLT-EKDRRFEIFKDNLRFID  80

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDS  466
            E N + + +Y+LGL +FADLTN+EYRS YLG    +R +   TK+  RY  +VG ++P+S
Sbjct  81   EHNGK-NLSYRLGLTKFADLTNDEYRSMYLG----SRLKRKATKTSLRYEARVGDAIPES  135

Query  467  IDW  475
            +DW
Sbjct  136  VDW  138



>gb|AFK47737.1| unknown [Medicago truncatula]
Length=359

 Score =   129 bits (325),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 64/108 (59%), Positives = 80/108 (74%), Gaps = 4/108 (4%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            R++EEVM +YE WLV+H K YNGLG EKD+RFEIFKDNL +IDE N+ ++  YK+GLN+F
Sbjct  26   RSNEEVMTMYEEWLVKHHKVYNGLG-EKDQRFEIFKDNLGFIDEHNA-QNYTYKVGLNKF  83

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTK--SDRRYAPKVGGSLPDSIDW  475
            AD TNEEYR+ YLG K DA+R + K K  +  RYA   G  LP  +DW
Sbjct  84   ADTTNEEYRNMYLGTKNDAKRNVMKIKITTGHRYAFNSGDRLPVHVDW  131



>gb|KHN12823.1| Cysteine proteinase RD21a [Glycine soja]
Length=366

 Score =   130 bits (326),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 81/109 (74%), Gaps = 2/109 (2%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  331
            ++ TD EVMA+YE WLV+H K YN LG +KDKRF++FKDNL +I E N+  +  YKLGLN
Sbjct  27   INYTDNEVMAMYEEWLVKHQKVYNELG-KKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLN  85

Query  332  RFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            +FAD+TNEEYR+ YLG K++A+RR+ KTKS   RYA      LP  +DW
Sbjct  86   KFADMTNEEYRAMYLGTKSNAKRRLMKTKSTGHRYAFSARDRLPVHVDW  134



>ref|XP_010919166.1| PREDICTED: oryzain alpha chain-like [Elaeis guineensis]
Length=221

 Score =   126 bits (317),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 63/120 (53%), Positives = 86/120 (72%), Gaps = 5/120 (4%)
 Frame = +2

Query  125  YDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSRE  304
            Y+E H  +GL  ++E++  LYE WL +HG++YN L  EK++RFEIFKDN+R+ID  N+  
Sbjct  85   YNEAHGVRGLEWSEEQMRLLYEGWLAKHGRTYNALE-EKERRFEIFKDNVRFIDAHNAAA  143

Query  305  D---RAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            D    +++LGLNRFAD+TNEEYR+ YLG +   +RR A+  SD RY   VG  LP+SIDW
Sbjct  144  DSGHHSFRLGLNRFADITNEEYRAVYLGTRPAGQRRRARFGSD-RYRYNVGEELPESIDW  202



>ref|NP_001242584.1| uncharacterized protein LOC100804015 precursor [Glycine max]
 gb|ACU20623.1| unknown [Glycine max]
Length=366

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 80/109 (73%), Gaps = 2/109 (2%)
 Frame = +2

Query  152  LSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLN  331
            ++ TD EVMA+YE WLV H K YN LG +KDKRF++FKDNL +I E N+  +  YKLGLN
Sbjct  27   INYTDNEVMAMYEEWLVRHQKGYNELG-KKDKRFQVFKDNLGFIQEHNNNLNNTYKLGLN  85

Query  332  RFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            +FAD+TNEEYR+ YLG K++A+RR+ KTKS   RYA      LP  +DW
Sbjct  86   KFADMTNEEYRAMYLGTKSNAKRRLMKTKSTGHRYAFSARDRLPVHVDW  134



>ref|XP_008338342.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   129 bits (325),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 87/108 (81%), Gaps = 3/108 (3%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            SR++ +V A+Y+ WLV+H K+YNG+G E+++RFEIFKDN+++IDE N+ +DR YK+GLN 
Sbjct  28   SRSEADVKAIYQEWLVKHQKTYNGIG-EEERRFEIFKDNMKFIDEHNA-QDRPYKVGLNA  85

