BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A12

Length=546
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009788736.1|  PREDICTED: luminal-binding protein 4               261   8e-80   Nicotiana sylvestris
sp|Q03684.1|BIP4_TOBAC  RecName: Full=Luminal-binding protein 4; ...    261   1e-79   Nicotiana tabacum [American tobacco]
gb|ACK55195.1|  ER luminal-binding protein                              259   4e-79   Nicotiana benthamiana
ref|XP_009588550.1|  PREDICTED: luminal-binding protein 4               259   4e-79   Nicotiana tomentosiformis
ref|XP_011075955.1|  PREDICTED: luminal-binding protein 5               253   1e-76   Sesamum indicum [beniseed]
ref|XP_006350519.1|  PREDICTED: luminal-binding protein 5-like          252   4e-76   Solanum tuberosum [potatoes]
ref|XP_004234985.1|  PREDICTED: luminal-binding protein 5               250   1e-75   Solanum lycopersicum
ref|XP_009592769.1|  PREDICTED: luminal-binding protein 5               250   2e-75   Nicotiana tomentosiformis
ref|XP_009773333.1|  PREDICTED: luminal-binding protein 5               250   2e-75   Nicotiana sylvestris
ref|XP_009396163.1|  PREDICTED: luminal-binding protein 2-like          249   2e-75   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDP05035.1|  unnamed protein product                                247   2e-74   Coffea canephora [robusta coffee]
gb|AGS42239.1|  ER luminal-binding protein                              247   2e-74   Capsicum annuum
sp|Q42434.1|BIP_SPIOL  RecName: Full=Luminal-binding protein; Sho...    246   3e-74   Spinacia oleracea
ref|XP_011084527.1|  PREDICTED: luminal-binding protein 5-like          246   6e-74   Sesamum indicum [beniseed]
gb|EYU19660.1|  hypothetical protein MIMGU_mgv1a002500mg                246   6e-74   Erythranthe guttata [common monkey flower]
gb|KHM99873.1|  Luminal-binding protein 5                               244   4e-73   Glycine soja [wild soybean]
gb|AJF19166.1|  endoplasmic reticulum chaperone binding protein         243   6e-73   Lycium chinense [Chinese boxthorn]
gb|AAK21920.1|AF338252_1  BiP-isoform D                                 239   8e-73   Glycine max [soybeans]
gb|KJB39586.1|  hypothetical protein B456_007G020600                    237   9e-73   Gossypium raimondii
gb|KHN16716.1|  Luminal-binding protein 5                               243   2e-72   Glycine soja [wild soybean]
gb|AAB86942.1|  endoplasmic reticulum HSC70-cognate binding prote...    242   2e-72   Glycine max [soybeans]
ref|XP_008390320.1|  PREDICTED: luminal-binding protein 5               242   2e-72   Malus domestica [apple tree]
gb|AAW55475.1|  ER-binding protein                                      242   2e-72   Malus pumila [paradise apple]
ref|XP_010266594.1|  PREDICTED: luminal-binding protein 5               241   3e-72   Nelumbo nucifera [Indian lotus]
ref|XP_009619852.1|  PREDICTED: luminal-binding protein 4-like          241   3e-72   Nicotiana tomentosiformis
gb|EYU25251.1|  hypothetical protein MIMGU_mgv1a002497mg                241   3e-72   Erythranthe guttata [common monkey flower]
ref|XP_007211088.1|  hypothetical protein PRUPE_ppa002489mg             241   3e-72   Prunus persica
gb|KJB39579.1|  hypothetical protein B456_007G020300                    238   5e-72   Gossypium raimondii
ref|XP_010671405.1|  PREDICTED: luminal-binding protein                 240   9e-72   Beta vulgaris subsp. vulgaris [field beet]
gb|AGT16055.1|  luminal-binding protein 2 precursor                     240   1e-71   Saccharum hybrid cultivar R570
gb|AGT16206.1|  luminal-binding protein                                 240   1e-71   Saccharum hybrid cultivar R570
gb|AGT15890.1|  luminal-binding protein                                 240   1e-71   Saccharum hybrid cultivar R570
ref|XP_003530453.1|  PREDICTED: luminal-binding protein 5               239   1e-71   Glycine max [soybeans]
gb|AAA99920.1|  glucose-regulated protein 78                            232   1e-71   Solanum lycopersicum
ref|NP_001105894.1|  luminal-binding protein 3 precursor                239   2e-71   Zea mays [maize]
gb|ACF86491.1|  unknown                                                 239   2e-71   Zea mays [maize]
ref|XP_008437399.1|  PREDICTED: luminal-binding protein 5               239   2e-71   Cucumis melo [Oriental melon]
ref|NP_001045675.1|  Os02g0115900                                       239   2e-71   
emb|CAB72128.1|  heat shock protein 70                                  239   3e-71   Cucumis sativus [cucumbers]
ref|XP_004143862.1|  PREDICTED: luminal-binding protein 5-like          239   3e-71   
ref|XP_002518865.1|  heat shock protein, putative                       239   3e-71   Ricinus communis
ref|XP_008337565.1|  PREDICTED: luminal-binding protein 5-like          238   4e-71   
emb|CAC14168.1|  putative luminal binding protein                       238   4e-71   Corylus avellana [European hazelnut]
gb|KJB18908.1|  hypothetical protein B456_003G074600                    233   4e-71   Gossypium raimondii
ref|XP_002303672.1|  BiP isoform A family protein                       238   4e-71   Populus trichocarpa [western balsam poplar]
gb|KJB18909.1|  hypothetical protein B456_003G074600                    233   5e-71   Gossypium raimondii
gb|KJB39584.1|  hypothetical protein B456_007G020600                    238   5e-71   Gossypium raimondii
gb|KJB39580.1|  hypothetical protein B456_007G020300                    238   5e-71   Gossypium raimondii
ref|NP_001105893.1|  luminal-binding protein 2 precursor                238   6e-71   
gb|KDP25255.1|  hypothetical protein JCGZ_20411                         238   7e-71   Jatropha curcas
ref|XP_009770477.1|  PREDICTED: luminal-binding protein 4-like          238   7e-71   Nicotiana sylvestris
gb|AAA81953.1|  BiP isoform C                                           233   7e-71   Glycine max [soybeans]
gb|KJB18915.1|  hypothetical protein B456_003G074600                    233   7e-71   Gossypium raimondii
gb|KHG04866.1|  Luminal-binding 5                                       239   9e-71   Gossypium arboreum [tree cotton]
gb|KJB18910.1|  hypothetical protein B456_003G074600                    233   1e-70   Gossypium raimondii
gb|KJB24175.1|  hypothetical protein B456_004G131400                    234   1e-70   Gossypium raimondii
ref|XP_006439283.1|  hypothetical protein CICLE_v10019184mg             237   1e-70   Citrus clementina [clementine]
ref|XP_009358650.1|  PREDICTED: luminal-binding protein 5-like          236   2e-70   Pyrus x bretschneideri [bai li]
gb|KJB18911.1|  hypothetical protein B456_003G074600                    233   3e-70   Gossypium raimondii
ref|XP_008239207.1|  PREDICTED: luminal-binding protein 5               236   3e-70   Prunus mume [ume]
gb|KEH21274.1|  heat shock 70 kDa protein                               236   3e-70   Medicago truncatula
gb|KJB18913.1|  hypothetical protein B456_003G074600                    232   3e-70   Gossypium raimondii
ref|XP_004952156.1|  PREDICTED: luminal-binding protein 3-like          236   4e-70   Setaria italica
ref|XP_008796727.1|  PREDICTED: luminal-binding protein 5               236   4e-70   Phoenix dactylifera
ref|XP_004503582.1|  PREDICTED: luminal-binding protein-like            236   5e-70   Cicer arietinum [garbanzo]
ref|XP_007040596.1|  Heat shock protein 70 (Hsp 70) family protein      235   9e-70   
ref|XP_006476337.1|  PREDICTED: luminal-binding protein 5-like          234   1e-69   Citrus sinensis [apfelsine]
emb|CDP12195.1|  unnamed protein product                                234   1e-69   Coffea canephora [robusta coffee]
ref|XP_006648229.1|  PREDICTED: luminal-binding protein 2-like          234   2e-69   Oryza brachyantha
gb|KDP35832.1|  hypothetical protein JCGZ_10646                         234   2e-69   Jatropha curcas
gb|KHG07305.1|  Luminal-binding 5                                       234   2e-69   Gossypium arboreum [tree cotton]
emb|CBI23034.3|  unnamed protein product                                234   2e-69   Vitis vinifera
gb|KJB24174.1|  hypothetical protein B456_004G131400                    234   2e-69   Gossypium raimondii
ref|XP_006343810.1|  PREDICTED: luminal-binding protein-like            234   2e-69   Solanum tuberosum [potatoes]
ref|XP_010107258.1|  Luminal-binding protein 5                          234   2e-69   Morus notabilis
emb|CBI34546.3|  unnamed protein product                                233   2e-69   Vitis vinifera
ref|XP_010918502.1|  PREDICTED: luminal-binding protein 4-like          234   2e-69   Elaeis guineensis
gb|KHN16714.1|  Luminal-binding protein 5                               234   2e-69   Glycine soja [wild soybean]
dbj|BAD95470.1|  BiP                                                    234   2e-69   Glycine max [soybeans]
ref|XP_002276268.2|  PREDICTED: luminal-binding protein 5-like is...    234   2e-69   Vitis vinifera
gb|KHG09348.1|  Luminal-binding 5                                       234   3e-69   Gossypium arboreum [tree cotton]
ref|XP_010662895.1|  PREDICTED: luminal-binding protein 5-like is...    234   3e-69   Vitis vinifera
ref|XP_004300491.1|  PREDICTED: luminal-binding protein                 233   3e-69   Fragaria vesca subsp. vesca
gb|KJB18907.1|  hypothetical protein B456_003G074600                    233   4e-69   Gossypium raimondii
ref|XP_007160200.1|  hypothetical protein PHAVU_002G301400g             233   4e-69   Phaseolus vulgaris [French bean]
gb|ACJ11746.1|  luminal binding protein                                 233   4e-69   Gossypium hirsutum [American cotton]
ref|XP_002263323.1|  PREDICTED: luminal-binding protein 5               233   4e-69   Vitis vinifera
ref|XP_009802727.1|  PREDICTED: luminal-binding protein                 233   5e-69   Nicotiana sylvestris
gb|EPS69483.1|  luminal-binding protein 5                               233   6e-69   Genlisea aurea
ref|XP_009593820.1|  PREDICTED: luminal-binding protein                 233   6e-69   Nicotiana tomentosiformis
ref|XP_011022455.1|  PREDICTED: luminal-binding protein 5-like          233   7e-69   Populus euphratica
ref|XP_004503579.1|  PREDICTED: luminal-binding protein-like            233   7e-69   Cicer arietinum [garbanzo]
ref|NP_001234636.1|  luminal-binding protein precursor                  233   7e-69   
ref|XP_006286332.1|  hypothetical protein CARUB_v100044651mg            226   8e-69   
gb|KHM99871.1|  Luminal-binding protein 4                               232   9e-69   Glycine soja [wild soybean]
gb|AAB63469.1|  endosperm lumenal binding protein                       232   1e-68   Oryza sativa [red rice]
ref|XP_003525327.2|  PREDICTED: luminal-binding protein                 233   1e-68   
ref|XP_010055986.1|  PREDICTED: luminal-binding protein                 231   2e-68   Eucalyptus grandis [rose gum]
gb|KCW72555.1|  hypothetical protein EUGRSUZ_E01024                     231   4e-68   Eucalyptus grandis [rose gum]
ref|XP_006286341.1|  hypothetical protein CARUB_v100065121mg            226   5e-68   
ref|XP_002868566.1|  hypothetical protein ARALYDRAFT_493781             230   7e-68   
ref|XP_010473721.1|  PREDICTED: mediator of RNA polymerase II tra...    229   9e-68   Camelina sativa [gold-of-pleasure]
emb|CDY63497.1|  BnaC07g48050D                                          229   1e-67   Brassica napus [oilseed rape]
ref|XP_002887878.1|  hypothetical protein ARALYDRAFT_892955             229   2e-67   Arabidopsis lyrata subsp. lyrata
ref|XP_011026831.1|  PREDICTED: luminal-binding protein 5               229   2e-67   Populus euphratica
ref|NP_199017.2|  Luminal-binding protein 2                             228   2e-67   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002299448.1|  BiP isoform A family protein                       229   2e-67   Populus trichocarpa [western balsam poplar]
ref|XP_006405286.1|  hypothetical protein EUTSA_v10027674mg             228   3e-67   Eutrema salsugineum [saltwater cress]
ref|XP_006827760.1|  hypothetical protein AMTR_s00009p00264000          228   3e-67   Amborella trichopoda
dbj|BAA12348.1|  luminal binding protein (BiP)                          228   3e-67   Arabidopsis thaliana [mouse-ear cress]
ref|NP_851119.1|  Luminal-binding protein 2                             228   3e-67   Arabidopsis thaliana [mouse-ear cress]
dbj|BAA13948.1|  luminal binding protein                                228   4e-67   Arabidopsis thaliana [mouse-ear cress]
gb|KFK32162.1|  hypothetical protein AALP_AA6G205800                    228   5e-67   Arabis alpina [alpine rockcress]
gb|KDO76632.1|  hypothetical protein CISIN_1g0059551mg                  221   7e-67   Citrus sinensis [apfelsine]
ref|XP_006401475.1|  hypothetical protein EUTSA_v10012896mg             227   9e-67   Eutrema salsugineum [saltwater cress]
ref|XP_010446984.1|  PREDICTED: mediator of RNA polymerase II tra...    226   1e-66   Camelina sativa [gold-of-pleasure]
ref|XP_010430591.1|  PREDICTED: mediator of RNA polymerase II tra...    226   2e-66   Camelina sativa [gold-of-pleasure]
gb|KDO76630.1|  hypothetical protein CISIN_1g0059551mg                  222   3e-66   Citrus sinensis [apfelsine]
emb|CDX77423.1|  BnaA07g05610D                                          225   3e-66   
gb|KDO76631.1|  hypothetical protein CISIN_1g0059551mg                  221   4e-66   Citrus sinensis [apfelsine]
ref|XP_010436161.1|  PREDICTED: mediator of RNA polymerase II tra...    225   4e-66   Camelina sativa [gold-of-pleasure]
ref|XP_009102505.1|  PREDICTED: mediator of RNA polymerase II tra...    225   5e-66   
ref|XP_009392825.1|  PREDICTED: luminal-binding protein 2               224   6e-66   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010934830.1|  PREDICTED: luminal-binding protein 4               224   9e-66   Elaeis guineensis
gb|AAZ95244.1|  putative luminal-binding protein                        224   9e-66   Isatis tinctoria [woad]
ref|XP_009418642.1|  PREDICTED: luminal-binding protein 2-like          223   2e-65   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003573226.1|  PREDICTED: luminal-binding protein 3               223   2e-65   Brachypodium distachyon [annual false brome]
emb|CDY46766.1|  BnaA03g17100D                                          222   3e-65   Brassica napus [oilseed rape]
emb|CDX79726.1|  BnaC03g20620D                                          222   4e-65   
ref|XP_002317789.2|  BiP isoform A family protein                       222   5e-65   Populus trichocarpa [western balsam poplar]
gb|KDO76629.1|  hypothetical protein CISIN_1g0059551mg                  221   6e-65   Citrus sinensis [apfelsine]
emb|CDY23972.1|  BnaC03g17190D                                          221   7e-65   Brassica napus [oilseed rape]
ref|NP_198206.1|  Luminal-binding protein 1                             222   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009132761.1|  PREDICTED: mediator of RNA polymerase II tra...    222   7e-65   Brassica rapa
dbj|BAA13947.1|  luminal binding protein                                222   7e-65   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001234941.1|  BiP isoform A                                      221   2e-64   
ref|XP_010545034.1|  PREDICTED: luminal-binding protein 4               220   3e-64   Tarenaya hassleriana [spider flower]
gb|KEH21282.1|  heat shock cognate 70 kDa-like protein                  219   1e-63   Medicago truncatula
ref|NP_001238736.1|  BiP isoform B precursor                            217   4e-63   
emb|CDX67525.1|  BnaA07g15650D                                          214   9e-63   
gb|AAA62325.1|  HSP70                                                   215   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
dbj|BAJ85675.1|  predicted protein                                      216   1e-62   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|AGN94841.1|  ER molecular chaperone                                  216   1e-62   Triticum aestivum [Canadian hard winter wheat]
gb|EMT16454.1|  Luminal-binding protein 4                               216   1e-62   
emb|CAA89834.2|  luminal binding protein                                216   2e-62   Pseudotsuga menziesii
gb|EMS58484.1|  Luminal-binding protein 3                               216   2e-62   Triticum urartu
gb|ABR18447.1|  unknown                                                 215   4e-62   Picea sitchensis
gb|KFK32977.1|  hypothetical protein AALP_AA6G313600                    214   5e-62   Arabis alpina [alpine rockcress]
ref|XP_001774724.1|  predicted protein                                  213   2e-61   
gb|KHG03675.1|  Luminal-binding 5                                       211   5e-61   Gossypium arboreum [tree cotton]
ref|XP_009125214.1|  PREDICTED: mediator of RNA polymerase II tra...    211   9e-61   Brassica rapa
ref|XP_006838409.1|  hypothetical protein AMTR_s00002p00096860          211   1e-60   Amborella trichopoda
ref|XP_006405378.1|  hypothetical protein EUTSA_v10028192mg             201   3e-59   
ref|XP_001780840.1|  predicted protein                                  206   3e-59   
ref|XP_010259649.1|  PREDICTED: luminal-binding protein 4-like          204   2e-58   Nelumbo nucifera [Indian lotus]
emb|CDP15491.1|  unnamed protein product                                204   2e-58   Coffea canephora [robusta coffee]
ref|NP_001290009.1|  mediator of RNA polymerase II transcription ...    202   9e-58   Vitis vinifera
ref|XP_006433401.1|  hypothetical protein CICLE_v10000531mg             202   2e-57   Citrus clementina [clementine]
emb|CDP21572.1|  unnamed protein product                                193   2e-57   Coffea canephora [robusta coffee]
ref|XP_002969949.1|  hypothetical protein SELMODRAFT_440900             201   2e-57   Selaginella moellendorffii
emb|CDY13371.1|  BnaC06g13860D                                          201   2e-57   Brassica napus [oilseed rape]
emb|CBI39503.3|  unnamed protein product                                199   4e-57   Vitis vinifera
ref|XP_006479343.1|  PREDICTED: luminal-binding protein 5-like          201   4e-57   Citrus sinensis [apfelsine]
ref|NP_172382.4|  protein BIP3                                          201   5e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002892480.1|  hypothetical protein ARALYDRAFT_311954             200   5e-57   
ref|XP_002981419.1|  hypothetical protein SELMODRAFT_444846             200   7e-57   Selaginella moellendorffii
ref|XP_010659633.1|  PREDICTED: mediator of RNA polymerase II tra...    200   9e-57   
ref|XP_006306953.1|  hypothetical protein CARUB_v10008520mg             200   1e-56   Capsella rubella
gb|AFC88846.1|  putative luminal binding protein 7B4                    200   1e-56   Tetragonia tetragonioides
ref|XP_010458176.1|  PREDICTED: probable mediator of RNA polymera...    200   1e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010458175.1|  PREDICTED: probable mediator of RNA polymera...    199   1e-56   
ref|XP_010475732.1|  PREDICTED: probable mediator of RNA polymera...    199   2e-56   Camelina sativa [gold-of-pleasure]
ref|XP_006423175.1|  hypothetical protein CICLE_v10027975mg             199   2e-56   
ref|XP_006423179.1|  hypothetical protein CICLE_v10030400mg             198   3e-56   
ref|XP_010674036.1|  PREDICTED: luminal-binding protein 5               198   3e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|NP_001184944.1|  protein BIP3                                       198   4e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010475731.1|  PREDICTED: probable mediator of RNA polymera...    197   7e-56   Camelina sativa [gold-of-pleasure]
gb|AAB70400.1|  Similar to Arabidopsis luminal binding protein (g...    197   8e-56   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010108159.1|  Luminal-binding protein 5                          196   1e-55   
gb|KFK43208.1|  hypothetical protein AALP_AA1G094300                    196   2e-55   Arabis alpina [alpine rockcress]
ref|XP_009118328.1|  PREDICTED: probable mediator of RNA polymera...    195   4e-55   Brassica rapa
ref|XP_011092383.1|  PREDICTED: luminal-binding protein 5-like          195   5e-55   Sesamum indicum [beniseed]
ref|XP_008388543.1|  PREDICTED: luminal-binding protein 5-like          195   5e-55   
ref|XP_010027237.1|  PREDICTED: luminal-binding protein 5-like          195   5e-55   
emb|CDY06347.1|  BnaA09g48560D                                          194   7e-55   
gb|KDO56235.1|  hypothetical protein CISIN_1g006194mg                   194   7e-55   Citrus sinensis [apfelsine]
emb|CAC37635.1|  luminal binding protein, BiP                           194   9e-55   Scherffelia dubia
ref|XP_010041040.1|  PREDICTED: luminal-binding protein 5-like          194   1e-54   Eucalyptus grandis [rose gum]
gb|KFK43207.1|  hypothetical protein AALP_AA1G094300                    194   1e-54   Arabis alpina [alpine rockcress]
ref|XP_007030985.1|  Heat shock protein 70 (Hsp 70) family protein      194   1e-54   
gb|KJB81015.1|  hypothetical protein B456_013G125300                    194   1e-54   Gossypium raimondii
gb|KDP23486.1|  hypothetical protein JCGZ_23319                         194   1e-54   Jatropha curcas
ref|XP_006417615.1|  hypothetical protein EUTSA_v10009566mg             194   1e-54   Eutrema salsugineum [saltwater cress]
emb|CDY22648.1|  BnaC08g42820D                                          192   2e-54   Brassica napus [oilseed rape]
gb|KCW61819.1|  hypothetical protein EUGRSUZ_H04513                     192   3e-54   Eucalyptus grandis [rose gum]
emb|CDP15493.1|  unnamed protein product                                191   4e-54   Coffea canephora [robusta coffee]
ref|XP_010266633.1|  PREDICTED: luminal-binding protein 5-like          179   4e-54   Nelumbo nucifera [Indian lotus]
ref|XP_006423186.1|  hypothetical protein CICLE_v10030032mg             192   4e-54   
ref|XP_011088129.1|  PREDICTED: luminal-binding protein 5-like          192   5e-54   Sesamum indicum [beniseed]
ref|XP_007206318.1|  hypothetical protein PRUPE_ppa002572mg             191   9e-54   
ref|XP_004302398.1|  PREDICTED: luminal-binding protein 4               191   1e-53   Fragaria vesca subsp. vesca
ref|XP_006480058.1|  PREDICTED: luminal-binding protein 5-like          191   2e-53   
ref|XP_008246412.1|  PREDICTED: luminal-binding protein 5               190   3e-53   Prunus mume [ume]
ref|XP_011092073.1|  PREDICTED: luminal-binding protein 5-like          189   5e-53   Sesamum indicum [beniseed]
emb|CDP16233.1|  unnamed protein product                                188   8e-53   Coffea canephora [robusta coffee]
ref|XP_002318993.2|  heat shock protein 70 cognate                      189   9e-53   
gb|KIY96078.1|  heat shock 70kDa protein 5                              184   1e-52   Monoraphidium neglectum
ref|XP_011023674.1|  PREDICTED: luminal-binding protein 4-like          187   3e-52   Populus euphratica
dbj|BAA76421.1|  dnaK-type molecular chaperone                          173   5e-52   Cicer arietinum [garbanzo]
ref|XP_009766974.1|  PREDICTED: luminal-binding protein 5-like          186   1e-51   Nicotiana sylvestris
ref|XP_009622355.1|  PREDICTED: mediator of RNA polymerase II tra...    186   1e-51   Nicotiana tomentosiformis
ref|XP_005842772.1|  hypothetical protein CHLNCDRAFT_144025             179   1e-51   Chlorella variabilis
emb|CDP16834.1|  unnamed protein product                                184   2e-51   Coffea canephora [robusta coffee]
ref|XP_007509232.1|  heat shock protein 70                              177   3e-51   Bathycoccus prasinos
ref|XP_006344666.1|  PREDICTED: mediator of RNA polymerase II tra...    184   4e-51   Solanum tuberosum [potatoes]
gb|EYU18532.1|  hypothetical protein MIMGU_mgv1a022234mg                183   7e-51   Erythranthe guttata [common monkey flower]
ref|XP_010553728.1|  PREDICTED: LOW QUALITY PROTEIN: probable med...    183   1e-50   
ref|XP_003055985.1|  luminal binding heat shock protein 70              182   2e-50   Micromonas pusilla CCMP1545
ref|XP_006472126.1|  PREDICTED: probable mediator of RNA polymera...    179   6e-50   Citrus sinensis [apfelsine]
ref|XP_002507118.1|  heat shock binding protein 70, ER luminal          181   6e-50   Micromonas commoda
gb|EAY91599.1|  hypothetical protein OsI_13234                          177   6e-50   Oryza sativa Indica Group [Indian rice]
ref|XP_006472125.1|  PREDICTED: probable mediator of RNA polymera...    177   8e-50   
ref|XP_006472128.1|  PREDICTED: probable mediator of RNA polymera...    167   1e-49   
ref|XP_001701685.1|  binding protein 1                                  180   1e-49   Chlamydomonas reinhardtii
gb|EEC79268.1|  hypothetical protein OsI_20053                          177   1e-49   Oryza sativa Indica Group [Indian rice]
ref|XP_002949576.1|  luminal binding protein Bip1                       180   1e-49   Volvox carteri f. nagariensis