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            FADLTN+EYR+ +LG ++D +RR+ K K    RYA + G +LP+S+DW
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDW  133



>ref|XP_009396268.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=473

 Score =   130 bits (327),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/127 (50%), Positives = 89/127 (70%), Gaps = 6/127 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+YDE+H  +GL R+DEEV  +Y++W+  HG++YN L GE+++RFE+FKDNLR++D
Sbjct  26   DMSIISYDEKHGVRGLERSDEEVRRMYDAWMAAHGRAYNAL-GERERRFEVFKDNLRFVD  84

Query  287  EQNSRED---RAYKLGLNRFADLTNEEYRSTYLGAKTD-ARRRIAKTKSDRRYAPKVGGS  454
              N+      R ++LGLNRFADLTNEEYR+ YLG + + A  R  +  SD RY       
Sbjct  85   AHNAAAGAGVRGFRLGLNRFADLTNEEYRAVYLGTRANRATARRVRVASD-RYRYNASEE  143

Query  455  LPDSIDW  475
            L + +DW
Sbjct  144  LSEFVDW  150



>ref|XP_010028191.1| PREDICTED: cysteine proteinase COT44-like [Eucalyptus grandis]
 gb|KCW54882.1| hypothetical protein EUGRSUZ_I00844 [Eucalyptus grandis]
Length=370

 Score =   129 bits (324),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 63/109 (58%), Positives = 84/109 (77%), Gaps = 5/109 (5%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTDEEVM +YE WL +HGK+YNGLG E+++RFEIF+DNLR++DE  +  +R+Y LG+NRF
Sbjct  29   RTDEEVMGMYELWLAKHGKAYNGLG-ERERRFEIFRDNLRFVDEHTAL-NRSYALGMNRF  86

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKT-KSDRRYA--PKVGGSLPDSIDW  475
            ADLTNEEYR+ YLG ++D  RR+AK  ++  RYA  P     LP ++DW
Sbjct  87   ADLTNEEYRAIYLGTRSDPMRRVAKARRASDRYASRPCDDSMLPAAVDW  135



>ref|XP_010461511.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 73/128 (57%), Positives = 91/128 (71%), Gaps = 12/128 (9%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDAR--RRIAKTKSDRRYAPKVGG  451
            +ID+ N + +  Y+LGL RFADLTN+EYRS YLGAKT  +  RRI+      RY  +VG 
Sbjct  82   FIDDHNEK-NLGYRLGLTRFADLTNDEYRSMYLGAKTHKKGERRIS-----HRYKARVGD  135

Query  452  SLPDSIDW  475
             LP+ +DW
Sbjct  136  ELPELVDW  143



>ref|XP_010500237.1| PREDICTED: cysteine proteinase RD21a-like [Camelina sativa]
Length=462

 Score =   130 bits (326),  Expect = 2e-32, Method: Compositional matrix adjust.
 Identities = 70/126 (56%), Positives = 91/126 (72%), Gaps = 8/126 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLS-RTDEEVMALYESWLVEHGK--SYNGLGGEKDKRFEIFKDNLR  277
            DMSII+YDE+H     S R+D EV ++YE WLV+HGK  + N L GEKD RFEIFKDNLR
Sbjct  23   DMSIISYDEKHGVSSSSGRSDAEVRSMYEEWLVKHGKVQNQNSLLGEKD-RFEIFKDNLR  81

Query  278  YIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
            +ID+ N + + +Y+LGL RFADLTN+EYRS YLGAKT  +    + ++  RY  +VG  L
Sbjct  82   FIDDHNEK-NLSYRLGLTRFADLTNDEYRSMYLGAKTHKK---GERRTSHRYKARVGDEL  137

Query  458  PDSIDW  475
            P+ +DW
Sbjct  138  PELVDW  143



>emb|CDY17044.1| BnaA08g04080D [Brassica napus]
Length=459

 Score =   129 bits (324),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +2

Query  107  DMSIITYDEEH-PAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+ H      SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHRTVSAGSRSDAEVSKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            D+ N + + +Y+LGL +FADLTN+EYRS Y+G    +R +   T++  RY  +VG +LP+
Sbjct  82   DDHNGK-NLSYRLGLTKFADLTNDEYRSMYVG----SRLKRKSTRTSLRYESRVGDALPE  136