ref|XP_005651681.1|  binding protein 1                                  179   3e-49   Coccomyxa subellipsoidea C-169
ref|XP_004230233.1|  PREDICTED: mediator of RNA polymerase II tra...    179   4e-49   Solanum lycopersicum
ref|XP_006650483.1|  PREDICTED: luminal-binding protein 4-like          178   5e-49   Oryza brachyantha
dbj|BAJ89190.1|  predicted protein                                      178   8e-49   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001051048.1|  Os03g0710500                                       178   8e-49   
gb|EEE59790.1|  hypothetical protein OsJ_12307                          178   1e-48   Oryza sativa Japonica Group [Japonica rice]
gb|KDD73887.1|  heat shock protein 70 Hsp70                             177   1e-48   Helicosporidium sp. ATCC 50920
ref|NP_001055613.1|  Os05g0428600                                       177   2e-48   
emb|CCO34015.1|  78 kDa glucose-regulated protein homolog Short=G...    166   3e-48   Rhizoctonia solani AG-1 IB
ref|XP_011127440.1|  hypothetical protein AOL_s00210g337                176   3e-48   Arthrobotrys oligospora ATCC 24927
ref|XP_001701884.1|  binding protein 2                                  176   3e-48   Chlamydomonas reinhardtii
ref|XP_002466589.1|  hypothetical protein SORBIDRAFT_01g010460          176   4e-48   Sorghum bicolor [broomcorn]
ref|XP_004351156.1|  heat shock protein Hsp70 family protein            179   5e-48   Cavenderia fasciculata
ref|XP_002971962.1|  hypothetical protein SELMODRAFT_412732             176   5e-48   
ref|XP_002977324.1|  hypothetical protein SELMODRAFT_417280             176   5e-48   
ref|XP_004986284.1|  PREDICTED: luminal-binding protein 4-like          176   6e-48   Setaria italica
gb|EEC83049.1|  hypothetical protein OsI_28153                          174   8e-48   Oryza sativa Indica Group [Indian rice]
gb|AER57864.1|  heat shock 70 family protein                            175   9e-48   Acytostelium subglobosum
ref|XP_001416181.1|  Luminal binding protein precursor, probable        175   1e-47   Ostreococcus lucimarinus CCE9901
gb|EIE87053.1|  heat shock 70 kDa protein                               167   1e-47   Rhizopus delemar RA 99-880
gb|ELU38685.1|  HSP70 domain-containing protein                         164   1e-47   Rhizoctonia solani AG-1 IA
gb|EWC46399.1|  glucose-regulated-like protein                          175   1e-47   Drechslerella stenobrocha 248
ref|XP_011112275.1|  hypothetical protein H072_6484                     174   1e-47   
ref|XP_749594.1|  Hsp70 chaperone BiP/Kar2                              174   1e-47   Aspergillus fumigatus Af293
ref|XP_004964075.1|  PREDICTED: luminal-binding protein 3-like          174   2e-47   Setaria italica
ref|XP_002787362.1|  heat shock protein,, putative                      168   2e-47   Perkinsus marinus ATCC 50983
ref|XP_001215218.1|  78 kDa glucose-regulated protein precursor         174   2e-47   Aspergillus terreus NIH2624
ref|XP_003283993.1|  hypothetical protein DICPUDRAFT_52641              174   2e-47   Dictyostelium purpureum
emb|CEI96781.1|  Putative Hsp70-like protein                            174   2e-47   Rhizopus microsporus
ref|XP_002519994.1|  heat shock protein, putative                       171   2e-47   
ref|XP_643155.1|  heat shock protein Hsp70 family protein               174   2e-47   Dictyostelium discoideum AX4
ref|XP_004971898.1|  PREDICTED: luminal-binding protein 3-like          174   2e-47   
emb|CAA78035.1|  BiP                                                    161   2e-47   Solanum tuberosum [potatoes]
ref|NP_001061194.1|  Os08g0197700                                       174   3e-47   
ref|XP_004971892.1|  PREDICTED: luminal-binding protein 3-like          174   3e-47   
dbj|BAK06498.1|  predicted protein                                      174   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006644572.1|  PREDICTED: luminal-binding protein 5-like          174   3e-47   Oryza brachyantha
ref|XP_007865808.1|  heat shock protein 70                              173   3e-47   Gloeophyllum trabeum ATCC 11539
ref|XP_002977325.1|  hypothetical protein SELMODRAFT_12397              169   3e-47   
emb|CEG66501.1|  Putative 70 kDa heat shock protein 3                   173   5e-47   Rhizopus microsporus
dbj|BAC67670.1|  Heat shock 70 kDa protein                              173   5e-47   Cyanidioschyzon merolae strain 10D
ref|XP_005829514.1|  heat shock protein 70, ER luminal                  172   6e-47   Guillardia theta CCMP2712
ref|XP_005539525.1|  luminal binding protein BiP                        172   6e-47   Cyanidioschyzon merolae strain 10D
ref|XP_008644508.1|  PREDICTED: luminal-binding protein 5-like is...    172   6e-47   Zea mays [maize]
emb|CEG00952.1|  Heat shock protein 70 family                           172   6e-47   Ostreococcus tauri
ref|XP_003074861.1|  Bip Luminal binding protein precursor, proba...    172   7e-47   
ref|XP_008644507.1|  PREDICTED: luminal-binding protein 5-like is...    172   8e-47   Zea mays [maize]
gb|EPS34018.1|  putative Hsp70 molecular chaperone                      172   9e-47   Penicillium oxalicum 114-2
gb|KGB79179.1|  glucose-regulated protein                               164   1e-46   Cryptococcus gattii VGII R265
ref|XP_006655245.1|  PREDICTED: luminal-binding protein 4-like          172   1e-46   Oryza brachyantha
ref|XP_001394413.1|  glucose-regulated protein                          172   1e-46   Aspergillus niger CBS 513.88
pir||T43716  dnaK-type molecular chaperone BiP [imported] - Asper...    172   1e-46
gb|EPB86036.1|  glucose-regulated protein                               172   1e-46   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_006433443.1|  hypothetical protein CICLE_v10003511mg             170   1e-46   
ref|XP_001272734.1|  ER Hsp70 chaperone BiP, putative                   171   2e-46   
ref|XP_003065938.1|  Chaperone protein BipA, putative                   171   2e-46   
ref|XP_001247458.1|  78 kDa glucose-regulated protein homolog pre...    171   2e-46   
gb|KIH94177.1|  heat shock 70kDa protein 5                              171   2e-46   
gb|ERS99131.1|  chaperone DnaK                                          171   2e-46   
dbj|GAN05474.1|  78 kDa glucose-regulated protein precursor             171   2e-46   
emb|CDO70407.1|  hypothetical protein BN946_scf184999.g48               174   2e-46   
ref|XP_002456746.1|  hypothetical protein SORBIDRAFT_03g041830          171   3e-46   
ref|XP_003709308.1|  glucose-regulated protein                          171   3e-46   
gb|KIW74076.1|  chaperone DnaK                                          171   3e-46   
gb|ABS87375.1|  Hsp70                                                   171   3e-46   
ref|XP_001260092.1|  ER Hsp70 chaperone BiP, putative                   171   3e-46   
ref|XP_008731153.1|  chaperone DnaK                                     171   3e-46   
ref|XP_009854462.1|  hypothetical protein NEUTE1DRAFT_69229             171   3e-46   
ref|XP_007761842.1|  glucose-regulated protein                          171   3e-46   
ref|XP_002949720.1|  luminal binding protein Bip2                       172   4e-46   
ref|XP_956567.1|  glucose-regulated protein                             170   4e-46   
ref|XP_002541644.1|  heat shock protein 70                              170   5e-46   
ref|XP_006694812.1|  hypothetical protein CTHT_0044200                  170   5e-46   
gb|KFH42267.1|  78 kDa glucose-regulated protein-like protein           170   6e-46   
ref|XP_005718499.1|  unnamed protein product                            169   7e-46   
ref|XP_003565461.1|  PREDICTED: luminal-binding protein 2-like          169   8e-46   
gb|EIE83965.1|  heat shock 70 kDa protein                               169   1e-45   
ref|XP_006433439.1|  hypothetical protein CICLE_v10003341mg             167   1e-45   
gb|AER35070.1|  heat shock protein 70 family protein                    169   1e-45   
gb|AAM02971.2|AF421538_1  BiP                                           169   1e-45   
ref|XP_002766650.1|  heat shock protein,, putative                      168   2e-45   
gb|KIX96403.1|  hypothetical protein Z520_07669                         169   2e-45   
gb|KIW00545.1|  chaperone DnaK                                          168   2e-45   
emb|CCX16990.1|  Similar to 78 kDa glucose-regulated protein homo...    168   2e-45   
gb|KIY63740.1|  heat shock protein 70                                   168   2e-45   
ref|XP_002784650.1|  heat shock protein,, putative                      168   2e-45   
ref|XP_002771035.1|  heat shock protein, putative                       168   2e-45   
gb|ESA23479.1|  hypothetical protein GLOINDRAFT_342147                  168   2e-45   
gb|KIW22152.1|  chaperone DnaK                                          168   3e-45   
gb|KID92978.1|  78 Kda glucose-regulated protein                        168   3e-45   
ref|XP_002765541.1|  heat shock protein,, putative                      167   3e-45   
ref|XP_628228.1|  heat shock protein, Hsp70                             167   3e-45   
ref|XP_007746179.1|  glucose-regulated protein                          168   3e-45   
ref|XP_009529503.1|  hypothetical protein PHYSODRAFT_286376             167   4e-45   
ref|XP_007006435.1|  hypothetical protein TREMEDRAFT_45220              167   4e-45   
ref|XP_006675160.1|  hypothetical protein BATDEDRAFT_18227              167   4e-45   
ref|XP_001936937.1|  heat shock 70 kDa protein C precursor              167   4e-45   
ref|XP_445544.1|  hypothetical protein                                  167   4e-45   
ref|XP_001802699.1|  hypothetical protein SNOG_20135                    159   4e-45   
gb|AAW63770.1|  PPAT5                                                   167   5e-45   
ref|XP_003650370.1|  hypothetical protein THITE_2109740                 167   5e-45   
gb|AAW63769.1|  PPAT5                                                   167   5e-45   
gb|KIE03662.1|  78 Kda glucose-regulated protein                        167   5e-45   
gb|KIV83252.1|  chaperone DnaK                                          167   5e-45   
ref|XP_009216086.1|  glucose-regulated protein                          167   5e-45   
emb|CAA70214.1|  grp78 homologue                                        167   6e-45   
gb|KIW59179.1|  chaperone DnaK                                          167   6e-45   
gb|KEZ40303.1|  78 kDa glucose-regulated protein-like protein           167   6e-45   
gb|EDZ71254.1|  YJL034Wp-like protein                                   159   6e-45   
gb|EKV06291.1|  hypothetical protein PDIP_80020                         167   6e-45   
ref|XP_008885842.1|  chaperonin protein BiP                             167   6e-45   
gb|KGO42968.1|  Heat shock protein 70 family                            167   7e-45   
emb|CEP62081.1|  LALA0S04e07338g1_1                                     167   7e-45   
ref|XP_009160633.1|  glucose-regulated protein                          167   7e-45   
emb|CDJ57867.1|  heat shock protein 70, putative                        167   7e-45   
emb|CDI83237.1|  heat shock protein 70, putative                        167   8e-45   
ref|XP_003344871.1|  hypothetical protein SMAC_06157                    166   8e-45   
ref|XP_002557888.1|  Pc12g10670                                         167   8e-45   
ref|XP_005720596.1|  PREDICTED: 78 kDa glucose-regulated protein-...    157   8e-45   
ref|XP_007920297.1|  hypothetical protein MYCFIDRAFT_70402              167   8e-45   
ref|XP_003664039.1|  glucose-regulated protein                          167   8e-45   
emb|CDS07402.1|  Putative Glucose-regulated protein                     166   9e-45   
gb|EMD35028.1|  hypothetical protein CERSUDRAFT_116540                  167   9e-45   
gb|KIW14426.1|  chaperone DnaK                                          167   9e-45   
emb|CDM34564.1|  Heat shock protein Hsp70                               166   9e-45   
ref|XP_002364404.1|  heat shock protein 70, putative                    166   9e-45   
ref|XP_010900735.1|  PREDICTED: heat shock 70 kDa protein-like          156   9e-45   
gb|KID77996.1|  78 Kda glucose-regulated protein                        166   9e-45   
gb|KFG85074.1|  78 Kda glucose-regulated protein                        166   1e-44   
emb|CEL58561.1|  78 kDa glucose-regulated protein homolog OS=Aspe...    166   1e-44   
ref|XP_003839696.1|  similar to 78 kDa glucose-regulated protein        166   1e-44   
ref|XP_007367087.1|  heat shock protein 70                              166   1e-44   
gb|EXV05765.1|  Hsp70 family protein                                    166   1e-44   
gb|KGO74743.1|  Heat shock protein 70 family                            166   1e-44   
ref|XP_007723370.1|  glucose-regulated protein                          166   1e-44   
emb|CCG83891.1|  protein of unknown function                            166   1e-44   
gb|EYE95244.1|  putative Hsp70 chaperone BiP/Kar2                       166   1e-44   
gb|KDB11386.1|  glucose-regulated protein                               166   1e-44   
emb|CBJ48460.1|  Molecular chaperones GRP78/BiP/KAR2, HSP70 super...    166   1e-44   
gb|KEQ87183.1|  dnaK-type molecular chaperone bipA                      166   1e-44   
ref|XP_010900734.1|  PREDICTED: heat shock 70 kDa protein-like          156   1e-44   
gb|KIW93367.1|  chaperone DnaK                                          166   1e-44   
ref|XP_002909118.1|  luminal-binding protein 3 precursor                166   1e-44   
ref|XP_002841363.1|  hypothetical protein                               166   1e-44   
emb|CDJ51855.1|  heat shock protein 70, putative                        166   1e-44   
gb|KHJ35398.1|  putative glucose-regulated protein                      166   2e-44   
gb|AFM45298.1|  heat shock protein 70II(B6)                             166   2e-44   
ref|XP_008901435.1|  luminal-binding protein                            166   2e-44   
ref|XP_001645496.1|  hypothetical protein Kpol_1004p11                  166   2e-44   
gb|KEQ98464.1|  hypothetical protein AUEXF2481DRAFT_46103               166   2e-44   
emb|CEI88073.1|  Putative Hsp71-like protein                            159   2e-44   
emb|CDH60531.1|  glucose-regulated protein                              166   2e-44   
gb|EHK48199.1|  molecular chaperone bip1                                165   2e-44   
gb|EKG12768.1|  Heat shock protein Hsp70                                165   2e-44   
dbj|BAA32524.1|  spermatid-specific heat shock protein 70               154   2e-44   
dbj|BAJ93696.1|  predicted protein                                      165   2e-44   
emb|CEF63370.1|  Heat shock cognate 71 kDa protein                      165   3e-44   
ref|XP_007809001.1|  glucose-regulated protein                          165   3e-44   
emb|CCE27207.1|  probable glucose-regulated protein 78 of hsp70 f...    168   3e-44   
gb|ESA04718.1|  hypothetical protein GLOINDRAFT_336076                  165   3e-44   
gb|KGQ04844.1|  78 kDa glucose-regulated protein                        165   3e-44   
ref|XP_008597224.1|  hsp70-like protein                                 165   3e-44   
ref|XP_002340735.1|  Hsp70 chaperone BiP/Kar2, putative                 165   4e-44   
gb|ESA16542.1|  hypothetical protein GLOINDRAFT_345509                  165   4e-44   
emb|CAA53369.1|  glucose regulated protein /BiP                         165   4e-44   
ref|XP_568651.1|  heat shock protein                                    165   4e-44   
gb|KEQ60096.1|  hsp70-like protein C                                    165   4e-44   
gb|KFA63583.1|  hypothetical protein S40285_04115                       164   4e-44   
ref|XP_008040622.1|  heat shock protein 70                              164   5e-44   
gb|KIJ28212.1|  hypothetical protein M422DRAFT_270532                   164   5e-44   
gb|EJU00625.1|  heat shock protein 70                                   164   5e-44   
ref|XP_003867956.1|  Ssa2 HSP70 chaperone                               156   5e-44   
ref|XP_003911998.1|  PREDICTED: 78 kDa glucose-regulated protein-...    155   5e-44   
ref|XP_007729844.1|  glucose-regulated protein                          164   5e-44   
gb|KIW41545.1|  chaperone DnaK                                          164   5e-44   
ref|XP_568652.1|  heat shock protein                                    165   6e-44   
ref|XP_003301555.1|  hypothetical protein PTT_13087                     164   6e-44   
emb|CDK27679.1|  unnamed protein product                                164   6e-44   
ref|XP_002109829.1|  hypothetical protein TRIADDRAFT_63625              164   6e-44   
ref|XP_010759507.1|  chaperone DnaK                                     164   6e-44   
gb|EEH38342.2|  hsp70-like protein                                      164   6e-44   
gb|EQL04043.1|  molecular chaperone bip1                                164   6e-44   
gb|KIR44580.1|  chaperone DnaK                                          164   6e-44   
emb|CEJ91198.1|  Putative Hsp70 chaperone BiP/Kar2                      164   6e-44   
ref|XP_007818331.1|  heat shock 70 kDa protein                          167   7e-44   
ref|XP_659666.1|  GR78_NEUCR 78 KDA GLUCOSE-REGULATED PROTEIN HOM...    164   7e-44   
ref|XP_002778105.1|  heat shock protein 70 precursor, putative          164   7e-44   
ref|XP_002491027.1|  ATPase involved in protein import into the E...    164   7e-44   
ref|XP_008024222.1|  hypothetical protein SETTUDRAFT_168574             164   7e-44   
ref|XP_003197568.1|  kar2 karyogamy protein                             164   8e-44   
gb|KIR84263.1|  chaperone DnaK                                          164   8e-44   
ref|XP_002783461.1|  heat shock protein 70 precursor, putative          164   8e-44   
gb|ELT89714.1|  hypothetical protein CAPTEDRAFT_18512                   164   8e-44   
gb|KIW62812.1|  chaperone DnaK                                          164   8e-44   
gb|KIX03950.1|  chaperone DnaK                                          164   8e-44   
ref|XP_007783507.1|  glucose-regulated protein                          164   8e-44   
ref|XP_007700252.1|  hypothetical protein COCSADRAFT_325751             164   9e-44   
gb|EKC33663.1|  78 kDa glucose-regulated protein                        164   9e-44   
gb|KIR53091.1|  glucose-regulated protein                               164   9e-44   
ref|XP_011506343.1|  PREDICTED: heat shock 70 kDa protein cognate...    164   9e-44   
emb|CEF64352.1|  Heat shock cognate 71 kDa protein                      164   9e-44   
gb|EUC60696.1|  heat shock Hsp70 protein                                164   9e-44   
gb|KEP49386.1|  heat shock Hsp70 protein                                164   9e-44   
ref|XP_007580014.1|  putative hsp70 chaperone protein                   164   1e-43   
ref|XP_005828584.1|  heat shock protein 70, ER luminal                  164   1e-43   
ref|XP_002288567.1|  heat shock protein/chaperone                       163   1e-43   
ref|XP_001819466.1|  glucose-regulated protein                          164   1e-43   
ref|NP_001292291.1|  78 kDa glucose-regulated protein precursor         164   1e-43   
ref|XP_005838018.1|  heat shock protein 70                              163   1e-43   
ref|XP_008858894.1|  heat shock protein70, hsp70A2, putative            156   1e-43   
ref|XP_009172848.1|  hypothetical protein T265_08704                    163   1e-43   
gb|KFH67887.1|  glucose-regulated protein                               163   1e-43   
gb|AAO44919.1|  Hsp70                                                   152   1e-43   
gb|KFX53237.1|  78 kDa glucose-regulated protein like                   163   1e-43   
ref|XP_002144745.1|  Hsp70 chaperone BiP/Kar2, putative                 163   1e-43   
ref|XP_007718250.1|  hypothetical protein COCCADRAFT_111670             163   1e-43   
gb|AET97609.1|  heat shock protein 70b                                  163   1e-43   
ref|XP_007800275.1|  glucose-regulated protein                          163   1e-43   
ref|XP_011402247.1|  Luminal-binding protein 5                          163   1e-43   
gb|KIK59750.1|  hypothetical protein GYMLUDRAFT_261751                  163   1e-43   
ref|XP_003046172.1|  predicted protein                                  163   1e-43   
ref|XP_011506344.1|  PREDICTED: heat shock 70 kDa protein cognate...    165   1e-43   
gb|EEH05682.1|  dnaK-type molecular chaperone bipA                      163   1e-43   
ref|XP_011277258.1|  putative heat shock protein                        163   1e-43   
gb|AAN15207.1|  heat shock protein 70-C                                 163   1e-43   
gb|KIW68420.1|  hsp72-like protein                                      163   1e-43   
emb|CDJ37887.1|  heat shock protein 70, putative                        163   1e-43   
ref|XP_003857319.1|  immunoglobulin heavy chain-binding protein, ...    163   2e-43   
gb|EPQ62600.1|  hypothetical protein BGT96224_ASP20649                  162   2e-43   
gb|EGC49409.1|  DnaK-type molecular chaperone bipA                      163   2e-43   
emb|CDJ62290.1|  heat shock protein 70, putative                        163   2e-43   
ref|XP_007293040.1|  dnaK-type molecular chaperone BiP                  163   2e-43   
ref|XP_011340123.1|  PREDICTED: heat shock 70 kDa protein cognate 3     163   2e-43   
gb|EMF17790.1|  Hsp70 chaperone BiP/Kar2                                163   2e-43   
ref|XP_005707456.1|  molecular chaperone DnaK                           163   2e-43   
gb|KIV91842.1|  chaperone DnaK                                          163   2e-43   
ref|XP_003885152.1|  Heat shock protein 70 (Precursor), related         163   2e-43   
ref|XP_001738250.1|  Luminal-binding protein 5 precursor                163   2e-43   
gb|EAY97768.1|  hypothetical protein OsI_19680                          160   2e-43   
ref|XP_006967237.1|  predicted protein                                  163   2e-43   
emb|CAA91253.1|  immunoglobulin heavy chain binding protein             163   2e-43   
ref|XP_001557140.1|  dnaK-type molecular chaperone BiP                  163   2e-43   
gb|EWM22457.1|  luminal binding protein                                 163   2e-43   
gb|KEF54489.1|  glucose-regulated protein                               163   2e-43   
ref|XP_001538200.1|  heat shock 70 kDa protein C precursor              162   2e-43   
ref|XP_009376693.1|  PREDICTED: LOW QUALITY PROTEIN: mediator of ...    162   2e-43   
gb|KDN61547.1|  putative hsp70-like protein                             162   2e-43   
gb|AFR98682.1|  glucose-regulated protein                               162   2e-43   
ref|XP_003035220.1|  heat shock protein HSS1                            162   2e-43   
gb|AAC15519.1|  heat shock protein 70                                   162   2e-43   
ref|XP_002670962.1|  hypothetical protein NAEGRDRAFT_83309              162   3e-43   
gb|KEQ74561.1|  immunoglobulin heavy chain-binding protein, KAR2        162   3e-43   
gb|KFY50117.1|  hypothetical protein V496_09590                         162   3e-43   
dbj|GAM83592.1|  hypothetical protein ANO11243_015800                   162   3e-43   
gb|ESU45671.1|  Zinc finger, C3HC4 type                                 156   3e-43   
gb|EFQ35485.1|  hsp70-like protein                                      162   3e-43   
gb|EMD88626.1|  hypothetical protein COCHEDRAFT_1181793                 162   3e-43   
ref|XP_002622883.1|  heat shock protein cognate 4                       162   3e-43   
gb|KIW29193.1|  hsp72-like protein                                      162   3e-43   
pdb|3QFU|A  Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) C...    159   3e-43   
gb|KIX99487.1|  hsp72-like protein                                      162   3e-43   
ref|XP_003848822.1|  Hsp70 family protein                               162   3e-43   
ref|XP_007745771.1|  hsp70-like protein                                 162   3e-43   
pdb|3QFP|A  Chain A, Crystal Structure Of Yeast Hsp70 (BipKAR2) A...    159   3e-43   
ref|XP_006611645.1|  PREDICTED: heat shock 70 kDa protein cognate...    162   3e-43   
gb|KIW92659.1|  hsp72-like protein                                      162   3e-43   
gb|KII84135.1|  hypothetical protein PLICRDRAFT_46498                   162   3e-43   
ref|XP_009029847.1|  hypothetical protein HELRODRAFT_104028             162   3e-43   
gb|KEQ77054.1|  heat shock 70 kDa protein                               162   3e-43   
gb|KFY84614.1|  hypothetical protein V500_09149                         162   3e-43   
ref|XP_005833237.1|  heat shock protein 70                              162   4e-43   
gb|KFZ13343.1|  hypothetical protein V502_06672                         162   4e-43   
ref|XP_005833236.1|  heat shock protein 70                              162   4e-43   
gb|KIW79560.1|  hsp72-like protein                                      162   4e-43   



>ref|XP_009788736.1| PREDICTED: luminal-binding protein 4 [Nicotiana sylvestris]
Length=667

 Score =   261 bits (668),  Expect = 8e-80, Method: Compositional matrix adjust.
 Identities = 126/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAGGAW RRTS I+FGIV+ G LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>sp|Q03684.1|BIP4_TOBAC RecName: Full=Luminal-binding protein 4; Short=BiP 4; AltName: 
Full=78 kDa glucose-regulated protein homolog 4; Short=GRP-78-4; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42659.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=667

 Score =   261 bits (667),  Expect = 1e-79, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 131/141 (93%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAGGAW RRTS I+FGIV+ G LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRTSLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTD ERLIGEAAKNLAA  PERT+FDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTVFDVKRLIGRKFDDKEVQRDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>gb|ACK55195.1| ER luminal-binding protein [Nicotiana benthamiana]
Length=667

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAGGAW RR S I+FGIV+ G LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>ref|XP_009588550.1| PREDICTED: luminal-binding protein 4 [Nicotiana tomentosiformis]
Length=667

 Score =   259 bits (663),  Expect = 4e-79, Method: Compositional matrix adjust.
 Identities = 125/141 (89%), Positives = 130/141 (92%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAGGAW RR S I+FGIV+ G LFAFSIA EEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGAWNRRASLIVFGIVLFGCLFAFSIATEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  61   IIANDQGNRITPSWVAFTDGERLIGEAAKNLAAVNPERTIFDVKRLIGRKFDDKEVQRDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>ref|XP_011075955.1| PREDICTED: luminal-binding protein 5 [Sesamum indicum]
Length=665

 Score =   253 bits (647),  Expect = 1e-76, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 130/138 (94%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAWK R S+++FGIV+IGSLFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKTRVSTVVFGIVLIGSLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD+ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYI+VKIK
Sbjct  123  PYKIVNKDGKPYIEVKIK  140



>ref|XP_006350519.1| PREDICTED: luminal-binding protein 5-like [Solanum tuberosum]
Length=668

 Score =   252 bits (643),  Expect = 4e-76, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 128/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A KRR SSI+F IV++GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALKRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVN+DGKPYIQVKIK
Sbjct  124  YKIVNRDGKPYIQVKIK  140



>ref|XP_004234985.1| PREDICTED: luminal-binding protein 5 [Solanum lycopersicum]
Length=668

 Score =   250 bits (639),  Expect = 1e-75, Method: Compositional matrix adjust.
 Identities = 121/137 (88%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A  RR SSI+F IV++GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    ALTRRASSIVFAIVLLGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_009592769.1| PREDICTED: luminal-binding protein 5 [Nicotiana tomentosiformis]
Length=668

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAWKRR S I+F I++ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAILLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDRKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PY+IVNKDGKPYIQVKIK
Sbjct  123  PYEIVNKDGKPYIQVKIK  140



>ref|XP_009773333.1| PREDICTED: luminal-binding protein 5 [Nicotiana sylvestris]
 sp|Q03685.1|BIP5_TOBAC RecName: Full=Luminal-binding protein 5; Short=BiP 5; AltName: 
Full=78 kDa glucose-regulated protein homolog 5; Short=GRP-78-5; 
Flags: Precursor [Nicotiana tabacum]
 emb|CAA42660.1| luminal binding protein (BiP) [Nicotiana tabacum]
Length=668

 Score =   250 bits (638),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/138 (88%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAWKRR S I+F IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWKRRASLIVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD ERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRD KLV
Sbjct  63   NDQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDKKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PY+IVNKDGKPYIQVKIK
Sbjct  123  PYEIVNKDGKPYIQVKIK  140



>ref|XP_009396163.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   249 bits (637),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 121/139 (87%), Positives = 128/139 (92%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
            G + + R S IL G++V GSLFAFS+AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    GSSSRNRGSMILLGLLVAGSLFAFSVAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  62   ANDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  122  VPYKIVNKDGKPYIQVKIK  140



>emb|CDP05035.1| unnamed protein product [Coffea canephora]
Length=665

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW RR S I+FGI+  GS FAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWARRASLIVFGILFFGSFFAFSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYI+VKIK
Sbjct  123  PYKIVNKDGKPYIEVKIK  140



>gb|AGS42239.1| ER luminal-binding protein [Capsicum annuum]
Length=668

 Score =   247 bits (631),  Expect = 2e-74, Method: Compositional matrix adjust.
 Identities = 119/137 (87%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            AWK R S  +F IV+ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    AWKTRASLTVFAIVLFGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD ERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVK+K
Sbjct  124  YKIVNKDGKPYIQVKVK  140



>sp|Q42434.1|BIP_SPIOL RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Spinacia oleracea]
 gb|AAA21808.1| ER-lumenal protein [Spinacia oleracea]
 gb|AAA21806.1| ER-lumenal protein [Spinacia oleracea]
Length=668

 Score =   246 bits (629),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 127/137 (93%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            AWK R SSI FGIV++GSLFAF  AK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIAN
Sbjct  4    AWKSRASSIAFGIVLLGSLFAFVSAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFT+ ERLIGEAAKN AA+ PERTIFDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVN+DGKPYIQVK++
Sbjct  124  YKIVNRDGKPYIQVKVQ  140



>ref|XP_011084527.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=665

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GA KRR SS + GIV++G LFAFSIAKEEA+K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GARKRRASSTVLGIVLLGCLFAFSIAKEEAAKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYI+VKIK
Sbjct  123  PYKIVNKDGKPYIEVKIK  140



>gb|EYU19660.1| hypothetical protein MIMGU_mgv1a002500mg [Erythranthe guttata]
Length=666

 Score =   246 bits (628),  Expect = 6e-74, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 127/138 (92%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GA KRR SSI+FGIV+IGSLFAF+IAKEEA K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GALKRRESSIVFGIVLIGSLFAFAIAKEEAPKIGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVN+DGKPYI+VKIK
Sbjct  123  PFKIVNRDGKPYIEVKIK  140



>gb|KHM99873.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   244 bits (622),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 120/139 (86%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  60

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  61   ANDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  120

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  121  VPYKIVNKDGKPYIQVKIK  139



>gb|AJF19166.1| endoplasmic reticulum chaperone binding protein [Lycium chinense]
Length=664

 Score =   243 bits (621),  Expect = 6e-73, Method: Compositional matrix adjust.
 Identities = 122/141 (87%), Positives = 125/141 (89%), Gaps = 4/141 (3%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAGGA KR  S I    V+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MAGGALKRSASLI----VLFGCLFALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  56

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDM
Sbjct  57   IIANDQGNRITPSWVAFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  116

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  117  KLVPYKIVNKDGKPYIQVKIK  137



>gb|AAK21920.1|AF338252_1 BiP-isoform D [Glycine max]
Length=495

 Score =   239 bits (610),  Expect = 8e-73, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 124/138 (90%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>gb|KJB39586.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=439

 Score =   237 bits (605),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>gb|KHN16716.1| Luminal-binding protein 5 [Glycine soja]
Length=726

 Score =   243 bits (621),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 122/143 (85%), Positives = 128/143 (90%), Gaps = 2/143 (1%)
 Frame = +3

Query  117  RAMAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQR  296
            RAMAG +W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  
Sbjct  58   RAMAG-SWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGH  115

Query  297  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQR  476
            VEIIANDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+
Sbjct  116  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQK  175

Query  477  DMKLVPYKIVNKDGKPYIQVKIK  545
            DMKLVPYKIVNKDGKPYIQVKIK
Sbjct  176  DMKLVPYKIVNKDGKPYIQVKIK  198



>gb|AAB86942.1| endoplasmic reticulum HSC70-cognate binding protein precursor 
[Glycine max]
Length=668

 Score =   242 bits (618),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 119/139 (86%), Positives = 125/139 (90%), Gaps = 1/139 (1%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  60

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            AN+QGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  61   ANNQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  120

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  121  VPYKIVNKDGKPYIQVKIK  139



>ref|XP_008390320.1| PREDICTED: luminal-binding protein 5 [Malus domestica]
 ref|XP_009344042.1| PREDICTED: luminal-binding protein 5 [Pyrus x bretschneideri]
Length=667

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R S I+  IV  G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAF+DSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVN+DGKPYIQV+IK
Sbjct  122  VPYKIVNRDGKPYIQVRIK  140



>gb|AAW55475.1| ER-binding protein [Malus pumila]
Length=667

 Score =   242 bits (617),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 125/139 (90%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R S I+  IV  G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRARGSLIVLAIVTFGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAF+DSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVN+DGKPYIQV+IK
Sbjct  122  VPYKIVNRDGKPYIQVRIK  140



>ref|XP_010266594.1| PREDICTED: luminal-binding protein 5 [Nelumbo nucifera]
Length=666

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 118/138 (86%), Positives = 125/138 (91%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G WK+R S I+ GIV+ G L AF+IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GVWKKRGSLIVLGIVLFGCLSAFAIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_009619852.1| PREDICTED: luminal-binding protein 4-like [Nicotiana tomentosiformis]
Length=666

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 124/141 (88%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            M GG W+R +S ++  IV+ G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>gb|EYU25251.1| hypothetical protein MIMGU_mgv1a002497mg [Erythranthe guttata]
Length=667

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 126/139 (91%), Gaps = 2/139 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
            AWKRR SSI+F  V+IGSLFAFSIA  +EEA K+GTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    AWKRRASSIIFAFVLIGSLFAFSIAAEEEEAPKVGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWV FTDSERLIGEAAKN  A  PERT+FDVKRLIGRKFEDKEVQ+DMKL
Sbjct  64   ANDQGNRITPSWVGFTDSERLIGEAAKNQFAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  123

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVN+DGKPYIQVKI+
Sbjct  124  VPYKIVNRDGKPYIQVKIR  142



>ref|XP_007211088.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
 gb|EMJ12287.1| hypothetical protein PRUPE_ppa002489mg [Prunus persica]
Length=667

 Score =   241 bits (616),  Expect = 3e-72, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>gb|KJB39579.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=526

 Score =   238 bits (606),  Expect = 5e-72, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_010671405.1| PREDICTED: luminal-binding protein [Beta vulgaris subsp. vulgaris]
Length=665

 Score =   240 bits (613),  Expect = 9e-72, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 127/138 (92%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW  R +SI+ GIV+ G+LFA +IAK+EA KLGTVIGIDLGTTYSCVGVYKD +VEIIA
Sbjct  3    GAWNSR-ASIVLGIVLCGTLFALTIAKDEAPKLGTVIGIDLGTTYSCVGVYKDGKVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFT+ ERLIGEAAKN AA+ PERT+FDVKRLIGRKFEDKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTNDERLIGEAAKNQAAANPERTVFDVKRLIGRKFEDKEVQRDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQV+++
Sbjct  122  PYKIVNKDGKPYIQVQVQ  139



>gb|AGT16055.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
 gb|AGT16312.1| luminal-binding protein 2 precursor [Saccharum hybrid cultivar 
R570]
Length=664

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>gb|AGT16206.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>gb|AGT15890.1| luminal-binding protein [Saccharum hybrid cultivar R570]
 gb|AGT16047.1| luminal-binding protein [Saccharum hybrid cultivar R570]
Length=663

 Score =   240 bits (612),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKII  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>ref|XP_003530453.1| PREDICTED: luminal-binding protein 5 [Glycine max]
Length=667

 Score =   239 bits (611),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 118/139 (85%), Positives = 124/139 (89%), Gaps = 1/139 (1%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  60

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKL
Sbjct  61   ANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKL  120

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  121  VPYKIVNKDGKPYIQVKIK  139



>gb|AAA99920.1| glucose-regulated protein 78, partial [Solanum lycopersicum]
Length=375

 Score =   232 bits (592),  Expect = 1e-71, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  141  KRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  320
            +R  S ++  IV++G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQ
Sbjct  6    RRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQ  65

Query  321  GNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYK  500
            GNRITPSWVAFTD+ERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYK
Sbjct  66   GNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYK  125

Query  501  IVNKDGKPYIQVKIK  545
            IV+KDGKPYIQVKIK
Sbjct  126  IVSKDGKPYIQVKIK  140



>ref|NP_001105894.1| luminal-binding protein 3 precursor [Zea mays]
 sp|O24581.1|BIP3_MAIZE RecName: Full=Luminal-binding protein 3; Short=BiP3; Flags: Precursor 
[Zea mays]
 gb|AAC49900.1| lumenal binding protein cBiPe3 [Zea mays]
Length=663

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>gb|ACF86491.1| unknown [Zea mays]
 gb|AFW66784.1| luminal-binding protein 3 Precursor [Zea mays]
Length=663

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 114/133 (86%), Positives = 122/133 (92%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI+
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYKII  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>ref|XP_008437399.1| PREDICTED: luminal-binding protein 5 [Cucumis melo]
Length=665

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|NP_001045675.1| Os02g0115900 [Oryza sativa Japonica Group]
 dbj|BAD07938.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAD07713.1| putative dnaK-type molecular chaperone BiP [Oryza sativa Japonica 
Group]
 dbj|BAF07589.1| Os02g0115900 [Oryza sativa Japonica Group]
 gb|EAY84196.1| hypothetical protein OsI_05577 [Oryza sativa Indica Group]
 gb|EAZ21491.1| hypothetical protein OsJ_05115 [Oryza sativa Japonica Group]
 gb|ACA50500.1| dnak-type molecular chaperone Bip [Oryza sativa Japonica Group]
Length=665

 Score =   239 bits (610),  Expect = 2e-71, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R  + L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  125  NKDGKPYIQVKIK  137



>emb|CAB72128.1| heat shock protein 70 [Cucumis sativus]
Length=665

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA  PERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_004143862.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 ref|XP_004169474.1| PREDICTED: luminal-binding protein 5-like [Cucumis sativus]
 gb|KGN50013.1| hypothetical protein Csa_5G149330 [Cucumis sativus]
Length=665