Query  464  SIDW  475
            S+DW
Sbjct  137  SVDW  140



>ref|XP_007136708.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
 gb|ESW08702.1| hypothetical protein PHAVU_009G067300g [Phaseolus vulgaris]
Length=373

 Score =   128 bits (321),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 69/124 (56%), Positives = 90/124 (73%), Gaps = 5/124 (4%)
 Frame = +2

Query  107  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD   H  K   R+DEEV ++YE WLV+HGK  + L   K+KRF+IFKDNL++I
Sbjct  26   DMSIISYDRTTHADKTERRSDEEVRSIYEEWLVKHGKVPSTLA-LKEKRFQIFKDNLKFI  84

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            D+ N+ E+R YK+GLNRFADL+N+EYRS YL  K +  R  AK  +  RYAP+V   LP+
Sbjct  85   DDHNA-ENRTYKVGLNRFADLSNDEYRSKYLRTKINPLRMTAKPSN--RYAPRVDDILPE  141

Query  464  SIDW  475
            S+DW
Sbjct  142  SVDW  145



>ref|XP_010688590.1| PREDICTED: low-temperature-induced cysteine proteinase-like [Beta 
vulgaris subsp. vulgaris]
Length=463

 Score =   129 bits (324),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/107 (60%), Positives = 80/107 (75%), Gaps = 1/107 (1%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            SRTD EVMALYESWL++HGK+YN LG EK++R E+FKDNL +ID+ NS +++ +KLGLN+
Sbjct  38   SRTDAEVMALYESWLMKHGKNYNALG-EKERRLEVFKDNLWFIDQHNSDQNQTFKLGLNQ  96

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            FADLTNEE+RS Y+G +   R R        RY  K G SLP SIDW
Sbjct  97   FADLTNEEFRSKYVGTRRRDRNRRLARSKSDRYGFKEGDSLPPSIDW  143



>gb|AEV41117.1| putative oryzain beta chain precursor [Oryza officinalis]
Length=465

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE ++RF +F DNLR+ D
Sbjct  28   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEHERRFRVFWDNLRFAD  86

Query  287  EQNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+R +D  ++LG+NRFADLTNEE+R+T+LGAK   R R A      RY       LP+
Sbjct  87   AHNARADDHGFRLGMNRFADLTNEEFRATFLGAKVVERSRAAG----ERYRHDGVEELPE  142

Query  464  SIDW  475
            S+DW
Sbjct  143  SVDW  146



>ref|XP_006652996.1| PREDICTED: oryzain beta chain-like [Oryza brachyantha]
Length=460

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 64/124 (52%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A Y+ WL E+G+SYN L GE D+RF +F DNLR++D
Sbjct  26   DMSIISYNEEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEYDRRFRVFWDNLRFVD  84

Query  287  EQNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+R  +  ++LG+NRFADLTNEE+R+ +LG K   R R+A      RY       LP+
Sbjct  85   AHNARAGEHRFRLGMNRFADLTNEEFRAAFLGVKVAERSRVA----GERYRHDGVEELPE  140

Query  464  SIDW  475
            S+DW
Sbjct  141  SVDW  144



>gb|AEV41071.1| putative oryzain beta chain precursor [Oryza minuta]
Length=464

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 65/124 (52%), Positives = 86/124 (69%), Gaps = 6/124 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE ++RF +F DNLR+ D
Sbjct  27   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GEHERRFRVFWDNLRFAD  85

Query  287  EQNSR-EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+R +D  ++LG+NRFADLTNEE+R+T+LGAK   R R A      RY       LP+
Sbjct  86   AHNARADDHGFRLGMNRFADLTNEEFRATFLGAKVVERSRAAG----ERYRHDGVEELPE  141

Query  464  SIDW  475
            S+DW
Sbjct  142  SVDW  145



>emb|CDY63586.1| BnaCnng42340D [Brassica napus]
Length=459

 Score =   129 bits (323),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 67/124 (54%), Positives = 89/124 (72%), Gaps = 7/124 (6%)
 Frame = +2