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLIVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA  PERT+FDVKRLIGRKF+DKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFDDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_002518865.1| heat shock protein, putative [Ricinus communis]
 gb|EEF43398.1| heat shock protein, putative [Ricinus communis]
Length=664

 Score =   239 bits (609),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R  +++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRAR-GAVVSAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>ref|XP_008337565.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=667

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R S ++  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAF+DSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVN+DGKPYIQV+IK
Sbjct  122  VPYKIVNRDGKPYIQVRIK  140



>emb|CAC14168.1| putative luminal binding protein [Corylus avellana]
Length=668

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S ++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>gb|KJB18908.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18912.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18914.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
 gb|KJB18916.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=423

 Score =   233 bits (593),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_002303672.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE78651.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   238 bits (608),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 116/138 (84%), Positives = 125/138 (91%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G W+ R  +++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRAR-GAVVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>gb|KJB18909.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=427

 Score =   233 bits (593),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>gb|KJB39584.1| hypothetical protein B456_007G020600 [Gossypium raimondii]
Length=667

 Score =   238 bits (608),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  122  VPYKIVNKDGKPYIQVKIK  140



>gb|KJB39580.1| hypothetical protein B456_007G020300 [Gossypium raimondii]
Length=667

 Score =   238 bits (607),  Expect = 5e-71, Method: Compositional matrix adjust.
 Identities = 115/139 (83%), Positives = 124/139 (89%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  122  VPYKIVNKDGKPYIQVKIK  140



>ref|NP_001105893.1| luminal-binding protein 2 precursor [Zea mays]
 ref|NP_001278725.1| NHP2-like protein 1 precursor [Zea mays]
 sp|P24067.3|BIP2_MAIZE RecName: Full=Luminal-binding protein 2; Short=BiP2; AltName: 
Full=B-70; Short=B70; AltName: Full=Heat shock protein 70 homolog 
2; Flags: Precursor [Zea mays]
 gb|AAC49899.1| lumenal binding protein cBiPe2 [Zea mays]
 gb|ACF86383.1| unknown [Zea mays]
 gb|AEW66883.1| ER luminal binding protein [Zea mays]
 gb|AFW69798.1| binding protein-like protein [Zea mays]
Length=663

 Score =   238 bits (607),  Expect = 6e-71, Method: Compositional matrix adjust.
 Identities = 114/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  141  KRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  320
            + R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQ
Sbjct  3    RARGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQ  62

Query  321  GNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYK  500
            GNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF DKEVQRDMKLVPYK
Sbjct  63   GNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYK  122

Query  501  IVNKDGKPYIQVKIK  545
            I+NKDGKPYIQVKIK
Sbjct  123  IINKDGKPYIQVKIK  137



>gb|KDP25255.1| hypothetical protein JCGZ_20411 [Jatropha curcas]
Length=665

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 117/139 (84%), Positives = 123/139 (88%), Gaps = 1/139 (1%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W+ R   ++  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGSWRAR-GLVVLAIVFFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  60

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  61   ANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  120

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  121  VPYKIVNKDGKPYIQVKIK  139



>ref|XP_009770477.1| PREDICTED: luminal-binding protein 4-like [Nicotiana sylvestris]
Length=666

 Score =   238 bits (607),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 122/141 (87%), Gaps = 0/141 (0%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            M GG W+R +S  +  IV+ G L A SIAKEEA+KL TVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MGGGYWRRSSSLAVLAIVLFGCLSALSIAKEEATKLRTVIGIDLGTTYSCVGVYKNGHVE  60

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWV FTD ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDM
Sbjct  61   IIANDQGNRITPSWVGFTDGERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDM  120

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYIQVKIK
Sbjct  121  KLVPYKIVNKDGKPYIQVKIK  141



>gb|AAA81953.1| BiP isoform C, partial [Glycine max]
Length=455

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W RR S I+  I+  G LFA SIAKEEA+KLGT+  IDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTLSAIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>gb|KJB18915.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=458

 Score =   233 bits (594),  Expect = 7e-71, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>gb|KHG04866.1| Luminal-binding 5 [Gossypium arboreum]
Length=733

 Score =   239 bits (609),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 118/142 (83%), Positives = 127/142 (89%), Gaps = 1/142 (1%)
 Frame = +3

Query  120  AMAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  299
            AMAG +W+ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  V
Sbjct  66   AMAG-SWRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHV  124

Query  300  EIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRD  479
            EIIANDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+D
Sbjct  125  EIIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKD  184

Query  480  MKLVPYKIVNKDGKPYIQVKIK  545
            MKLVPYKIVNKDGKPYIQVKIK
Sbjct  185  MKLVPYKIVNKDGKPYIQVKIK  206



>gb|KJB18910.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=482

 Score =   233 bits (594),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>gb|KJB24175.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=518

 Score =   234 bits (596),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+++ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_006439283.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
 gb|ESR52523.1| hypothetical protein CICLE_v10019184mg [Citrus clementina]
Length=667

 Score =   237 bits (605),  Expect = 1e-70, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S ++  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  P+RTIFDVKRLIGRKFEDKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLA  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVN+DGKPYIQV+I+
Sbjct  123  PYKIVNRDGKPYIQVQIR  140



>ref|XP_009358650.1| PREDICTED: luminal-binding protein 5-like [Pyrus x bretschneideri]
Length=667

 Score =   236 bits (603),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 123/137 (90%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+ R S ++  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRARGSLVVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAF+DSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFSDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVN+DGKPYIQV+IK
Sbjct  124  YKIVNRDGKPYIQVRIK  140



>gb|KJB18911.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=526

 Score =   233 bits (595),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_008239207.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=667

 Score =   236 bits (603),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/138 (83%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTD ERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVGFTDGERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>gb|KEH21274.1| heat shock 70 kDa protein [Medicago truncatula]
Length=668

 Score =   236 bits (602),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 115/141 (82%), Positives = 124/141 (88%), Gaps = 1/141 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            M  G+WKR  S  +  I+ IG LFA S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VE
Sbjct  1    MMAGSWKR-GSLFVLAIISIGCLFACSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVE  59

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWV+FTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDM
Sbjct  60   IIANDQGNRITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDM  119

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVN+DGKPYIQV++K
Sbjct  120  KLVPYKIVNRDGKPYIQVRVK  140



>gb|KJB18913.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=505

 Score =   232 bits (592),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_004952156.1| PREDICTED: luminal-binding protein 3-like [Setaria italica]
Length=665

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 121/133 (91%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRDMKLVPY IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDMKLVPYNIV  124

Query  507  NKDGKPYIQVKIK  545
            NK+GKPYIQVKIK
Sbjct  125  NKEGKPYIQVKIK  137



>ref|XP_008796727.1| PREDICTED: luminal-binding protein 5 [Phoenix dactylifera]
Length=664

 Score =   236 bits (601),  Expect = 4e-70, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            + +   S+IL GI++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SMRNSGSAILLGILLSGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRD+KLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFEDKEVQRDIKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKI+
Sbjct  124  YKIVNKDGKPYIQVKIR  140



>ref|XP_004503582.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   236 bits (601),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 117/138 (85%), Positives = 122/138 (88%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+WK   S  +  I+  G LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWKC-GSLFVLAIISFGCLFAISIAKEEGTKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>ref|XP_007040596.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY25097.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=665

 Score =   235 bits (599),  Expect = 9e-70, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+   S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRASGSLVVLAIVLSGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_006476337.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=667

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S ++  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLVVLAIVFFGGLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  P+RTIFDVKRLIGRKF+DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPDRTIFDVKRLIGRKFDDKEVQRDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVNKDGKPYIQV+I+
Sbjct  123  PFKIVNKDGKPYIQVQIR  140



>emb|CDP12195.1| unnamed protein product [Coffea canephora]
Length=664

 Score =   234 bits (598),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 116/137 (85%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+R  S I   IV  G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRSGSFIALAIVFFGCLSAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_006648229.1| PREDICTED: luminal-binding protein 2-like [Oryza brachyantha]
Length=665

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 112/133 (84%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R  + L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGCAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF DKEVQRDMKLVPY+IV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYQIV  124

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKI+
Sbjct  125  NKDGKPYIQVKIR  137



>gb|KDP35832.1| hypothetical protein JCGZ_10646 [Jatropha curcas]
Length=666

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
              A +R+ S I+  IV+ GSL A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AAALRRQASLIVLAIVLFGSLLAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKL
Sbjct  62   ANDQGNRITPSWVAFTDNERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKI+
Sbjct  122  VPYKIVNKDGKPYIQVKIR  140



>gb|KHG07305.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+++ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>emb|CBI23034.3| unnamed protein product [Vitis vinifera]
Length=648

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW  R SS++ GI+++G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERT+FDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVNKDGKPYIQVKIK
Sbjct  123  PFKIVNKDGKPYIQVKIK  140



>gb|KJB24174.1| hypothetical protein B456_004G131400 [Gossypium raimondii]
Length=666

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+++ R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSFRARGSLVVLAIVLSGCLFALSIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFQDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_006343810.1| PREDICTED: luminal-binding protein-like [Solanum tuberosum]
Length=667

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 123/139 (88%), Gaps = 0/139 (0%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G  +R  S ++  IV++G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  2    AGCLRRGNSLVVLTIVLLGCLSALSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  61

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTD+ERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  62   ANDQGNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKL  121

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKI++KDGKPYIQVKIK
Sbjct  122  VPYKIISKDGKPYIQVKIK  140



>ref|XP_010107258.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC14452.1| Luminal-binding protein 5 [Morus notabilis]
Length=667

 Score =   234 bits (597),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 122/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S I+  IV  G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARGSLIVLAIVTFGCLFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQ+D+KL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFDDKEVQKDIKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVNKDGKPYIQV IK
Sbjct  123  PFKIVNKDGKPYIQVNIK  140



>emb|CBI34546.3| unnamed protein product [Vitis vinifera]
Length=606

 Score =   233 bits (593),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+RR S I+  IV  G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            Y IVNKDGKPYIQVKIK
Sbjct  124  YNIVNKDGKPYIQVKIK  140



>ref|XP_010918502.1| PREDICTED: luminal-binding protein 4-like [Elaeis guineensis]
Length=664

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 124/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            + + R+S I+ G+++ G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SMRNRSSGIMLGLLLTGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAF D+ERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQRD+KLVP
Sbjct  64   DQGNRITPSWVAFADTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDKEVQRDIKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKI+
Sbjct  124  YKIVNKDGKPYIQVKIR  140



>gb|KHN16714.1| Luminal-binding protein 5 [Glycine soja]
Length=668

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  171  IVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVA  350
            IV +G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVA
Sbjct  16   IVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVA  75

Query  351  FTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  530
            FTDSERLIGEAAKNLAA  PER IFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI
Sbjct  76   FTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  135

Query  531  QVKIK  545
            QVKIK
Sbjct  136  QVKIK  140



>dbj|BAD95470.1| BiP [Glycine max]
Length=668

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 114/125 (91%), Positives = 117/125 (94%), Gaps = 0/125 (0%)
 Frame = +3

Query  171  IVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVA  350
            IV +G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVA
Sbjct  16   IVSLGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVA  75

Query  351  FTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  530
            FTDSERLIGEAAKNLAA  PER IFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI
Sbjct  76   FTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  135

Query  531  QVKIK  545
            QVKIK
Sbjct  136  QVKIK  140



>ref|XP_002276268.2| PREDICTED: luminal-binding protein 5-like isoform X2 [Vitis vinifera]
Length=667

 Score =   234 bits (596),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW  R SS++ GI+++G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERT+FDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVNKDGKPYIQVKIK
Sbjct  123  PFKIVNKDGKPYIQVKIK  140



>gb|KHG09348.1| Luminal-binding 5 [Gossypium arboreum]
Length=667

 Score =   234 bits (596),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+ + R S ++  IV+ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSGRARGSLVVLAIVLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF+DKEVQ+DMKLV
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFDDKEVQKDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|XP_010662895.1| PREDICTED: luminal-binding protein 5-like isoform X1 [Vitis vinifera]
Length=697

 Score =   234 bits (597),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 111/138 (80%), Positives = 124/138 (90%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW  R SS++ GI+++G L A SIAKEE++KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWGLRASSVVLGILLVGCLVAISIAKEESNKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERT+FDVKRLIGRKF+DKEVQ+DMKL 
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTVFDVKRLIGRKFDDKEVQKDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVNKDGKPYIQVKIK
Sbjct  123  PFKIVNKDGKPYIQVKIK  140



>ref|XP_004300491.1| PREDICTED: luminal-binding protein [Fragaria vesca subsp. vesca]
Length=667

 Score =   233 bits (595),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 112/138 (81%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+W+ R S I+  IV +G LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWRARNSLIVLAIVTLGCLFAISIAKEETAKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERT+FDVKRLIGRKF DKEVQRDMKL 
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNHERTVFDVKRLIGRKFADKEVQRDMKLF  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            P+KIVN+DGKPYIQVKIK
Sbjct  123  PFKIVNQDGKPYIQVKIK  140



>gb|KJB18907.1| hypothetical protein B456_003G074600 [Gossypium raimondii]
Length=666

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_007160200.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
 gb|ESW32194.1| hypothetical protein PHAVU_002G301400g [Phaseolus vulgaris]
Length=666

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 116/141 (82%), Positives = 123/141 (87%), Gaps = 2/141 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVE  302
            MAG    R  S I+  IV  G +FA SIAKEEA+KLGTVIGIDLGTTYSCVGVY++  VE
Sbjct  1    MAGSLASR--SLIVLAIVTFGCVFAISIAKEEATKLGTVIGIDLGTTYSCVGVYRNGHVE  58

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKF+DKEVQRDM
Sbjct  59   IIANDQGNRITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFQDKEVQRDM  118

Query  483  KLVPYKIVNKDGKPYIQVKIK  545
            KLVPYKIVNKDGKPYI+VKIK
Sbjct  119  KLVPYKIVNKDGKPYIEVKIK  139



>gb|ACJ11746.1| luminal binding protein [Gossypium hirsutum]
Length=666

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 114/137 (83%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S +   IV+ G  FA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVALAIVLSGCFFAISIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_002263323.1| PREDICTED: luminal-binding protein 5 [Vitis vinifera]
Length=667

 Score =   233 bits (594),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 115/137 (84%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+RR S I+  IV  G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRRRGSLIVAAIVCFGFLAAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            Y IVNKDGKPYIQVKIK
Sbjct  124  YNIVNKDGKPYIQVKIK  140



>ref|XP_009802727.1| PREDICTED: luminal-binding protein [Nicotiana sylvestris]
Length=666

 Score =   233 bits (593),  Expect = 5e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G  +R +S ++  IV+ G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GYLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKD KPYIQVKIK
Sbjct  123  PYKIVNKDSKPYIQVKIK  140



>gb|EPS69483.1| luminal-binding protein 5, partial [Genlisea aurea]
Length=661

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 113/137 (82%), Positives = 122/137 (89%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A K RTS+I+ GIV+IG   A SIA +EA KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  2    ALKMRTSTIVLGIVLIGCFLATSIAVDEAPKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  61

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  62   DQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVP  121

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNK+GKPYI+V+IK
Sbjct  122  YKIVNKEGKPYIEVQIK  138



>ref|XP_009593820.1| PREDICTED: luminal-binding protein [Nicotiana tomentosiformis]
Length=668

 Score =   233 bits (593),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 121/138 (88%), Gaps = 0/138 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G  +R +S ++  IV+ G L A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GYLRRGSSLVVLAIVLFGCLSALSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLV
Sbjct  63   NDQGNRITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLV  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKD KPYIQVKIK
Sbjct  123  PYKIVNKDSKPYIQVKIK  140



>ref|XP_011022455.1| PREDICTED: luminal-binding protein 5-like [Populus euphratica]
Length=666

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 114/138 (83%), Positives = 123/138 (89%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G W+ R  +++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWRAR-GAVVSAILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKLV
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLV  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>ref|XP_004503579.1| PREDICTED: luminal-binding protein-like [Cicer arietinum]
Length=667

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/125 (90%), Positives = 116/125 (93%), Gaps = 0/125 (0%)
 Frame = +3

Query  171  IVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVA  350
            I+  G LFAFS AKEE SKLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVA
Sbjct  15   IISFGCLFAFSAAKEEGSKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVA  74

Query  351  FTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  530
            FTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK+GKPYI
Sbjct  75   FTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYI  134

Query  531  QVKIK  545
            QVKIK
Sbjct  135  QVKIK  139



>ref|NP_001234636.1| luminal-binding protein precursor [Solanum lycopersicum]
 sp|P49118.1|BIP_SOLLC RecName: Full=Luminal-binding protein; Short=BiP; AltName: Full=78 
kDa glucose-regulated protein homolog; Short=GRP-78; Flags: 
Precursor [Solanum lycopersicum]
 gb|AAA34139.1| glucose-regulated protein 78 [Solanum lycopersicum]
Length=666

 Score =   233 bits (593),  Expect = 7e-69, Method: Compositional matrix adjust.
 Identities = 113/135 (84%), Positives = 122/135 (90%), Gaps = 0/135 (0%)
 Frame = +3

Query  141  KRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQ  320
            +R  S ++  IV++G L A S AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQ
Sbjct  6    RRGNSLVVLAIVLLGCLSALSNAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQ  65

Query  321  GNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYK  500
            GNRITPSWVAFTD+ERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYK
Sbjct  66   GNRITPSWVAFTDNERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYK  125

Query  501  IVNKDGKPYIQVKIK  545
            IV+KDGKPYIQVKIK
Sbjct  126  IVSKDGKPYIQVKIK  140



>ref|XP_006286332.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
 gb|EOA19230.1| hypothetical protein CARUB_v100044651mg, partial [Capsella rubella]
Length=415

 Score =   226 bits (577),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>gb|KHM99871.1| Luminal-binding protein 4 [Glycine soja]
Length=668

 Score =   232 bits (592),  Expect = 9e-69, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S +   IV +  LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  9    RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  68

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV
Sbjct  69   RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  128

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  129  NKDGKPYIQVKIK  141



>gb|AAB63469.1| endosperm lumenal binding protein [Oryza sativa]
Length=663

 Score =   232 bits (591),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 113/133 (85%), Positives = 120/133 (90%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S+ L G+++ GSLFAFS+AKEE  KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  5    RGSAFLLGVLLAGSLFAFSVAKEETKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  64

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKR IGRKFE+KEVQRDMKLVPYKIV
Sbjct  65   RITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRDIGRKFEEKEVQRDMKLVPYKIV  124

Query  507  NKDGKPYIQVKIK  545
            NK GKPYIQVKIK
Sbjct  125  NKIGKPYIQVKIK  137



>ref|XP_003525327.2| PREDICTED: luminal-binding protein [Glycine max]
Length=701

 Score =   233 bits (593),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 115/133 (86%), Positives = 119/133 (89%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R S +   IV +  LF  SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  42   RGSLLPLAIVSLVCLFVISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  101

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV
Sbjct  102  RITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  161

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVKIK
Sbjct  162  NKDGKPYIQVKIK  174



>ref|XP_010055986.1| PREDICTED: luminal-binding protein [Eucalyptus grandis]
Length=667

 Score =   231 bits (589),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S ++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD ERLIGEAAKN AA   ERT+FDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  64   DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>gb|KCW72555.1| hypothetical protein EUGRSUZ_E01024 [Eucalyptus grandis]
Length=719

 Score =   231 bits (589),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 111/137 (81%), Positives = 121/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S ++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  56   SWRASGSFVVLSILLFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  115

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD ERLIGEAAKN AA   ERT+FDVKRLIGRKFEDKEVQ+DMKLVP
Sbjct  116  DQGNRITPSWVAFTDGERLIGEAAKNQAAVNAERTVFDVKRLIGRKFEDKEVQKDMKLVP  175

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  176  YKIVNKDGKPYIQVKIK  192



>ref|XP_006286341.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
 gb|EOA19239.1| hypothetical protein CARUB_v100065121mg, partial [Capsella rubella]
Length=484

 Score =   226 bits (577),  Expect = 5e-68, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_002868566.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH44825.1| hypothetical protein ARALYDRAFT_493781 [Arabidopsis lyrata subsp. 
lyrata]
Length=668

 Score =   230 bits (586),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 110/132 (83%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_010473721.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   229 bits (585),  Expect = 9e-68, Method: Compositional matrix adjust.
 Identities = 109/131 (83%), Positives = 120/131 (92%), Gaps = 0/131 (0%)
 Frame = +3

Query  153  SSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            +++L   V++G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRI
Sbjct  4    NTVLLAFVLLGCLFAASIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRI  63

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKLVPYKIVNK
Sbjct  64   TPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNK  123

Query  513  DGKPYIQVKIK  545
            +GKPYIQVKIK
Sbjct  124  EGKPYIQVKIK  134



>emb|CDY63497.1| BnaC07g48050D [Brassica napus]
Length=642

 Score =   229 bits (584),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 118/130 (91%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +++  I+  GSLFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TVVLAIIFFGSLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTDSERLIGEAAKN A   PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVNKD
Sbjct  70   PSWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>ref|XP_002887878.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH64137.1| hypothetical protein ARALYDRAFT_892955 [Arabidopsis lyrata subsp. 
lyrata]
Length=662

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            S++  I ++G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  5    SLVLAIFLLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  64

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKLVPYKIVNK+
Sbjct  65   PSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKE  124

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  125  GKPYIQVKIK  134



>ref|XP_011026831.1| PREDICTED: luminal-binding protein 5 [Populus euphratica]
Length=666

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G W  R   ++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNSERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>ref|NP_199017.2| Luminal-binding protein 2 [Arabidopsis thaliana]
 gb|AED94756.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=613

 Score =   228 bits (580),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_002299448.1| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE84253.1| BiP isoform A family protein [Populus trichocarpa]
Length=666

 Score =   229 bits (583),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 113/138 (82%), Positives = 120/138 (87%), Gaps = 1/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G W  R   ++  I++ G LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GTWTAR-GVVVSAIILFGCLFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQ+DMKL 
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQKDMKLF  121

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  122  PYKIVNKDGKPYIQVKIK  139



>ref|XP_006405286.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
 dbj|BAJ34315.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ46739.1| hypothetical protein EUTSA_v10027674mg [Eutrema salsugineum]
Length=669

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/130 (84%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TVVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVNKD
Sbjct  70   PSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDKKLVPYQIVNKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>ref|XP_006827760.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
 gb|ERM95176.1| hypothetical protein AMTR_s00009p00264000 [Amborella trichopoda]
Length=665

 Score =   228 bits (582),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 120/136 (88%), Gaps = 0/136 (0%)
 Frame = +3

Query  138  WKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  317
            ++ R S ++  ++  G LFAF +AKEEA+KLGTVIGIDLGTTYSCVGVYK   VEIIAND
Sbjct  5    FRDRGSLMVLALIASGCLFAFVVAKEEATKLGTVIGIDLGTTYSCVGVYKSGHVEIIAND  64

Query  318  QGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPY  497
            QGNRITPSWVAFTD+ERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVPY
Sbjct  65   QGNRITPSWVAFTDTERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPY  124

Query  498  KIVNKDGKPYIQVKIK  545
            KIVNKDGKPY+QVK+K
Sbjct  125  KIVNKDGKPYVQVKMK  140



>dbj|BAA12348.1| luminal binding protein (BiP) [Arabidopsis thaliana]
Length=668

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|NP_851119.1| Luminal-binding protein 2 [Arabidopsis thaliana]
 sp|Q39043.2|MD37F_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37f; AltName: Full=Heat shock 70 kDa protein 12; AltName: 
Full=Heat shock protein 70-12; Short=AtHsp70-12; AltName: 
Full=Luminal-binding protein 2; Short=AtBP2; Short=BiP2; Flags: 
Precursor [Arabidopsis thaliana]
 dbj|BAB08435.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAO00752.1| luminal binding protein [Arabidopsis thaliana]
 gb|AAP37765.1| At5g42020 [Arabidopsis thaliana]
 gb|AED94755.1| Luminal-binding protein 2 [Arabidopsis thaliana]
Length=668

 Score =   228 bits (581),  Expect = 3e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>dbj|BAA13948.1| luminal binding protein [Arabidopsis thaliana]
Length=668

 Score =   228 bits (581),  Expect = 4e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 118/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>gb|KFK32162.1| hypothetical protein AALP_AA6G205800 [Arabis alpina]
Length=663

 Score =   228 bits (580),  Expect = 5e-67, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            S +   + +G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  5    SFVLAFIFLGCLFAISIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  64

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+DMKLVPYKIVNKD
Sbjct  65   PSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDMKLVPYKIVNKD  124

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  125  GKPYIQVKIK  134



>gb|KDO76632.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=409

 Score =   221 bits (564),  Expect = 7e-67, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN AA  P+RTIFDVKRLIGRKFEDKEVQRDMKL PYKIVN+DGKPYIQV+I+
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIR  120



>ref|XP_006401475.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
 gb|ESQ42928.1| hypothetical protein EUTSA_v10012896mg [Eutrema salsugineum]
Length=668

 Score =   227 bits (578),  Expect = 9e-67, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFAFSTAKEEANKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRK+EDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKYEDKEVQKDKKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_010446984.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010447007.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Camelina sativa]
 ref|XP_010436160.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X1 [Camelina sativa]
Length=668

 Score =   226 bits (577),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 117/132 (89%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              + +  I+ +G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTAVLAIIFLGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_010430591.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Camelina sativa]
Length=662

 Score =   226 bits (576),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 106/130 (82%), Positives = 119/130 (92%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            ++L   +++G LFA SIAKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  5    TVLLAFILLGCLFAVSIAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  64

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTDSERLIGEAAKN AA  P+RT+FDVKRLIGRKF+DKEVQ+DMKLVPYKIVNK+
Sbjct  65   PSWVGFTDSERLIGEAAKNQAAVNPDRTVFDVKRLIGRKFDDKEVQKDMKLVPYKIVNKE  124

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  125  GKPYIQVKIK  134



>gb|KDO76630.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=494

 Score =   222 bits (566),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN AA  P+RTIFDVKRLIGRKFEDKEVQRDMKL PYKIVN+DGKPYIQV+I+
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIR  120



>emb|CDX77423.1| BnaA07g05610D [Brassica napus]
Length=642

 Score =   225 bits (573),  Expect = 3e-66, Method: Compositional matrix adjust.
 Identities = 107/130 (82%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +++  I+  G LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TVVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTDSERLIGEAAKN A   PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVNKD
Sbjct  70   PSWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>gb|KDO76631.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=487

 Score =   221 bits (563),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN AA  P+RTIFDVKRLIGRKFEDKEVQRDMKL PYKIVN+DGKPYIQV+I+
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIR  120



>ref|XP_010436161.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f isoform X2 [Camelina sativa]
Length=668

 Score =   225 bits (573),  Expect = 4e-66, Method: Compositional matrix adjust.
 Identities = 108/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  341
            +  I+  G LFAFS AKEEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  12   VLAIIFFGCLFAFSTAKEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  71

Query  342  WVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGK  521
            WV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVNKDGK
Sbjct  72   WVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVNKDGK  131

Query  522  PYIQVKIK  545
            PYIQVKIK
Sbjct  132  PYIQVKIK  139



>ref|XP_009102505.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f-like [Brassica rapa]
Length=666

 Score =   225 bits (573),  Expect = 5e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LF FS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFTFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWVAFTDSERLIGEAAKN A   PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVAFTDSERLIGEAAKNQAPLNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_009392825.1| PREDICTED: luminal-binding protein 2 [Musa acuminata subsp. malaccensis]
Length=668

 Score =   224 bits (572),  Expect = 6e-66, Method: Compositional matrix adjust.
 Identities = 117/137 (85%), Positives = 125/137 (91%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            + + R S IL G+++ GSLFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SLRNRGSVILLGLLLAGSLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGR+FEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRRFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKDGKPYIQVKIK
Sbjct  124  YKIVNKDGKPYIQVKIK  140



>ref|XP_010934830.1| PREDICTED: luminal-binding protein 4 [Elaeis guineensis]
Length=661

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 116/134 (87%), Positives = 122/134 (91%), Gaps = 0/134 (0%)
 Frame = +3

Query  144  RRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  323
            R  S IL G+ + G LFAFSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQG
Sbjct  3    RSRSVILLGLFITGCLFAFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQG  62

Query  324  NRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI  503
            NRITPSWVAFTDSERLIGEAAKN AA+  ERTIFDVKRLIGRKF+DKEVQRDMKLVPYKI
Sbjct  63   NRITPSWVAFTDSERLIGEAAKNQAAANAERTIFDVKRLIGRKFDDKEVQRDMKLVPYKI  122

Query  504  VNKDGKPYIQVKIK  545
            VNKDGKPYIQVKIK
Sbjct  123  VNKDGKPYIQVKIK  136



>gb|AAZ95244.1| putative luminal-binding protein [Isatis tinctoria]
Length=668

 Score =   224 bits (571),  Expect = 9e-66, Method: Compositional matrix adjust.
 Identities = 107/132 (81%), Positives = 115/132 (87%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFA   AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFALCTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_009418642.1| PREDICTED: luminal-binding protein 2-like [Musa acuminata subsp. 
malaccensis]
Length=666

 Score =   223 bits (569),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 109/118 (92%), Positives = 111/118 (94%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FAFSIAKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSERL
Sbjct  22   FAFSIAKEEAIKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERL  81

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI+NKDGKPYIQVKIK
Sbjct  82   IGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIINKDGKPYIQVKIK  139



>ref|XP_003573226.1| PREDICTED: luminal-binding protein 3 [Brachypodium distachyon]
Length=665

 Score =   223 bits (568),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 108/118 (92%), Positives = 110/118 (93%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FAFS AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTDSERL
Sbjct  20   FAFSAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN+DGKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNRDGKPYIQVKIK  137



>emb|CDY46766.1| BnaA03g17100D [Brassica napus]
Length=642

 Score =   222 bits (566),  Expect = 3e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 117/130 (90%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +I+  I+ +G +FAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TIVLAIIFVGCVFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KD
Sbjct  70   PSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>emb|CDX79726.1| BnaC03g20620D [Brassica napus]
Length=642

 Score =   222 bits (566),  Expect = 4e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TVVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KD
Sbjct  70   PSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>ref|XP_002317789.2| BiP isoform A family protein [Populus trichocarpa]
 gb|EEE96009.2| BiP isoform A family protein [Populus trichocarpa]
Length=668

 Score =   222 bits (566),  Expect = 5e-65, Method: Compositional matrix adjust.
 Identities = 110/140 (79%), Positives = 120/140 (86%), Gaps = 1/140 (1%)
 Frame = +3

Query  129  GGAWKRRTSSILF-GIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEI  305
            G + K R  S +   I ++GSL   SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEI
Sbjct  2    GFSLKHRAGSFMVVAIFLLGSLLTVSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEI  61

Query  306  IANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMK  485
            IANDQGNRITPSWVAFTDSERLIGEAAKN AA+ PERTIFDVKRLIGR + DKEVQ+DMK
Sbjct  62   IANDQGNRITPSWVAFTDSERLIGEAAKNQAAANPERTIFDVKRLIGRVYGDKEVQKDMK  121

Query  486  LVPYKIVNKDGKPYIQVKIK  545
            L PYKIVNKDGKPYI+VKIK
Sbjct  122  LFPYKIVNKDGKPYIEVKIK  141



>gb|KDO76629.1| hypothetical protein CISIN_1g0059551mg, partial [Citrus sinensis]
Length=647

 Score =   221 bits (564),  Expect = 6e-65, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 112/119 (94%), Gaps = 0/119 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            LFA SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSER
Sbjct  2    LFAISIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSER  61

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN AA  P+RTIFDVKRLIGRKFEDKEVQRDMKL PYKIVN+DGKPYIQV+I+
Sbjct  62   LIGEAAKNQAAVNPDRTIFDVKRLIGRKFEDKEVQRDMKLAPYKIVNRDGKPYIQVQIR  120



>emb|CDY23972.1| BnaC03g17190D [Brassica napus]
 emb|CDX84809.1| BnaA03g14210D [Brassica napus]
Length=642

 Score =   221 bits (564),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
              +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NGTVVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+
Sbjct  68   ITPSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVD  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|NP_198206.1| Luminal-binding protein 1 [Arabidopsis thaliana]
 sp|Q9LKR3.1|MD37A_ARATH RecName: Full=Mediator of RNA polymerase II transcription subunit 
37a; AltName: Full=Heat shock 70 kDa protein 11; AltName: 
Full=Heat shock protein 70-11; Short=AtHsp70-11; AltName: 
Full=Luminal-binding protein 1; Short=AtBP1; Short=BiP1; Flags: 
Precursor [Arabidopsis thaliana]
 gb|AAF88019.1| Hypothetical protein T26D3.10 [Arabidopsis thaliana]
 gb|AAN17430.1| Unknown protein [Arabidopsis thaliana]
 gb|AAN65099.1| Unknown protein [Arabidopsis thaliana]
 gb|AED93812.1| Luminal-binding protein 1 [Arabidopsis thaliana]
Length=669

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|XP_009132761.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=669

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 105/130 (81%), Positives = 116/130 (89%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            +++  I+  G LFAFS AKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   TVVLAIIFFGCLFAFSTAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWV FTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKF DKEVQ+D KLVPY+IV+KD
Sbjct  70   PSWVGFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFADKEVQKDRKLVPYQIVDKD  129

Query  516  GKPYIQVKIK  545
            GKPYIQVKIK
Sbjct  130  GKPYIQVKIK  139



>dbj|BAA13947.1| luminal binding protein [Arabidopsis thaliana]
Length=669

 Score =   222 bits (565),  Expect = 7e-65, Method: Compositional matrix adjust.
 Identities = 106/132 (80%), Positives = 116/132 (88%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
             S+++  I+  G LFA S A EEA+KLG+VIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  8    NSTVVLAIIFFGCLFALSSAIEEATKLGSVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  67

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV FTDSERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D KLVPY+IVN
Sbjct  68   ITPSWVGFTDSERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDRKLVPYQIVN  127

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVKIK
Sbjct  128  KDGKPYIQVKIK  139



>ref|NP_001234941.1| BiP isoform A [Glycine max]
 gb|AAA81956.1| BiP isoform A [Glycine max]
Length=664

 Score =   221 bits (562),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 113/139 (81%), Positives = 121/139 (87%), Gaps = 3/139 (2%)
 Frame = +3

Query  135  AWKRRTSSILFGIVV-IGSLFA-FSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
            ++ R +S     I+V +G LF  FSIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEII
Sbjct  4    SFSRGSSCFPLAIIVSLGCLFRDFSIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEII  63

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSW +FTDSERLIGEAAKNLAA  PER IFDVKRLIGRKFEDKEVQRDMKL
Sbjct  64   ANDQGNRITPSW-SFTDSERLIGEAAKNLAAVNPERVIFDVKRLIGRKFEDKEVQRDMKL  122

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQ KIK
Sbjct  123  VPYKIVNKDGKPYIQEKIK  141



>ref|XP_010545034.1| PREDICTED: luminal-binding protein 4 [Tarenaya hassleriana]
Length=665

 Score =   220 bits (561),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 108/130 (83%), Positives = 115/130 (88%), Gaps = 1/130 (1%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            ++   IV  G L+A SIAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  10   AVALAIVFFGCLYA-SIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  68

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTDSERLIGEAAKN AA  PERTIFDVKRLIGR+F DKEVQRDMKL+PYKIVNKD
Sbjct  69   PSWVAFTDSERLIGEAAKNQAAVNPERTIFDVKRLIGRQFTDKEVQRDMKLMPYKIVNKD  128

Query  516  GKPYIQVKIK  545
            GKPYIQV  K
Sbjct  129  GKPYIQVNFK  138



>gb|KEH21282.1| heat shock cognate 70 kDa-like protein [Medicago truncatula]
Length=669

 Score =   219 bits (557),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 108/132 (82%), Positives = 116/132 (88%), Gaps = 1/132 (1%)
 Frame = +3

Query  153  SSILFGIVVIGSLFAFSIAKEEAS-KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
            S +L  I+ +  LFA S AKEE + KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNR
Sbjct  9    SVLLLTIISLVCLFATSAAKEEGTTKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNR  68

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWV+FTD ERLIGEAAKNLAA  PERTIFDVKRLIGRKF DKEVQRDMKLVPYKIVN
Sbjct  69   ITPSWVSFTDDERLIGEAAKNLAAVNPERTIFDVKRLIGRKFADKEVQRDMKLVPYKIVN  128

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQV++K
Sbjct  129  KDGKPYIQVRVK  140



>ref|NP_001238736.1| BiP isoform B precursor [Glycine max]
 gb|AAA81954.1| BiP isoform B [Glycine max]
Length=666

 Score =   217 bits (553),  Expect = 4e-63, Method: Compositional matrix adjust.
 Identities = 114/139 (82%), Positives = 119/139 (86%), Gaps = 4/139 (3%)
 Frame = +3

Query  129  GGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEII  308
             G+W RR S I+  I+  G LFA SIAKEEA+KLGTVIGIDL TTYSCVGV     VEII
Sbjct  2    AGSWARR-SLIVLAIISFGCLFAISIAKEEATKLGTVIGIDL-TTYSCVGVT--DAVEII  57

Query  309  ANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKL  488
            ANDQGNRITPSWVAFTDSERLIGEAAK +AA  P RTIFDVKRLIGRKFEDKEVQRDMKL
Sbjct  58   ANDQGNRITPSWVAFTDSERLIGEAAKIVAAVNPVRTIFDVKRLIGRKFEDKEVQRDMKL  117

Query  489  VPYKIVNKDGKPYIQVKIK  545
            VPYKIVNKDGKPYIQVKIK
Sbjct  118  VPYKIVNKDGKPYIQVKIK  136



>emb|CDX67525.1| BnaA07g15650D [Brassica napus]
Length=577

 Score =   214 bits (546),  Expect = 9e-63, Method: Compositional matrix adjust.
 Identities = 109/136 (80%), Positives = 116/136 (85%), Gaps = 3/136 (2%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  317
            R+   +  I+  G LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIAND
Sbjct  3    RSFGAVLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIAND  62

Query  318  QGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPY  497
            QGNRITPSWVAFTDS RLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY
Sbjct  63   QGNRITPSWVAFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPY  122

Query  498  KIVNKDGKPYIQVKIK  545
            +IVNKDGKPYIQVKIK
Sbjct  123  QIVNKDGKPYIQVKIK  138



>gb|AAA62325.1| HSP70 [Hordeum vulgare subsp. vulgare]
Length=608

 Score =   215 bits (548),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 103/118 (87%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDM+LVPYKIVNK+GKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMRLVPYKIVNKEGKPYIQVKIK  137



>dbj|BAJ85675.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=665

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVPYKIVNK+GKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIK  137



>gb|AGN94841.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVPYKIVNK+GKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIK  137



>gb|EMT16454.1| Luminal-binding protein 4 [Aegilops tauschii]
 gb|AGN94840.1| ER molecular chaperone [Triticum aestivum]
 gb|AGN94842.1| ER molecular chaperone [Triticum aestivum]
Length=665

 Score =   216 bits (550),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVPYKIVNK+GKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIK  137



>emb|CAA89834.2| luminal binding protein [Pseudotsuga menziesii]
Length=675

 Score =   216 bits (549),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  341
            L   +  G LF+  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  23   LAAFITAGFLFSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  82

Query  342  WVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGK  521
            WVAFTD+ERLIGEAAKN AA  PERT+FDVKRLIGRK+EDKEVQ+D+KL+PYKIVNKDGK
Sbjct  83   WVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQKDIKLLPYKIVNKDGK  142

Query  522  PYIQVKIK  545
            PYIQVKI+
Sbjct  143  PYIQVKIR  150



>gb|EMS58484.1| Luminal-binding protein 3 [Triticum urartu]
Length=709

 Score =   216 bits (550),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 104/118 (88%), Positives = 107/118 (91%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            FA   AKEEA KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTD ERL
Sbjct  20   FALCAAKEEAKKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDGERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQRDMKLVPYKIVNK+GKPYIQVKIK
Sbjct  80   IGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKEGKPYIQVKIK  137



>gb|ABR18447.1| unknown [Picea sitchensis]
Length=687

 Score =   215 bits (547),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 114/128 (89%), Gaps = 0/128 (0%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPS  341
            L   ++ G L +  IA EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPS
Sbjct  33   LAAFIIAGFLVSSVIAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPS  92

Query  342  WVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGK  521
            WVAFTD+ERLIGEAAKN AA  PERT+FDVKRLIGRK+EDKEVQRD+KL+PYKIVNKDGK
Sbjct  93   WVAFTDTERLIGEAAKNQAAMNPERTVFDVKRLIGRKYEDKEVQRDVKLLPYKIVNKDGK  152

Query  522  PYIQVKIK  545
            PYIQVKI+
Sbjct  153  PYIQVKIR  160



>gb|KFK32977.1| hypothetical protein AALP_AA6G313600 [Arabis alpina]
Length=662

 Score =   214 bits (545),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 106/119 (89%), Positives = 110/119 (92%), Gaps = 1/119 (1%)
 Frame = +3

Query  192  FAFSIAKEE-ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            FAFS AKEE A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWV FTDSER
Sbjct  18   FAFSNAKEEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVGFTDSER  77

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY+IVNKDGKPYIQVKIK
Sbjct  78   LIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPYEIVNKDGKPYIQVKIK  136



>ref|XP_001774724.1| predicted protein [Physcomitrella patens]
 gb|EDQ60395.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   213 bits (541),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 115/130 (88%), Gaps = 5/130 (4%)
 Frame = +3

Query  171  IVVIGSLFAFSIA-----KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            ++V+G LFA  +A      EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRIT
Sbjct  6    LLVLGLLFAAGVAGSFGAAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRIT  65

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTD+ERLIGEAAKN AA  PERT+FDVKRLIGRKFEDKEVQ+D+KL PYKIVNKD
Sbjct  66   PSWVAFTDNERLIGEAAKNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIVNKD  125

Query  516  GKPYIQVKIK  545
            GKP+IQVK+K
Sbjct  126  GKPHIQVKVK  135



>gb|KHG03675.1| Luminal-binding 5 [Gossypium arboreum]
 gb|KHG17377.1| Luminal-binding 5 [Gossypium arboreum]
Length=666

 Score =   211 bits (538),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 112/137 (82%), Positives = 120/137 (88%), Gaps = 0/137 (0%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +W+   S ++  IV+ G  FA +IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  4    SWRASGSLVVLAIVLSGCFFAIAIAKEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKFEDKEVQRDMKLVP
Sbjct  64   DQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRKFEDKEVQRDMKLVP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YKIVNKD KPYIQVKIK
Sbjct  124  YKIVNKDDKPYIQVKIK  140



>ref|XP_009125214.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37f [Brassica rapa]
Length=665