Query  107  DMSIITYDE-EHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYI  283
            DMSII+YD+  H     SR+D EV  LYE WLV+HGK  N L  EKD+RFEIFKDNLR+I
Sbjct  23   DMSIISYDKNHHTISAGSRSDAEVYKLYEEWLVKHGKVQNSLT-EKDRRFEIFKDNLRFI  81

Query  284  DEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
            D+ N + + +Y+LGL +FADLTN+EYRS Y+G    +R +   T++  RY  +VG +LP+
Sbjct  82   DDHNGK-NLSYRLGLTKFADLTNDEYRSMYVG----SRLKRKSTRTSLRYEARVGDALPE  136

Query  464  SIDW  475
            S+DW
Sbjct  137  SVDW  140



>ref|XP_008340386.1| PREDICTED: cysteine proteinase COT44-like [Malus domestica]
Length=366

 Score =   127 bits (320),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 63/119 (53%), Positives = 89/119 (75%), Gaps = 4/119 (3%)
 Frame = +2

Query  122  TYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSR  301
            T  +  P  G SR++ +V A+Y+ WLV+H K+YNG+G E ++RFEIFKDNL++IDE N+ 
Sbjct  18   TLSQASPIVG-SRSEADVRAIYQEWLVKHQKTYNGIG-EDERRFEIFKDNLKFIDEHNAL  75

Query  302  EDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
             DR YK+GLN FADLTN+EYR+ +LG ++D +RR  K K+   RYA + G +LP+S+DW
Sbjct  76   -DRPYKVGLNAFADLTNQEYRAKFLGTRSDPKRRXMKAKNPSLRYAFRAGETLPESVDW  133



>pir||TAGB actinidain (EC 3.4.22.14) precursor - kiwi fruit
 gb|AAA32629.1| actinidin [Actinidia deliciosa]
Length=380

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +2

Query  143  AKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYK  319
            AK L+ RT++EV A+YESWL+++GKSYN LG E ++RFEIFK+ LR+IDE N+  +R+YK
Sbjct  27   AKNLTQRTNDEVKAMYESWLIKYGKSYNSLG-EWERRFEIFKETLRFIDEHNADTNRSYK  85

Query  320  LGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            +GLN+FADLT+EE+RSTYLG  + +     KTK   RY P+VG  LP  +DW
Sbjct  86   VGLNQFADLTDEEFRSTYLGFTSGSN----KTKVSNRYEPRVGQVLPSYVDW  133



>gb|ADQ85986.1| actinidin [Actinidia chinensis]
Length=380

 Score =   127 bits (320),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +2

Query  143  AKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYK  319
            AK L+ RT++EV A+YESWL+++GKSYN LG E ++RFEIFK+ LR+IDE N+  +R+YK
Sbjct  27   AKNLTQRTNDEVKAMYESWLIKYGKSYNSLG-EWERRFEIFKETLRFIDEHNADTNRSYK  85

Query  320  LGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            +GLN+FADLT+EE+RSTYLG  + +     KTK   RY P+VG  LP  +DW
Sbjct  86   VGLNQFADLTDEEFRSTYLGFTSGSN----KTKVSNRYEPRVGQVLPSYVDW  133



>sp|A5HII1.1|ACTN_ACTDE RecName: Full=Actinidain; Short=Actinidin; AltName: Full=Allergen 
Act d 1; AltName: Allergen=Act d 1; Flags: Precursor [Actinidia 
deliciosa]
 gb|ABQ10189.1| actinidin Act1a [Actinidia deliciosa]
Length=380

 Score =   127 bits (320),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/112 (57%), Positives = 86/112 (77%), Gaps = 6/112 (5%)
 Frame = +2

Query  143  AKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYK  319
            AK L+ RT++EV A+YESWL+++GKSYN LG E ++RFEIFK+ LR+IDE N+  +R+YK
Sbjct  27   AKNLTQRTNDEVKAMYESWLIKYGKSYNSLG-EWERRFEIFKETLRFIDEHNADTNRSYK  85