 Score =   211 bits (536),  Expect = 9e-61, Method: Compositional matrix adjust.
 Identities = 107/136 (79%), Positives = 114/136 (84%), Gaps = 3/136 (2%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAND  317
            R+   +  I+  G LFA FS AKEE   +KLGTVIGIDLGTTYSCVG YK+  VEIIAND
Sbjct  3    RSFGAVLAIIFFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGAYKNGHVEIIAND  62

Query  318  QGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPY  497
            QGNRITPSWV FTDS RLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+D KLVPY
Sbjct  63   QGNRITPSWVDFTDSARLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDRKLVPY  122

Query  498  KIVNKDGKPYIQVKIK  545
            +IVNKDGKPYIQVKIK
Sbjct  123  QIVNKDGKPYIQVKIK  138



>ref|XP_006838409.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
 gb|ERN00978.1| hypothetical protein AMTR_s00002p00096860 [Amborella trichopoda]
Length=671

 Score =   211 bits (536),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 104/143 (73%), Positives = 116/143 (81%), Gaps = 2/143 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFS--IAKEEASKLGTVIGIDLGTTYSCVGVYKDQR  296
            + G   +   SSIL   V+  S F F   +  EEA KLGTVIGIDLGTTYSCVGVYK+  
Sbjct  4    LKGNTIQMMKSSILILSVIFLSGFVFESFVKAEEAPKLGTVIGIDLGTTYSCVGVYKNGH  63

Query  297  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQR  476
            VEIIANDQGNRITPSWVAFTD+ERL+GEAAKN AA  PERTIFDVKRLIGR+F DKEVQR
Sbjct  64   VEIIANDQGNRITPSWVAFTDTERLVGEAAKNQAALNPERTIFDVKRLIGRRFSDKEVQR  123

Query  477  DMKLVPYKIVNKDGKPYIQVKIK  545
            DMK +PYK+VNKDGKPYI+VKI+
Sbjct  124  DMKFLPYKVVNKDGKPYIEVKIR  146



>ref|XP_006405378.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
 gb|ESQ46831.1| hypothetical protein EUTSA_v10028192mg, partial [Eutrema salsugineum]
Length=415

 Score =   201 bits (512),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 96/113 (85%), Positives = 103/113 (91%), Gaps = 0/113 (0%)
 Frame = +3

Query  207  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            AKE+A+K GT+IGIDLGT YSCVGVYK+  VEIIANDQGNRITPSWV FTDSE LIGEAA
Sbjct  26   AKEDATKFGTLIGIDLGTAYSCVGVYKNDHVEIIANDQGNRITPSWVGFTDSESLIGEAA  85

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            KN AA  PERTIFDVKRLIGRKFEDK+VQ+D KLVPY+IVNKDGKPYIQVKIK
Sbjct  86   KNQAAVNPERTIFDVKRLIGRKFEDKQVQKDRKLVPYQIVNKDGKPYIQVKIK  138



>ref|XP_001780840.1| predicted protein [Physcomitrella patens]
 gb|EDQ54319.1| predicted protein [Physcomitrella patens]
Length=662

 Score =   206 bits (525),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 97/113 (86%), Positives = 106/113 (94%), Gaps = 0/113 (0%)
 Frame = +3

Query  207  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            A EEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSERLIGEAA
Sbjct  23   AAEEAAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAA  82

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            KN AA  PERT+FDVKRLIGRKFEDKEVQ+D+KL PYKI+NKDGKP+IQV++K
Sbjct  83   KNQAAVNPERTVFDVKRLIGRKFEDKEVQKDIKLFPYKIINKDGKPHIQVQVK  135



>ref|XP_010259649.1| PREDICTED: luminal-binding protein 4-like [Nelumbo nucifera]
Length=661

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 114/138 (83%), Gaps = 2/138 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GA  R T+  L  +  +  L   ++A EE+ KLGTVIGIDLGTTYSCVGVY++  VEIIA
Sbjct  2    GAKYRATA--LLVLFAMEFLLGLAVASEESPKLGTVIGIDLGTTYSCVGVYRNGHVEIIA  59

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTDSERLIGEAAKN A+   ERTIFDVKRLIGRKF+D EVQRD+K +
Sbjct  60   NDQGNRITPSWVAFTDSERLIGEAAKNQASLNAERTIFDVKRLIGRKFDDPEVQRDIKFL  119

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYK+VNKDGKPYIQVKI+
Sbjct  120  PYKVVNKDGKPYIQVKIR  137



>emb|CDP15491.1| unnamed protein product [Coffea canephora]
Length=663

 Score =   204 bits (519),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 102/138 (74%), Positives = 115/138 (83%), Gaps = 2/138 (1%)
 Frame = +3

Query  138  WKRRTSSILFGIVVIGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            +K+  +  +F + V   L   ++A EE+ K  LGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    YKKSKALWIFFLFVSEFLLGITLAAEESQKKNLGTVIGIDLGTTYSCVGVYKNGNVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERTIFDVKRLIGRKF+D EVQRDMK++
Sbjct  63   NDQGNRITPSWVAFTDTERLIGEAAKNQAAINAERTIFDVKRLIGRKFDDPEVQRDMKML  122

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYKIVNKDGKPYIQVKIK
Sbjct  123  PYKIVNKDGKPYIQVKIK  140



>ref|NP_001290009.1| mediator of RNA polymerase II transcription subunit 37a precursor 
[Vitis vinifera]
 gb|AFJ20202.1| putative luminal-binding protein [Vitis vinifera]
Length=660

 Score =   202 bits (515),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 99/137 (72%), Positives = 115/137 (84%), Gaps = 1/137 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A K R   IL  + V+  LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIAN
Sbjct  2    AVKNRAVMIL-QLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIAN  60

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWV+FT++ERLIGEAAKN AA  PERTIFDVKRLIGRKF+D EVQRD+K +P
Sbjct  61   DQGNRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLP  120

Query  495  YKIVNKDGKPYIQVKIK  545
            YK+VNK+GKPYIQVKI+
Sbjct  121  YKVVNKEGKPYIQVKIR  137



>ref|XP_006433401.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
 ref|XP_006472078.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
 gb|ESR46641.1| hypothetical protein CICLE_v10000531mg [Citrus clementina]
Length=657

 Score =   202 bits (513),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 98/124 (79%), Positives = 108/124 (87%), Gaps = 5/124 (4%)
 Frame = +3

Query  189  LFAFSI-----AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAF  353
            LFAF       A ++ +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWVAF
Sbjct  13   LFAFEFSLALAAADDTTKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAF  72

Query  354  TDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQ  533
            TD+ERLIGEAAKN AA   ERTIFDVKRLIGRKF+D EVQRD+K +PYKIVNKDGKPYIQ
Sbjct  73   TDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKDGKPYIQ  132

Query  534  VKIK  545
            VK+K
Sbjct  133  VKVK  136



>emb|CDP21572.1| unnamed protein product, partial [Coffea canephora]
Length=286

 Score =   193 bits (491),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQR  296
            MA  +  +  +  L  + V   L   ++A E   K  LGTVIGIDLGTTYSCVGVY++  
Sbjct  1    MAYSSSVKNKACWLLLLFVSEFLAGIALAAEGTQKQNLGTVIGIDLGTTYSCVGVYRNGN  60

Query  297  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQR  476
            VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AA  PE T+FDVKR IGRKF+D EVQR
Sbjct  61   VEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRKFDDPEVQR  120

Query  477  DMKLVPYKIVNKDGKPYIQVKIK  545
            DMKL+PYK+VNKDGKPYI VK+K
Sbjct  121  DMKLLPYKVVNKDGKPYIDVKMK  143



>ref|XP_002969949.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
 gb|EFJ29073.1| hypothetical protein SELMODRAFT_440900 [Selaginella moellendorffii]
Length=660

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 101/133 (76%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R+  +LF +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFT++ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQRDMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQRDMKLFPFKIV  119

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVK+K
Sbjct  120  NKDGKPYIQVKVK  132



>emb|CDY13371.1| BnaC06g13860D [Brassica napus]
Length=673

 Score =   201 bits (512),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 106/144 (74%), Positives = 115/144 (80%), Gaps = 10/144 (7%)
 Frame = +3

Query  144  RRTSSILFGIVVIGSLFA-FSIAKEE--ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            R   +++  I++ G LFA FS AKEE   +KLGTVIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  3    RSFGAVVLAIILFGFLFASFSTAKEEEATTKLGTVIGIDLGTTYSCVGVYKNGHVEIIAN  62

Query  315  DQGNRITPSWVAFTDSERLIG-------EAAKNLAASKPERTIFDVKRLIGRKFEDKEVQ  473
            DQGNRITPSWVAFTDSERLIG        A  N AA  PERTIF VKRLIGRKFEDKEVQ
Sbjct  63   DQGNRITPSWVAFTDSERLIGSLYSKLFHAYLNKAAVNPERTIFGVKRLIGRKFEDKEVQ  122

Query  474  RDMKLVPYKIVNKDGKPYIQVKIK  545
            +D KLVPY+IVNKDGKPYIQVKIK
Sbjct  123  KDRKLVPYQIVNKDGKPYIQVKIK  146



>emb|CBI39503.3| unnamed protein product [Vitis vinifera]
Length=576

 Score =   199 bits (507),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A K R   IL  + V+  LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIAN
Sbjct  2    AVKNRAVMIL-QLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIAN  60

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWV+FT++ERLIGEAAKN AA  PERTIFDVKRLIGRKF+D EVQRD+K +P
Sbjct  61   DQGNRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLP  120

Query  495  YKIVNKDGKPYIQVKIK  545
            YK+VNK+GKPYIQV I+
Sbjct  121  YKVVNKEGKPYIQVTIR  137



>ref|XP_006479343.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   201 bits (510),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 93/118 (79%), Positives = 104/118 (88%), Gaps = 0/118 (0%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
               + A +  +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD+ERL
Sbjct  20   LGLAAADDTTTKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERL  79

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IGEAAKN AA  PERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  80   IGEAAKNQAAFNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  137



>ref|NP_172382.4| protein BIP3 [Arabidopsis thaliana]
 sp|Q8H1B3.1|MD37B_ARATH RecName: Full=Probable mediator of RNA polymerase II transcription 
subunit 37b; AltName: Full=BiP chaperone BIP-L; AltName: 
Full=Heat shock 70 kDa protein 13; AltName: Full=Heat shock 
protein 70-13; Short=AtHsp70-13; AltName: Full=Hsp70 protein 
BiP chaperone BIP-L; AltName: Full=Luminal-binding protein 
3; Short=AtBP3; Short=BiP3; Flags: Precursor [Arabidopsis 
thaliana]
 gb|AAN60163.1| BiP chaperone BIP-L [Arabidopsis thaliana]
 gb|AEE28392.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=675

 Score =   201 bits (510),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 112/131 (85%), Gaps = 1/131 (1%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            ++L  ++ IG+    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRI
Sbjct  24   TVLDFLMNIGAALMSSLAIEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRI  83

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPSWVAFTD+ERLIGEAAKN AA  PERTIFD KRLIGRKF+D +VQRD+K +PYK+VNK
Sbjct  84   TPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNK  143

Query  513  DGKPYIQVKIK  545
            DGKPYIQVK+K
Sbjct  144  DGKPYIQVKVK  154



>ref|XP_002892480.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68739.1| hypothetical protein ARALYDRAFT_311954 [Arabidopsis lyrata subsp. 
lyrata]
Length=646

 Score =   200 bits (509),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 1/123 (1%)
 Frame = +3

Query  180  IGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFT  356
            IG+    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWVAFT
Sbjct  3    IGAALMSSVAIESEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFT  62

Query  357  DSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQV  536
            D+ERLIGEAAKN AA  PERTIFD KRLIGRKF+D +VQRD+K +PYK+VNKDGKPYIQV
Sbjct  63   DTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQV  122

Query  537  KIK  545
            K+K
Sbjct  123  KVK  125



>ref|XP_002981419.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
 gb|EFJ17607.1| hypothetical protein SELMODRAFT_444846 [Selaginella moellendorffii]
Length=660

 Score =   200 bits (509),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 100/133 (75%), Positives = 113/133 (85%), Gaps = 3/133 (2%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R+  +LF +++ G+          A+KLGTVIGIDLGTTYSCVGVYK+  VEIIANDQGN
Sbjct  3    RSVILLFALLIAGAAVVAKEE---AAKLGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGN  59

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFT++ERLIGEAAKN AA  PERTIFDVKRLIGRKFEDKEVQ+DMKL P+KIV
Sbjct  60   RITPSWVAFTETERLIGEAAKNQAAVNPERTIFDVKRLIGRKFEDKEVQKDMKLFPFKIV  119

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVK+K
Sbjct  120  NKDGKPYIQVKVK  132



>ref|XP_010659633.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Vitis vinifera]
Length=649

 Score =   200 bits (508),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 114/137 (83%), Gaps = 1/137 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A K R   IL  + V+  LF  ++A E + KLGTVIGIDLGTTYSCVGVY++  VEIIAN
Sbjct  2    AVKNRAVMIL-QLFVLEFLFGTALAAENSQKLGTVIGIDLGTTYSCVGVYRNGHVEIIAN  60

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWV+FT++ERLIGEAAKN AA  PERTIFDVKRLIGRKF+D EVQRD+K +P
Sbjct  61   DQGNRITPSWVSFTNTERLIGEAAKNQAALNPERTIFDVKRLIGRKFDDPEVQRDIKFLP  120

Query  495  YKIVNKDGKPYIQVKIK  545
            YK+VNK+GKPYIQV I+
Sbjct  121  YKVVNKEGKPYIQVTIR  137



>ref|XP_006306953.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
 gb|EOA39851.1| hypothetical protein CARUB_v10008520mg [Capsella rubella]
Length=665

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 97/133 (73%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            T+  L  +V + +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGN
Sbjct  12   TNRALVCLVFLMTALMSSVAIEGEDQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGN  71

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTD+ERLIGEAAKN AA  PERTIFD KRLIGRKF+D +VQRD+K +PYK+V
Sbjct  72   RITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVV  131

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVK+K
Sbjct  132  NKDGKPYIQVKVK  144



>gb|AFC88846.1| putative luminal binding protein 7B4, partial [Tetragonia tetragonioides]
Length=699

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 95/138 (69%), Positives = 115/138 (83%), Gaps = 1/138 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFA-FSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            + + R  S++F I+ +    A  ++A ++ +  GTVIGIDLGTTYSCVGVYKD  VEII 
Sbjct  39   STRSRDLSLMFLILFVTEFLAGVTLAADDQALKGTVIGIDLGTTYSCVGVYKDGHVEIIP  98

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA  PERTIFDVKRLIGR+F+D EVQRD+K++
Sbjct  99   NDQGNRITPSWVAFTDTERLIGEAAKNQAALNPERTIFDVKRLIGRRFDDPEVQRDIKML  158

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYK+VN+DGKPYI+VKIK
Sbjct  159  PYKVVNRDGKPYIEVKIK  176



>ref|XP_010458176.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=664

 Score =   200 bits (508),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 94/132 (71%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
            T+  L  +V + +L +    + E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNR
Sbjct  12   TNKALVYLVFLTALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNR  71

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWVAFTD+ERLIGEAAKN AA  PERTIFD KRL+GRKF+D +VQRD+K +PYK+VN
Sbjct  72   ITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVN  131

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVK+K
Sbjct  132  KDGKPYIQVKVK  143



>ref|XP_010458175.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=665

 Score =   199 bits (507),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 96/133 (72%), Positives = 111/133 (83%), Gaps = 1/133 (1%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            T+  L  +V + +    S+A E E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGN
Sbjct  12   TNKALVYLVFLTAALMSSVAVEGEEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGN  71

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTD+ERLIGEAAKN AA  PERTIFD KRL+GRKF+D +VQRD+K +PYK+V
Sbjct  72   RITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLMGRKFDDPDVQRDIKFLPYKVV  131

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVK+K
Sbjct  132  NKDGKPYIQVKVK  144



>ref|XP_010475732.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X2 [Camelina sativa]
Length=665

 Score =   199 bits (506),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 110/132 (83%), Gaps = 0/132 (0%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
            T+  L  +V + +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNR
Sbjct  12   TNKALVYLVFLTALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNR  71

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPSWVAFTD+ERLIGEAAKN AA  PERT+FD KRL+GRKF+D +VQRD+K +PYK+VN
Sbjct  72   ITPSWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYKVVN  131

Query  510  KDGKPYIQVKIK  545
            KDGKPYIQVK+K
Sbjct  132  KDGKPYIQVKVK  143



>ref|XP_006423175.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
 gb|ESR36415.1| hypothetical protein CICLE_v10027975mg [Citrus clementina]
Length=655

 Score =   199 bits (505),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAA  401
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  402  SKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
              PERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  131



>ref|XP_006423179.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
 gb|ESR36419.1| hypothetical protein CICLE_v10030400mg [Citrus clementina]
Length=655

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 92/108 (85%), Positives = 101/108 (94%), Gaps = 0/108 (0%)
 Frame = +3

Query  222  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAA  401
            +KLGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AA
Sbjct  24   TKLGTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAA  83

Query  402  SKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
              PERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  84   FNPERTIFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  131



>ref|XP_010674036.1| PREDICTED: luminal-binding protein 5 [Beta vulgaris subsp. vulgaris]
Length=664

 Score =   198 bits (504),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 97/131 (74%), Positives = 106/131 (81%), Gaps = 8/131 (6%)
 Frame = +3

Query  153  SSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            S  L G+ V+        A ++ +  GTVIGIDLGTTYSCVGVYKD  VEIIANDQGNRI
Sbjct  18   SEFLLGVTVL--------AADDQTIKGTVIGIDLGTTYSCVGVYKDGHVEIIANDQGNRI  69

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPSWVAFTDSERL GEAAKN AA  PERTIFDVKRLIGRKF D EVQRDMK++PYK+VN+
Sbjct  70   TPSWVAFTDSERLTGEAAKNQAAINPERTIFDVKRLIGRKFSDPEVQRDMKMLPYKVVNR  129

Query  513  DGKPYIQVKIK  545
            DGKPYIQVK K
Sbjct  130  DGKPYIQVKTK  140



>ref|NP_001184944.1| protein BIP3 [Arabidopsis thaliana]
 gb|AEE28393.1| probable mediator of RNA polymerase II transcription subunit 
37b [Arabidopsis thaliana]
Length=665

 Score =   198 bits (503),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/133 (71%), Positives = 110/133 (83%), Gaps = 1/133 (1%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            R  +I   + +   + + +I  EE  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGN
Sbjct  13   RNKAIACLVFLTALMSSLAIEGEE-QKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGN  71

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTD+ERLIGEAAKN AA  PERTIFD KRLIGRKF+D +VQRD+K +PYK+V
Sbjct  72   RITPSWVAFTDTERLIGEAAKNQAAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVV  131

Query  507  NKDGKPYIQVKIK  545
            NKDGKPYIQVK+K
Sbjct  132  NKDGKPYIQVKVK  144



>ref|XP_010475731.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b isoform X1 [Camelina sativa]
Length=666

 Score =   197 bits (502),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 110/130 (85%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            ++++ + +  +L +    + E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRIT
Sbjct  15   ALVYLVFLTAALMSIVAIEAEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRIT  74

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTD+ERLIGEAAKN AA  PERT+FD KRL+GRKF+D +VQRD+K +PYK+VNKD
Sbjct  75   PSWVAFTDTERLIGEAAKNQAAKNPERTVFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKD  134

Query  516  GKPYIQVKIK  545
            GKPYIQVK+K
Sbjct  135  GKPYIQVKVK  144



>gb|AAB70400.1| Similar to Arabidopsis luminal binding protein (gb|D89342) [Arabidopsis 
thaliana]
Length=655

 Score =   197 bits (501),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 91/110 (83%), Positives = 100/110 (91%), Gaps = 0/110 (0%)
 Frame = +3

Query  216  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNL  395
            E  KLGTVIGIDLGTTYSCVGVY ++ VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN 
Sbjct  9    EEQKLGTVIGIDLGTTYSCVGVYHNKHVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQ  68

Query  396  AASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            AA  PERTIFD KRLIGRKF+D +VQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  69   AAKNPERTIFDPKRLIGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK  118



>ref|XP_010108159.1| Luminal-binding protein 5 [Morus notabilis]
 gb|EXC17991.1| Luminal-binding protein 5 [Morus notabilis]
Length=657

 Score =   196 bits (499),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 94/120 (78%), Positives = 105/120 (88%), Gaps = 1/120 (1%)
 Frame = +3

Query  189  LFAFSIAKEEAS-KLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSE  365
            +F   IA EE+  KLGTVIGIDLGTTYSCVGVYK+  V+IIANDQGNRITPSWVAFTD+E
Sbjct  21   MFGLVIAAEESQPKLGTVIGIDLGTTYSCVGVYKNGHVDIIANDQGNRITPSWVAFTDTE  80

Query  366  RLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            RLIGEAAKN A   P+RTI DVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  81   RLIGEAAKNQAPLNPDRTIIDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  140



>gb|KFK43208.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=659

 Score =   196 bits (499),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/133 (68%), Positives = 108/133 (81%), Gaps = 0/133 (0%)
 Frame = +3

Query  147  RTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGN  326
            ++ + LF ++ I +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIANDQGN
Sbjct  6    KSLAYLFFMIAISALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIANDQGN  65

Query  327  RITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIV  506
            RITPSWVAFTDSERLIGEAAKN A   PE TI D KR IGR+F+D EVQRD+K +PYK+V
Sbjct  66   RITPSWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPYKVV  125