Query  320  LGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            +GLN+FADLT+EE+RSTYLG  + +     KTK   RY P+VG  LP  +DW
Sbjct  86   VGLNQFADLTDEEFRSTYLGFTSGSN----KTKVSNRYEPRVGQVLPSYVDW  133



>ref|XP_009372437.1| PREDICTED: cysteine proteinase COT44-like [Pyrus x bretschneideri]
Length=366

 Score =   127 bits (319),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 59/108 (55%), Positives = 86/108 (80%), Gaps = 3/108 (3%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            S+++ +V A+Y+ WLV+H K+YNG+G E++ RFEIFKDNL++IDE N+ +DR YK+GLN 
Sbjct  28   SQSEADVRAIYQEWLVKHQKTYNGIG-EEEVRFEIFKDNLKFIDEHNA-QDRPYKVGLNA  85

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKS-DRRYAPKVGGSLPDSIDW  475
            FADLTN+EYR+ +LG ++D +RR+ K K    RYA + G +LP+S+DW
Sbjct  86   FADLTNQEYRAKFLGTRSDPKRRVMKAKKPSLRYAFRAGETLPESVDW  133



>gb|AEV40973.1| putative oryzain beta chain precursor [Oryza punctata]
Length=461

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/125 (51%), Positives = 87/125 (70%), Gaps = 7/125 (6%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+ EH A+GL RT+ E  A Y+ WL E+G+SYN L GE+++RF +F DNL+++D
Sbjct  23   DMSIISYNAEHGARGLERTEAEARAAYDLWLAENGRSYNAL-GERERRFRVFWDNLKFVD  81

Query  287  EQNSREDR--AYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLP  460
              N+R D    ++LG+NRFADLTN+E+RST+LGAK   R R A      RY       LP
Sbjct  82   AHNARADEHGGFRLGMNRFADLTNDEFRSTFLGAKVVERSRAAG----ERYRHDGVEELP  137

Query  461  DSIDW  475
            +S+DW
Sbjct  138  ESVDW  142



>gb|KDO59789.1| hypothetical protein CISIN_1g012022mg [Citrus sinensis]
Length=472

 Score =   128 bits (322),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG E+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EQERRFEIFKDNLKFVN  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  454
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  79   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  137

Query  455  LPDSIDW  475
            LP+S+DW
Sbjct  138  LPESVDW  144



>ref|XP_006487026.1| PREDICTED: cysteine proteinase RD21a-like [Citrus sinensis]
Length=472

 Score =   128 bits (322),  Expect = 8e-32, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 90/127 (71%), Gaps = 6/127 (5%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII Y+  H   G + ++  +  +YE WLV+HGK+YN LG E+++RFEIFKDNL++++
Sbjct  20   DMSIIDYNRMHGNGGGNMSESHMRMMYEHWLVKHGKNYNALG-EQERRFEIFKDNLKFVN  78

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRI----AKTKSDRRYAPKVGGS  454
            E N+   R YK+GLN+FADLTN+E+R+ YLGAK + ++ +       KS  RY  K G +
Sbjct  79   EHNAVA-RTYKVGLNKFADLTNDEFRNMYLGAKMERKKALRAGNGNAKSSDRYVYKHGDA  137

Query  455  LPDSIDW  475
            LP+S+DW
Sbjct  138  LPESVDW  144



>gb|ABQ10194.1| actinidin Act2c [Actinidia arguta]
Length=378

 Score =   127 bits (319),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 62/106 (58%), Positives = 80/106 (75%), Gaps = 6/106 (6%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RT+++V  +YESWLVE GKSYN L  EK+ RFEIFKDNLR ID+ N+  +R++ LGLNRF
Sbjct  33   RTNDQVRDMYESWLVEQGKSYNSLD-EKEMRFEIFKDNLRIIDDHNADANRSFSLGLNRF  91

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLT+EEYRSTYLG K+  + +++      RY PKVG  LP+ +DW
Sbjct  92   ADLTDEEYRSTYLGFKSGPKAKVSN-----RYVPKVGDVLPNYVDW  132