Query  507  NKDGKPYIQVKIK  545
            NKDGKPY QVK+K
Sbjct  126  NKDGKPYFQVKVK  138



>ref|XP_009118328.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b [Brassica rapa]
Length=653

 Score =   195 bits (496),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 93/131 (71%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            ++ + + ++  +F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRI
Sbjct  5    ALAYLVFMMTLVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRI  64

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPSWVAFTD+ERLIGEAAKN AA  PE TIFD KRL+GRKF+D +VQRD+K +PYK+VNK
Sbjct  65   TPSWVAFTDTERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNK  124

Query  513  DGKPYIQVKIK  545
            DGKPYIQVK+K
Sbjct  125  DGKPYIQVKVK  135



>ref|XP_011092383.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=658

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 90/105 (86%), Positives = 100/105 (95%), Gaps = 0/105 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
            GTVIGIDLGTTYSCVGVY++ +VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AA  P
Sbjct  32   GTVIGIDLGTTYSCVGVYRNGKVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNP  91

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            ERTIFDVKRLIGRKF+D EVQRDMK++PYK+V+KDGKPYIQVKI+
Sbjct  92   ERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVDKDGKPYIQVKIR  136



>ref|XP_008388543.1| PREDICTED: luminal-binding protein 5-like [Malus domestica]
Length=662

 Score =   195 bits (495),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 94/137 (69%), Positives = 112/137 (82%), Gaps = 3/137 (2%)
 Frame = +3

Query  144  RRTSSILFGIVVI---GSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            +R  ++ F  +++     L   ++A E++ K+GTVIGIDLGTTYSCV VYK+  VEIIAN
Sbjct  4    KRIHALSFAFLLLFVSEFLCGIAVAAEDSPKVGTVIGIDLGTTYSCVAVYKNGHVEIIAN  63

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTD+ERLIGEAAKN A    ERTIFDVKRLIGRKF+D EVQRD+K +P
Sbjct  64   DQGNRITPSWVAFTDTERLIGEAAKNQAPLNAERTIFDVKRLIGRKFDDPEVQRDIKYLP  123

Query  495  YKIVNKDGKPYIQVKIK  545
            YK+VNKDGKPYIQVK+K
Sbjct  124  YKVVNKDGKPYIQVKVK  140



>ref|XP_010027237.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=667

 Score =   195 bits (496),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 92/111 (83%), Positives = 102/111 (92%), Gaps = 0/111 (0%)
 Frame = +3

Query  213  EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  392
            +++ K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSERLIGEAAKN
Sbjct  32   DDSPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  91

Query  393  LAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
             AA   ERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  92   QAAMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK  142



>emb|CDY06347.1| BnaA09g48560D [Brassica napus]
Length=642

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 105/121 (87%), Gaps = 1/121 (1%)
 Frame = +3

Query  186  SLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS  362
            ++F  S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWVAFTD+
Sbjct  35   AVFMSSVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDT  94

Query  363  ERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            ERLIGEAAKN AA  PE TIFD KRL+GRKF+D +VQRD+K +PYK+VNKDGKPYIQVK+
Sbjct  95   ERLIGEAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKV  154

Query  543  K  545
            K
Sbjct  155  K  155



>gb|KDO56235.1| hypothetical protein CISIN_1g006194mg [Citrus sinensis]
Length=657

 Score =   194 bits (494),  Expect = 7e-55, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 106/124 (85%), Gaps = 5/124 (4%)
 Frame = +3

Query  189  LFAFSIAKEEA-----SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAF  353
            LFAF  +   A     +KLGTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWVAF
Sbjct  13   LFAFEFSLALAAADDATKLGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAF  72

Query  354  TDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQ  533
            TD+ERLIGEAAKN AA   ERT+FDVKRLIGRKF+D EVQRD+K +PYKIVNK GKPYIQ
Sbjct  73   TDTERLIGEAAKNQAALNAERTVFDVKRLIGRKFDDPEVQRDIKFLPYKIVNKGGKPYIQ  132

Query  534  VKIK  545
            VK+K
Sbjct  133  VKVK  136



>emb|CAC37635.1| luminal binding protein, BiP, partial [Scherffelia dubia]
Length=665

 Score =   194 bits (494),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 114/142 (80%), Gaps = 4/142 (3%)
 Frame = +3

Query  120  AMAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRV  299
            AMAG    R  + ++  +  +  L A   A+EEA K+GTVIGIDLGTTYSCVGVYK+ RV
Sbjct  5    AMAG----RGRAFVVSAVCALALLCAVVRAEEEAKKIGTVIGIDLGTTYSCVGVYKNGRV  60

Query  300  EIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRD  479
            EIIANDQGNRITPS+VAFTD+ERLIG+AAKN A S PER ++DVKRLIGRKF DK+VQRD
Sbjct  61   EIIANDQGNRITPSYVAFTDNERLIGDAAKNQATSNPERPVYDVKRLIGRKFTDKDVQRD  120

Query  480  MKLVPYKIVNKDGKPYIQVKIK  545
            MKLV Y I++ +GKPYIQV +K
Sbjct  121  MKLVSYTIIDHNGKPYIQVDVK  142



>ref|XP_010041040.1| PREDICTED: luminal-binding protein 5-like [Eucalyptus grandis]
Length=665

 Score =   194 bits (494),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 92/109 (84%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  219  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLA  398
            + K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSERLIGEAAKN A
Sbjct  33   SPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKNQA  92

Query  399  ASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            A   ERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  93   AMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVKVK  141



>gb|KFK43207.1| hypothetical protein AALP_AA1G094300 [Arabis alpina]
Length=660

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 90/129 (70%), Positives = 104/129 (81%), Gaps = 0/129 (0%)
 Frame = +3

Query  159  ILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  338
            + F I +  +L +  + K E   LGTVIGIDLGTTYSCVGVY+++ VEIIANDQGNRITP
Sbjct  11   LFFMIAISAALMSSEVTKAEEQTLGTVIGIDLGTTYSCVGVYRNKHVEIIANDQGNRITP  70

Query  339  SWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDG  518
            SWVAFTDSERLIGEAAKN A   PE TI D KR IGR+F+D EVQRD+K +PYK+VNKDG
Sbjct  71   SWVAFTDSERLIGEAAKNQATKNPEGTICDPKRFIGRQFDDPEVQRDIKFLPYKVVNKDG  130

Query  519  KPYIQVKIK  545
            KPY QVK+K
Sbjct  131  KPYFQVKVK  139



>ref|XP_007030985.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
 gb|EOY11487.1| Heat shock protein 70 (Hsp 70) family protein [Theobroma cacao]
Length=659

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/138 (71%), Positives = 114/138 (83%), Gaps = 4/138 (3%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLF-AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            A K +   +LF  + I   F   ++A +E +K+GTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  2    AIKNKAFWVLF--LFISEFFLGIAVAADE-TKVGTVIGIDLGTTYSCVGVYKNGHVEIIA  58

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLV  491
            NDQGNRITPSWVAFTD+ERLIGEAAKN AA   ERTIFDVKRLIGRKF+D EVQRD+K +
Sbjct  59   NDQGNRITPSWVAFTDTERLIGEAAKNQAALNAERTIFDVKRLIGRKFDDPEVQRDIKFL  118

Query  492  PYKIVNKDGKPYIQVKIK  545
            PYK+VNKDGKPYIQ+K+K
Sbjct  119  PYKVVNKDGKPYIQIKVK  136



>gb|KJB81015.1| hypothetical protein B456_013G125300 [Gossypium raimondii]
Length=656

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 98/137 (72%), Positives = 111/137 (81%), Gaps = 2/137 (1%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            A K +   +LF + +   L   ++A  + SK+G VIGIDLGTTYSCVGVYK+  VEIIAN
Sbjct  2    AAKNKAFWVLF-LFISEFLLGIAVASND-SKVGAVIGIDLGTTYSCVGVYKNGHVEIIAN  59

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRKF D EVQRD+K +P
Sbjct  60   DQGNRITPSWVAFTDSERLIGEAAKNQAALNAERTIFDVKRLIGRKFNDPEVQRDVKFLP  119

Query  495  YKIVNKDGKPYIQVKIK  545
            YK+VNKDGKPYIQVK+K
Sbjct  120  YKVVNKDGKPYIQVKVK  136



>gb|KDP23486.1| hypothetical protein JCGZ_23319 [Jatropha curcas]
Length=662

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/115 (77%), Positives = 104/115 (90%), Gaps = 0/115 (0%)
 Frame = +3

Query  201  SIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGE  380
            ++A +++ KLGTVIGIDLGTTYSCVGV ++  +EIIANDQGNRITPSWVAFTD+ERLIGE
Sbjct  23   AVAADDSPKLGTVIGIDLGTTYSCVGVSRNGHIEIIANDQGNRITPSWVAFTDTERLIGE  82

Query  381  AAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            AAKN AA  PE T+FDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  83   AAKNQAAFNPENTVFDVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  137



>ref|XP_006417615.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
 gb|ESQ35968.1| hypothetical protein EUTSA_v10009566mg [Eutrema salsugineum]
Length=657

 Score =   194 bits (493),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 94/134 (70%), Positives = 110/134 (82%), Gaps = 2/134 (1%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFS-IAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  323
             + + + + V  SL   S +A E E  K+GTVIGIDLGTTYSCVGVY ++ VEIIANDQG
Sbjct  3    NNPLAYLVFVTASLVLISSVATEGEEQKIGTVIGIDLGTTYSCVGVYHNKHVEIIANDQG  62

Query  324  NRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI  503
            NRITPSWVAFTD+ERLIGEAAKN AA  PERTI D KRL+GRKF+D +VQRD+K +PYK+
Sbjct  63   NRITPSWVAFTDTERLIGEAAKNQAAKNPERTIHDPKRLMGRKFDDPDVQRDIKFLPYKV  122

Query  504  VNKDGKPYIQVKIK  545
            VNKDGKPYIQVK+K
Sbjct  123  VNKDGKPYIQVKVK  136



>emb|CDY22648.1| BnaC08g42820D [Brassica napus]
Length=605

 Score =   192 bits (489),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 92/116 (79%), Positives = 102/116 (88%), Gaps = 1/116 (1%)
 Frame = +3

Query  201  SIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIG  377
            S+A E E  KLGTVIGIDLGTTYSCVGVY +  VEIIANDQGNRITPSWVAFTD+ERLIG
Sbjct  3    SVAIEGEEEKLGTVIGIDLGTTYSCVGVYHNNHVEIIANDQGNRITPSWVAFTDTERLIG  62

Query  378  EAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            EAAKN AA  PE TIFD KRL+GRKF+D +VQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  63   EAAKNQAAKNPEGTIFDPKRLMGRKFDDPDVQRDIKFLPYKVVNKDGKPYIQVKVK  118



>gb|KCW61819.1| hypothetical protein EUGRSUZ_H04513 [Eucalyptus grandis]
Length=618

 Score =   192 bits (489),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 91/109 (83%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +3

Query  213  EEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  392
            +++ K+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTDSERLIGEAAKN
Sbjct  32   DDSPKVGTVIGIDLGTTYSCVGVYKNGHVEIIANDQGNRITPSWVAFTDSERLIGEAAKN  91

Query  393  LAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVK  539
             AA   ERTIFDVKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK
Sbjct  92   QAAMNAERTIFDVKRLIGRKFDDAEVQRDIKYLPYKVVNKDGKPYIQVK  140



>emb|CDP15493.1| unnamed protein product [Coffea canephora]
Length=547

 Score =   191 bits (485),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 111/143 (78%), Gaps = 2/143 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQR  296
            MA  +  +  +  L  + V   L   ++A E++ K  LGTVIGIDLGTTYSCVGVY++  
Sbjct  1    MASSSSVKNKAFWLLLLFVSEFLAGVTLAAEDSQKQNLGTVIGIDLGTTYSCVGVYRNGN  60

Query  297  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQR  476
            VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN AA  PE T+FDVKR IGRKF D EVQR
Sbjct  61   VEIIANDQGNRITPSWVAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRKFNDPEVQR  120

Query  477  DMKLVPYKIVNKDGKPYIQVKIK  545
            DMKL+PYK+VNK GKPYI VK+K
Sbjct  121  DMKLLPYKVVNKVGKPYIDVKMK  143



>ref|XP_010266633.1| PREDICTED: luminal-binding protein 5-like [Nelumbo nucifera]
Length=109

 Score =   179 bits (454),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 88/107 (82%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            GAW++R S I+ GIV+ G L AF+IAKEEA+KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GAWRKRGSLIVLGIVLFGCLSAFAIAKEEATKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  62

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRK  452
            NDQGNRITPSWVAFTDSERLIGEAAKN AA   ERTIFDVKRLIGRK
Sbjct  63   NDQGNRITPSWVAFTDSERLIGEAAKNQAAVNAERTIFDVKRLIGRK  109



>ref|XP_006423186.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
 gb|ESR36426.1| hypothetical protein CICLE_v10030032mg [Citrus clementina]
Length=639

 Score =   192 bits (489),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 104/121 (86%), Gaps = 2/121 (2%)
 Frame = +3

Query  189  LFAFSIA--KEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS  362
            LFA  +A   +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD+
Sbjct  13   LFALRLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDT  72

Query  363  ERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            ERLIGEAAKN AA  PERTIFDVKRLIG KF+D EVQRD+K +PYK+VNK GKPYIQVK+
Sbjct  73   ERLIGEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKVVNKGGKPYIQVKV  132

Query  543  K  545
            K
Sbjct  133  K  133



>ref|XP_011088129.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=656

 Score =   192 bits (488),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 93/126 (74%), Positives = 107/126 (85%), Gaps = 1/126 (1%)
 Frame = +3

Query  171  IVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWV  347
            +++  S F   IA   E+S+  TVIGIDLGTTYSCVGVY+  +++IIANDQGNRITPSWV
Sbjct  11   LLLFASEFLIGIAAAAESSQSQTVIGIDLGTTYSCVGVYRHGKLDIIANDQGNRITPSWV  70

Query  348  AFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPY  527
            AFTD+ERLIGEAAKN A   PERTIFDVKRLIGRKF+D EVQRDMK++PYK+V KDGKPY
Sbjct  71   AFTDTERLIGEAAKNQATLNPERTIFDVKRLIGRKFDDPEVQRDMKMLPYKVVVKDGKPY  130

Query  528  IQVKIK  545
            IQVKIK
Sbjct  131  IQVKIK  136



>ref|XP_007206318.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
 gb|EMJ07517.1| hypothetical protein PRUPE_ppa002572mg [Prunus persica]
Length=657

 Score =   191 bits (486),  Expect = 9e-54, Method: Compositional matrix adjust.
 Identities = 93/119 (78%), Positives = 103/119 (87%), Gaps = 0/119 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            LF  + A   +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTD+ER
Sbjct  16   LFISASAAGGSSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSWVAFTDTER  75

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            LIGEAAKN A    ERTIF VKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  76   LIGEAAKNQAPLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  134



>ref|XP_004302398.1| PREDICTED: luminal-binding protein 4 [Fragaria vesca subsp. vesca]
Length=662

 Score =   191 bits (486),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 93/134 (69%), Positives = 108/134 (81%), Gaps = 1/134 (1%)
 Frame = +3

Query  147  RTSSILFGIVVIGS-LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  323
            R  S+ F ++ +   L   ++A E +S  GTVIGIDLGTTYSCVGVY++  VEII NDQG
Sbjct  5    RALSLTFLLLFVSEFLCGIALAAEGSSTPGTVIGIDLGTTYSCVGVYRNGNVEIIVNDQG  64

Query  324  NRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI  503
            NRITPSWVAFTD+ERLIGEAAKN A    ERTIFDVKRLIGRKF D EVQRD+K +PYK+
Sbjct  65   NRITPSWVAFTDTERLIGEAAKNQAPQNAERTIFDVKRLIGRKFNDPEVQRDIKFLPYKV  124

Query  504  VNKDGKPYIQVKIK  545
            VNK+GKPYIQVK+K
Sbjct  125  VNKEGKPYIQVKVK  138



>ref|XP_006480058.1| PREDICTED: luminal-binding protein 5-like [Citrus sinensis]
Length=661

 Score =   191 bits (485),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  195  AFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLI  374
              + A +  +KL TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD+ERLI
Sbjct  21   GLAAADDTTTKLKTVIGIDLGTTYSCVGVYRNDHVEIIANDQGNRITPSWVAFTDTERLI  80

Query  375  GEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            GEAAKN AA  PERTIFDVKRLIG KF+D EVQRD+K +PYK+VNK GKPYIQVK+K
Sbjct  81   GEAAKNQAALNPERTIFDVKRLIGGKFDDPEVQRDIKFLPYKVVNKGGKPYIQVKVK  137



>ref|XP_008246412.1| PREDICTED: luminal-binding protein 5 [Prunus mume]
Length=664

 Score =   190 bits (483),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 90/109 (83%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +3

Query  219  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLA  398
            +SK+GTVIGIDLGTTYSCVGVYK+  VEIIANDQGNRITPSWVAFTD+ERLIGEAAKN A
Sbjct  32   SSKVGTVIGIDLGTTYSCVGVYKNGNVEIIANDQGNRITPSWVAFTDTERLIGEAAKNQA  91

Query  399  ASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
                ERTIF VKRLIGRKF+D EVQRD+K +PYK+VNKDGKPYIQVK+K
Sbjct  92   PLNAERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKDGKPYIQVKVK  140



>ref|XP_011092073.1| PREDICTED: luminal-binding protein 5-like [Sesamum indicum]
Length=657

 Score =   189 bits (481),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 89/131 (68%), Positives = 110/131 (84%), Gaps = 1/131 (1%)
 Frame = +3

Query  156  SILFGIVVIG-SLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            ++LF  +++  S  A +    +   LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRI
Sbjct  5    NVLFCFLLLFVSGIAIAAQDSQNRDLGTVIGIDLGTTYSCVGVYTNGKVEIIANDQGNRI  64

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPSWVAFT+++RLIGEAAKN AA  PERT+FDVKRLIGRKF+D +VQRDMK++PY++V+K
Sbjct  65   TPSWVAFTNTDRLIGEAAKNQAALNPERTVFDVKRLIGRKFDDPDVQRDMKMLPYQVVDK  124

Query  513  DGKPYIQVKIK  545
            DGKPY+QVK K
Sbjct  125  DGKPYVQVKTK  135



>emb|CDP16233.1| unnamed protein product [Coffea canephora]
Length=592

 Score =   188 bits (478),  Expect = 8e-53, Method: Compositional matrix adjust.
 Identities = 90/127 (71%), Positives = 102/127 (80%), Gaps = 0/127 (0%)
 Frame = +3

Query  165  FGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSW  344
            F I+    +F F +       LGTVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSW
Sbjct  36   FLILYFSWVFFFFLHVYFHQNLGTVIGIDLGTTYSCVGVYRNGNVEIIANDQGNRITPSW  95

Query  345  VAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKP  524
            VAFTD+ERLIGEAAKN AA  PE T+FDVKR IGR+ +D EVQRDMKL+PYK+ NKDGKP
Sbjct  96   VAFTDTERLIGEAAKNQAALNPESTVFDVKRFIGRRVDDPEVQRDMKLLPYKVANKDGKP  155

Query  525  YIQVKIK  545
            YI VK+K
Sbjct  156  YIDVKMK  162



>ref|XP_002318993.2| heat shock protein 70 cognate [Populus trichocarpa]
 gb|EEE94916.2| heat shock protein 70 cognate [Populus trichocarpa]
Length=660

 Score =   189 bits (479),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 103/130 (79%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            + LF  V         +A ++  KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+T
Sbjct  10   AFLFLFVSEYYFLGLVVAADDGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTD+ERLIGEAAKN A   PERTIF VKRLIGRKF+D EVQRD+K +PYK+VNKD
Sbjct  70   PSWVAFTDTERLIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKD  129

Query  516  GKPYIQVKIK  545
            GK YIQVK+K
Sbjct  130  GKSYIQVKVK  139



>gb|KIY96078.1| heat shock 70kDa protein 5 [Monoraphidium neglectum]
Length=433

 Score =   184 bits (468),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 88/118 (75%), Positives = 101/118 (86%), Gaps = 0/118 (0%)
 Frame = +3

Query  189  LFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSER  368
            +F  ++  +E  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+VAFTDSER
Sbjct  18   VFGMAVQAKEEEKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSER  77

Query  369  LIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            LIG+AAKN A   P+RTI+DVKRLIGRKFEDKEVQRD KL+ Y IV+K GKP +QV +
Sbjct  78   LIGDAAKNQATVNPKRTIYDVKRLIGRKFEDKEVQRDKKLMSYDIVDKAGKPMVQVDV  135



>ref|XP_011023674.1| PREDICTED: luminal-binding protein 4-like [Populus euphratica]
Length=660

 Score =   187 bits (475),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 91/130 (70%), Positives = 102/130 (78%), Gaps = 0/130 (0%)
 Frame = +3

Query  156  SILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            + LF  V         +A +   KLGTVIGIDLGTTYSCV V +D  VEIIANDQGNR+T
Sbjct  10   AFLFLFVSEYYFLGLVVAADGGPKLGTVIGIDLGTTYSCVAVSRDGHVEIIANDQGNRVT  69

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTD+ERLIGEAAKN A   PERTIF VKRLIGRKF+D EVQRD+K +PYK+VNKD
Sbjct  70   PSWVAFTDTERLIGEAAKNQAPMNPERTIFGVKRLIGRKFDDPEVQRDIKFLPYKVVNKD  129