>gb|ADQ85985.1| actinidin [Actinidia chinensis]
Length=380

 Score =   127 bits (318),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 82/106 (77%), Gaps = 5/106 (5%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RT++EV A+YESWL+++GKSYN LG E ++RFEIFK+ LR+IDE N+  +R+YK+GLN+F
Sbjct  33   RTNDEVKAMYESWLIKYGKSYNSLG-EWERRFEIFKETLRFIDEHNADTNRSYKVGLNQF  91

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLT+EE+RSTYLG  + +     KTK   RY P+VG  LP  +DW
Sbjct  92   ADLTDEEFRSTYLGFTSGSN----KTKVSNRYEPRVGQVLPSYVDW  133



>dbj|BAC75927.1| cysteine protease-5 [Helianthus annuus]
Length=365

 Score =   126 bits (317),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 64/110 (58%), Positives = 76/110 (69%), Gaps = 4/110 (4%)
 Frame = +2

Query  155  SRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNR  334
            +RTDEEV   YE WL  HGK+YN LG EK+ RF IF DNL++IDE N   +R+YK+GLN+
Sbjct  26   TRTDEEVRNTYELWLARHGKTYNALG-EKESRFRIFADNLKFIDEHNLSGNRSYKVGLNQ  84

Query  335  FADLTNEEYRSTYLGAKTDARRRIAKTKS---DRRYAPKVGGSLPDSIDW  475
            FADLTNEEYRS YLG K D  RRIAK +     RRYA +     P  +DW
Sbjct  85   FADLTNEEYRSMYLGTKVDPYRRIAKMQRGEISRRYAVQENEMFPAKVDW  134



>ref|XP_004960237.1| PREDICTED: oryzain beta chain-like isoform X2 [Setaria italica]
Length=461

 Score =   127 bits (319),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 62/124 (50%), Positives = 87/124 (70%), Gaps = 4/124 (3%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII+Y+EEH A+GL RT+ E  A+Y+ WL EHG++YN L  E D+RF +F DNLR++D
Sbjct  27   DMSIISYNEEHGARGLERTEAEARAMYDLWLAEHGRAYNAL-DEHDRRFRVFWDNLRFVD  85

Query  287  EQNSRE-DRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPD  463
              N+R  D  Y+LG+N+FADLTN+E+R+ YLGA+  AR       +  RY      +LP+
Sbjct  86   AHNARAGDHGYRLGMNQFADLTNDEFRAAYLGARLPARGD--DRAAGERYRHDGVEALPE  143

Query  464  SIDW  475
            ++DW
Sbjct  144  NVDW  147



>emb|CDY25228.1| BnaC02g30040D [Brassica napus]
Length=460

 Score =   127 bits (318),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 71/129 (55%), Positives = 91/129 (71%), Gaps = 13/129 (10%)
 Frame = +2

Query  107  DMSIITYDEE-HPAKGLSRTDEEVMALYESWLVEHGK-----SYNGLGGEKDKRFEIFKD  268
            DMSII+YDE+ H +    R+D EV  +YE W+ +HGK       NGL    D+RFEIFKD
Sbjct  22   DMSIISYDEKRHISAVNGRSDAEVSKIYEEWMEKHGKKKMMTQNNGL--VTDQRFEIFKD  79

Query  269  NLRYIDEQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVG  448
            NLR+IDE N++ + +YKLGL RFADLTN+EYRS YLGAK   ++R+ KT    RY P+VG
Sbjct  80   NLRFIDEHNNK-NLSYKLGLTRFADLTNDEYRSIYLGAK--PKKRVLKTSD--RYEPRVG  134

Query  449  GSLPDSIDW  475
             +LP S+DW
Sbjct  135  DALPASVDW  143



>ref|XP_009400290.1| PREDICTED: oryzain alpha chain-like [Musa acuminata subsp. malaccensis]
Length=470

 Score =   126 bits (317),  Expect = 3e-31, Method: Compositional matrix adjust.
 Identities = 61/126 (48%), Positives = 87/126 (69%), Gaps = 5/126 (4%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSI+ Y++EH  +GL R++EE+  +YE WL +HG++ N L G+ + RF+IFKDNLR++D
Sbjct  24   DMSIVAYNKEHGVRGLERSEEEMRRMYEGWLAKHGRANNAL-GQNEMRFDIFKDNLRFVD  82

Query  287  EQNSREDRA---YKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSL  457
              N+  D     ++LGLNRFADLTNEEYR+ YLG +     R ++   D RY  + G  L
Sbjct  83   AHNAAADAGRHRFRLGLNRFADLTNEEYRAAYLGTRARGVARRSRVPGD-RYRYEDGEEL  141

Query  458  PDSIDW  475
            P+S+DW
Sbjct  142  PESVDW  147



>gb|KHN08598.1| Cysteine proteinase RD21a [Glycine soja]
Length=435

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 65/125 (52%), Positives = 83/125 (66%), Gaps = 14/125 (11%)
 Frame = +2

Query  107  DMSIITYDEEHPAKGLSRTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYID  286
            DMSII YDE H              +YE+WLV+HGK+YN LG EK++RF+IFKDNLR+I+
Sbjct  2    DMSIIDYDESH-----------TRHVYEAWLVKHGKAYNALG-EKERRFKIFKDNLRFIE  49

Query  287  EQNSREDRAYKLGLNRFADLTNEEYRSTYLGAKTDARRRIAKT--KSDRRYAPKVGGSLP  460
            E N   D++YKLGLN+FADLTNEEYR+ +LG +T   +  A    K   RYA + G  LP
Sbjct  50   EHNGAGDKSYKLGLNKFADLTNEEYRAMFLGTRTRGPKNKAAVVAKKTDRYAYRAGEELP  109

Query  461  DSIDW  475
              +DW
Sbjct  110  AMVDW  114



>emb|CAA34486.1| unnamed protein product [Actinidia deliciosa]
Length=380

 Score =   125 bits (315),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 63/112 (56%), Positives = 85/112 (76%), Gaps = 6/112 (5%)
 Frame = +2

Query  143  AKGLS-RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYK  319
            AK L+ RT++EV A+YESWL+++GKSYN LG E ++RFEIFK+ LR+IDE N+  +R+YK
Sbjct  27   AKNLTQRTNDEVKAMYESWLIKYGKSYNSLG-EWERRFEIFKETLRFIDEHNADTNRSYK  85

Query  320  LGLNRFADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            +GLN+FADLT+EE+RSTYLG  + +     KTK   RY P+ G  LP  +DW
Sbjct  86   VGLNQFADLTDEEFRSTYLGFTSGSN----KTKVSNRYEPRFGQVLPSYVDW  133



>ref|XP_004169515.1| PREDICTED: cysteine proteinase RD21a-like [Cucumis sativus]
Length=459

 Score =   126 bits (316),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N+ ++  Y+LGLN F
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINA-QNLPYRLGLNVF  90

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYRS YLG K  +  R  + ++  RY P++G  LPDSIDW
Sbjct  91   ADLTNEEYRSRYLGGKFASGSR--RNRTSNRYLPRLGDDLPDSIDW  134



>gb|KGN55227.1| hypothetical protein Csa_4G641600 [Cucumis sativus]
Length=459

 Score =   126 bits (316),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 61/106 (58%), Positives = 78/106 (74%), Gaps = 3/106 (3%)
 Frame = +2

Query  158  RTDEEVMALYESWLVEHGKSYNGLGGEKDKRFEIFKDNLRYIDEQNSREDRAYKLGLNRF  337
            RTD+EVMALY+ W  +HGK +N LG E + RF IFKDNL++IDE N+ ++  Y+LGLN F
Sbjct  32   RTDDEVMALYDQWRAKHGKLHNNLGAEPENRFHIFKDNLKFIDEINA-QNLPYRLGLNVF  90

Query  338  ADLTNEEYRSTYLGAKTDARRRIAKTKSDRRYAPKVGGSLPDSIDW  475
            ADLTNEEYRS YLG K  +  R  + ++  RY P++G  LPDSIDW
Sbjct  91   ADLTNEEYRSRYLGGKFASGSR--RNRTSNRYLPRLGDDLPDSIDW  134



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 552245584395