Query  516  GKPYIQVKIK  545
            GK YIQVK+K
Sbjct  130  GKSYIQVKVK  139



>dbj|BAA76421.1| dnaK-type molecular chaperone [Cicer arietinum]
Length=109

 Score =   173 bits (439),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 87/108 (81%), Positives = 93/108 (86%), Gaps = 1/108 (1%)
 Frame = +3

Query  132  GAWKRRTSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIA  311
            G+WK  +  +L  I+  G LFA SIAKEE +KLGTVIGIDLGTTYSCVGVYK+  VEIIA
Sbjct  3    GSWKCGSLFVL-AIISFGCLFAISIAKEEGTKLGTVIGIDLGTTYSCVGVYKNGHVEIIA  61

Query  312  NDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKF  455
            NDQGNRITPSWVAFTDSERLIGEAAKNLAA  PERTIFDVKRLIGRKF
Sbjct  62   NDQGNRITPSWVAFTDSERLIGEAAKNLAAVNPERTIFDVKRLIGRKF  109



>ref|XP_009766974.1| PREDICTED: luminal-binding protein 5-like [Nicotiana sylvestris]
Length=667

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +3

Query  198  FSIAKEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVAFTDSERLI  374
             +  K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWVAFTD+ERLI
Sbjct  29   LAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLI  88

Query  375  GEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            GEAAKN AA  PERTI+DVKRLIGRKF+D EVQ+ +K++P+++VNKDGKPY+QVKIK
Sbjct  89   GEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKDGKPYVQVKIK  145



>ref|XP_009622355.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Nicotiana tomentosiformis]
Length=668

 Score =   186 bits (471),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 102/117 (87%), Gaps = 1/117 (1%)
 Frame = +3

Query  198  FSIAKEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVAFTDSERLI  374
             +  K +   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWVAFTD+ERLI
Sbjct  29   LAAEKNQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLI  88

Query  375  GEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            GEAAKN AA  PERTI+DVKRLIGRKF+D EVQ+ +K++P+++VNKDGKPY+QVKIK
Sbjct  89   GEAAKNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFEVVNKDGKPYVQVKIK  145



>ref|XP_005842772.1| hypothetical protein CHLNCDRAFT_144025, partial [Chlorella variabilis]
 gb|EFN50655.1| hypothetical protein CHLNCDRAFT_144025 [Chlorella variabilis]
Length=310

 Score =   179 bits (453),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 84/109 (77%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  216  EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNL  395
            E  KLGTVIGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPS+VAFTD+ERLIG+AAKN 
Sbjct  30   EQEKLGTVIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSYVAFTDTERLIGDAAKNQ  89

Query  396  AASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            A   P+RT++DVKRLIGRKF D EVQRD KLV Y IV+K  KPYIQV++
Sbjct  90   ATVNPKRTVYDVKRLIGRKFSDAEVQRDAKLVSYNIVDKQSKPYIQVEV  138



>emb|CDP16834.1| unnamed protein product [Coffea canephora]
Length=577

 Score =   184 bits (467),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/121 (73%), Positives = 100/121 (83%), Gaps = 2/121 (2%)
 Frame = +3

Query  189  LFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS  362
            L   ++A E   K  LGTVIGI+LGTTYSCVGVY++  VEII NDQGNRITPSWVAFTD+
Sbjct  23   LAGIALAAEGTQKQNLGTVIGIELGTTYSCVGVYRNGNVEIIPNDQGNRITPSWVAFTDT  82

Query  363  ERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            ERLIGEAAKN AA  PE T+FDVKR IGR+ +D EVQRDMKL+PYK+ NKDGKPYI VK+
Sbjct  83   ERLIGEAAKNQAALNPESTVFDVKRFIGRRVDDPEVQRDMKLLPYKVANKDGKPYIDVKM  142

Query  543  K  545
            K
Sbjct  143  K  143



>ref|XP_007509232.1| heat shock protein 70 [Bathycoccus prasinos]
 emb|CCO19689.1| heat shock protein 70 [Bathycoccus prasinos]
Length=263

 Score =   177 bits (448),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 84/129 (65%), Positives = 104/129 (81%), Gaps = 1/129 (1%)
 Frame = +3

Query  159  ILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  338
            ILF +  +  L + + A +   KLGTVIGIDLGTTYSCVG Y + +VEIIANDQGNRITP
Sbjct  5    ILFPVSFVLLLLS-AFADDSGEKLGTVIGIDLGTTYSCVGAYVNGKVEIIANDQGNRITP  63

Query  339  SWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDG  518
            S+VAFTD+ERLIG+AAKN A S P RT+FD KRLIGRK+ DK+VQRD+K+ P+K+VNK+ 
Sbjct  64   SYVAFTDTERLIGDAAKNQATSNPTRTVFDAKRLIGRKYSDKDVQRDLKMFPFKVVNKES  123

Query  519  KPYIQVKIK  545
            KP I+V +K
Sbjct  124  KPCIEVDLK  132



>ref|XP_006344666.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a-like [Solanum tuberosum]
Length=669

 Score =   184 bits (468),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 88/113 (78%), Positives = 101/113 (89%), Gaps = 1/113 (1%)
 Frame = +3

Query  210  KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            K++   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWVAFTD+ERLIGEAA
Sbjct  34   KKQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAA  93

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            KN AA  PERTI+DVKRLIGRKF+D EVQ+ +K++P+ IVNKDGKPY++VKIK
Sbjct  94   KNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFNIVNKDGKPYVEVKIK  146



>gb|EYU18532.1| hypothetical protein MIMGU_mgv1a022234mg, partial [Erythranthe 
guttata]
Length=625

 Score =   183 bits (465),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 84/103 (82%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  234  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPE  413
            T+IGIDLGTTYSCVGVY+  ++EIIANDQGNRITPSWVAFTD+ERLIGEAAKN A+  PE
Sbjct  1    TIIGIDLGTTYSCVGVYRQGKLEIIANDQGNRITPSWVAFTDTERLIGEAAKNQASLNPE  60

Query  414  RTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            RTIFDVKRLIGRKF+D EVQRDMK++PYK+V+KDGK YI+VKI
Sbjct  61   RTIFDVKRLIGRKFDDVEVQRDMKMLPYKVVDKDGKAYIEVKI  103



>ref|XP_010553728.1| PREDICTED: LOW QUALITY PROTEIN: probable mediator of RNA polymerase 
II transcription subunit 37b [Tarenaya hassleriana]
Length=658

 Score =   183 bits (464),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 89/130 (68%), Positives = 106/130 (82%), Gaps = 1/130 (1%)
 Frame = +3

Query  159  ILFGIVVIGSLFAFSIAKE-EASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
            + F + V  S F  ++  + E  KLGTVIGIDLGTTYSCVGV+++  VEIIANDQGNRIT
Sbjct  9    LYFLLFVAASAFMSNLMIDGEEQKLGTVIGIDLGTTYSCVGVFRNGHVEIIANDQGNRIT  68

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PSWVAFTDSERLIGEAAKN AA  PERT+ D KRLIGR+F+D EVQ ++K + YK+VNKD
Sbjct  69   PSWVAFTDSERLIGEAAKNQAAMNPERTVSDAKRLIGRRFDDPEVQGNVKYLSYKVVNKD  128

Query  516  GKPYIQVKIK  545
            GKPYIQ+K+K
Sbjct  129  GKPYIQMKVK  138



>ref|XP_003055985.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
 gb|EEH59361.1| luminal binding heat shock protein 70 [Micromonas pusilla CCMP1545]
Length=659

 Score =   182 bits (462),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 87/132 (66%), Positives = 107/132 (81%), Gaps = 2/132 (2%)
 Frame = +3

Query  150  TSSILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNR  329
            T S+L  ++ + +L   +  +E   +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNR
Sbjct  6    TRSLL--VIFLATLVGAANGQEATEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGNR  63

Query  330  ITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVN  509
            ITPS+VAFTDSERLIG+AAKN A + P RT+FD KRLIGRKF DKEVQRD+K+ P+K+VN
Sbjct  64   ITPSYVAFTDSERLIGDAAKNQATANPTRTVFDAKRLIGRKFTDKEVQRDVKMFPFKVVN  123

Query  510  KDGKPYIQVKIK  545
            KD KP I+V +K
Sbjct  124  KDSKPCIEVDLK  135



>ref|XP_006472126.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
 ref|XP_006472127.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
Length=503

 Score =   179 bits (454),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 81/103 (79%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +3

Query  237  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPER  416
            VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+AFTD+ERLIGEAAKN AA  PER
Sbjct  41   VIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPER  100

Query  417  TIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            TIFDVKRLIG++F+D EVQRD+K +PYK+VNKDGKPY+QVK+K
Sbjct  101  TIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVKVK  143



>ref|XP_002507118.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
 gb|ACO68376.1| heat shock binding protein 70, ER luminal [Micromonas sp. RCC299]
Length=660

 Score =   181 bits (459),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 87/127 (69%), Positives = 104/127 (82%), Gaps = 3/127 (2%)
 Frame = +3

Query  165  FGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSW  344
            F  VV   L   + A+E + +LGTVIGIDLGTTYSCVGVY + +VEIIANDQGNRITPS+
Sbjct  14   FATVV---LLQGTKAEESSEQLGTVIGIDLGTTYSCVGVYVNGKVEIIANDQGNRITPSY  70

Query  345  VAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKP  524
            VAFTD ERLIG+AAKN A + P RT+FD KRLIGRK+ DKEVQRDMK+ P+K+VNKD KP
Sbjct  71   VAFTDGERLIGDAAKNQATANPTRTVFDAKRLIGRKYTDKEVQRDMKMFPFKVVNKDSKP  130

Query  525  YIQVKIK  545
             I+V++K
Sbjct  131  CIEVELK  137



>gb|EAY91599.1| hypothetical protein OsI_13234 [Oryza sativa Indica Group]
Length=426

 Score =   177 bits (450),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWVAFTD ERL+GEAAKN AA  P
Sbjct  37   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNP  96

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            +RTIFD+KRLIGR+F+D+EVQRD+K +PYK+V+K GKPY++V++K
Sbjct  97   DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVK  141



>ref|XP_006472125.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like, partial [Citrus sinensis]
Length=435

 Score =   177 bits (449),  Expect = 8e-50, Method: Compositional matrix adjust.
 Identities = 80/104 (77%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  234  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPE  413
             VIGID+GTTYS VG+Y+D  VEIIANDQGNR TPSW+AFTD+ERLIGEAAKN AA  PE
Sbjct  32   AVIGIDMGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPE  91

Query  414  RTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            RTIFDVKRLIG++F+D EVQRD+K +PYK+VNKDGKPY+QV +K
Sbjct  92   RTIFDVKRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVNVK  135



>ref|XP_006472128.1| PREDICTED: probable mediator of RNA polymerase II transcription 
subunit 37b-like [Citrus sinensis]
Length=108

 Score =   167 bits (424),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 76/98 (78%), Positives = 89/98 (91%), Gaps = 0/98 (0%)
 Frame = +3

Query  252  LGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDV  431
            +GTTYS VG+Y+D  VEIIANDQGNR TPSW+AFTD+ERLIGEAAKN AA  PERTIFDV
Sbjct  1    MGTTYSRVGLYRDGHVEIIANDQGNRFTPSWIAFTDTERLIGEAAKNQAALDPERTIFDV  60

Query  432  KRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            KRLIG++F+D EVQRD+K +PYK+VNKDGKPY+QVK+K
Sbjct  61   KRLIGKRFDDPEVQRDIKFLPYKVVNKDGKPYVQVKVK  98



>ref|XP_001701685.1| binding protein 1 [Chlamydomonas reinhardtii]
 gb|EDP06660.1| binding protein 1 [Chlamydomonas reinhardtii]
Length=656

 Score =   180 bits (457),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 87/118 (74%), Positives = 100/118 (85%), Gaps = 1/118 (1%)
 Frame = +3

Query  192  FAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERL  371
            + F +  EE  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+VAFTD ERL
Sbjct  18   YGFGVWAEE-EKLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDEERL  76

Query  372  IGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            IG+AAKN A   P+RT++DVKRLIGRK+EDKEVQRD KLV Y IV++ GKPY+ V +K
Sbjct  77   IGDAAKNQATVNPKRTVYDVKRLIGRKYEDKEVQRDKKLVSYDIVDRQGKPYVAVDVK  134



>gb|EEC79268.1| hypothetical protein OsI_20053 [Oryza sativa Indica Group]
Length=433

 Score =   177 bits (448),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +3

Query  234  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS-ERLIGEAAKNLAASKP  410
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWVAFTD  ERLIGEAAKN AA+ P
Sbjct  57   TVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  116

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++K
Sbjct  117  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVK  161



>ref|XP_002949576.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
 gb|EFJ49128.1| luminal binding protein Bip1 [Volvox carteri f. nagariensis]
Length=653

 Score =   180 bits (456),  Expect = 1e-49, Method: Compositional matrix adjust.
 Identities = 89/112 (79%), Positives = 98/112 (88%), Gaps = 2/112 (2%)
 Frame = +3

Query  207  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            A EE  KLGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+VAFTDSERLIG+AA
Sbjct  22   ASEE--KLGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAA  79

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            KN A   P+RTI+DVKRLIGR+FEDKEVQRD KLV Y IV+K GKPY+ V +
Sbjct  80   KNQATVNPKRTIYDVKRLIGRRFEDKEVQRDKKLVSYDIVDKSGKPYVSVDV  131



>ref|XP_005651681.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
 gb|EIE27137.1| binding protein 1 [Coccomyxa subellipsoidea C-169]
Length=639

 Score =   179 bits (454),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  228  LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASK  407
            LGTVIGIDLGTTYSCVGVYK+ RVEIIANDQGNRITPS+VAFTDSERLIG+AAKN A + 
Sbjct  11   LGTVIGIDLGTTYSCVGVYKNGRVEIIANDQGNRITPSYVAFTDSERLIGDAAKNQATTN  70

Query  408  PERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            P+RT++DVKRLIGRKF+DKEVQRD K+V YK+V+K  KPY++V I
Sbjct  71   PDRTVYDVKRLIGRKFKDKEVQRDAKMVSYKVVDKAAKPYVEVTI  115



>ref|XP_004230233.1| PREDICTED: mediator of RNA polymerase II transcription subunit 
37a [Solanum lycopersicum]
Length=669

 Score =   179 bits (454),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 85/113 (75%), Positives = 100/113 (88%), Gaps = 1/113 (1%)
 Frame = +3

Query  210  KEEASKLGTVIGIDLGTTYSCVGVYK-DQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            K++   LGTVIGIDLGTTYSCVGVYK +  VEIIANDQGNRITPSWVAFTD+ERLIGEAA
Sbjct  34   KKQKQNLGTVIGIDLGTTYSCVGVYKGENNVEIIANDQGNRITPSWVAFTDTERLIGEAA  93

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            KN AA  PERTI+DVKRLIGRKF+D EVQ+ +K++P+ +VNK GKP+++VKIK
Sbjct  94   KNQAALNPERTIYDVKRLIGRKFDDPEVQKIIKMLPFNVVNKAGKPHVEVKIK  146



>ref|XP_006650483.1| PREDICTED: luminal-binding protein 4-like [Oryza brachyantha]
Length=665

 Score =   178 bits (452),  Expect = 5e-49, Method: Compositional matrix adjust.
 Identities = 78/103 (76%), Positives = 96/103 (93%), Gaps = 0/103 (0%)
 Frame = +3

Query  237  VIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPER  416
            VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWVAFTD ERL+GEAAKN AA  P+R
Sbjct  39   VIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNPDR  98

Query  417  TIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            TIFD+KRLIGR+F+D+EVQRD+K +PYK+V+KDGKPY++V++K
Sbjct  99   TIFDIKRLIGRRFDDEEVQRDVKYLPYKVVSKDGKPYVEVRVK  141



>dbj|BAJ89190.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=667

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 84/116 (72%), Positives = 98/116 (84%), Gaps = 1/116 (1%)
 Frame = +3

Query  201  SIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS-ERLIG  377
            + A  E    GTVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWVAFTD  ERLIG
Sbjct  28   AAAPAEGGSTGTVIGIDLGTTYSCVGVYRNGRVEIIANDQGNRITPSWVAFTDGGERLIG  87

Query  378  EAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            EAAKN AA+ PERTI+D KRLIGR F D  VQRD+KL+PY +V+++GKP+IQV++K
Sbjct  88   EAAKNQAAANPERTIYDAKRLIGRDFADAVVQRDIKLLPYSVVDRNGKPHIQVQVK  143



>ref|NP_001051048.1| Os03g0710500 [Oryza sativa Japonica Group]
 gb|AAX95660.1| dnaK protein [Oryza sativa Japonica Group]
 gb|ABF98501.1| Luminal binding protein 5 precursor, putative, expressed [Oryza 
sativa Japonica Group]
 dbj|BAF12962.1| Os03g0710500 [Oryza sativa Japonica Group]
Length=669

 Score =   178 bits (451),  Expect = 8e-49, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWVAFTD ERL+GEAAKN AA  P
Sbjct  37   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNP  96

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            +RTIFD+KRLIGR+F+D+EVQRD+K +PYK+V+K GKPY++V++K
Sbjct  97   DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVK  141



>gb|EEE59790.1| hypothetical protein OsJ_12307 [Oryza sativa Japonica Group]
Length=726

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 78/105 (74%), Positives = 96/105 (91%), Gaps = 0/105 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWVAFTD ERL+GEAAKN AA  P
Sbjct  94   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDDERLVGEAAKNQAALNP  153

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            +RTIFD+KRLIGR+F+D+EVQRD+K +PYK+V+K GKPY++V++K
Sbjct  154  DRTIFDIKRLIGRRFDDEEVQRDVKYLPYKVVDKGGKPYVEVRVK  198



>gb|KDD73887.1| heat shock protein 70 Hsp70 [Helicosporidium sp. ATCC 50920]
Length=651

 Score =   177 bits (449),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 86/129 (67%), Positives = 100/129 (78%), Gaps = 2/129 (2%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSIAKEEASK--LGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRIT  335
             F + V+      + AKEE  K  +GTVIGIDLGTTYSCVGVYK+ +VEII NDQGNRIT
Sbjct  3    FFCLAVVALCAGTAFAKEEEKKENVGTVIGIDLGTTYSCVGVYKNGKVEIIPNDQGNRIT  62

Query  336  PSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKD  515
            PS+VAFTD ERLIG+AAKN A S P+RTI+DVKRLIGR F D  VQRDMKLV Y +VN  
Sbjct  63   PSYVAFTDGERLIGDAAKNQATSNPKRTIYDVKRLIGRDFNDANVQRDMKLVSYDLVNNG  122

Query  516  GKPYIQVKI  542
            GKPY+ V++
Sbjct  123  GKPYVSVEV  131



>ref|NP_001055613.1| Os05g0428600 [Oryza sativa Japonica Group]
 gb|AAS90667.1| putative Luminal binding protein [Oryza sativa Japonica Group]
 gb|AAV59416.1| putative luminal binding protein 5 [Oryza sativa Japonica Group]
 dbj|BAF17527.1| Os05g0428600 [Oryza sativa Japonica Group]
Length=687

 Score =   177 bits (448),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 80/105 (76%), Positives = 96/105 (91%), Gaps = 1/105 (1%)
 Frame = +3

Query  234  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS-ERLIGEAAKNLAASKP  410
            TVIGIDLGTTYSCVGVY++ RVEIIANDQGNRITPSWVAFTD  ERLIGEAAKN AA+ P
Sbjct  57   TVIGIDLGTTYSCVGVYRNDRVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  116

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++K
Sbjct  117  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVK  161



>emb|CCO34015.1| 78 kDa glucose-regulated protein homolog Short=GRP-78 [Rhizoctonia 
solani AG-1 IB]
Length=161

 Score =   166 bits (419),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 85/143 (59%), Positives = 106/143 (74%), Gaps = 2/143 (1%)
 Frame = +3

Query  123  MAGGAWKRRTSSILFGIV-VIGSLFAFSIAKEEASK-LGTVIGIDLGTTYSCVGVYKDQR  296
            MA    +   +S++F ++ VI ++    +A+ +  K  GTVIGIDLGTTYSCVGV++  R
Sbjct  1    MAARPSRSYAASVVFILLAVIAAICLVPVARADDDKNYGTVIGIDLGTTYSCVGVHRGGR  60

Query  297  VEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQR  476
            VEIIANDQGNRITPSWV F D ERLIG+AAK    + P +T+FD KRLIGRKFED E++R
Sbjct  61   VEIIANDQGNRITPSWVQFGDDERLIGDAAKAAFHTSPSQTVFDAKRLIGRKFEDPELKR  120

Query  477  DMKLVPYKIVNKDGKPYIQVKIK  545
            DMK  P+K+VNK GKP IQVK K
Sbjct  121  DMKHWPFKVVNKGGKPMIQVKNK  143



>ref|XP_011127440.1| hypothetical protein AOL_s00210g337 [Arthrobotrys oligospora 
ATCC 24927]
 gb|EGX43890.1| hypothetical protein AOL_s00210g337 [Arthrobotrys oligospora 
ATCC 24927]
Length=672

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 79/124 (64%), Positives = 102/124 (82%), Gaps = 0/124 (0%)
 Frame = +3

Query  171  IVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVA  350
            + +IG+  A +   + A   GTVIGIDLGTTYSCVGV +  +VEIIANDQGNRITPSWVA
Sbjct  24   LALIGTAHADANTNDTADSYGTVIGIDLGTTYSCVGVMQKGKVEIIANDQGNRITPSWVA  83

Query  351  FTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYI  530
            FTD ERL+G+AAKN AA+ P+RTIFD+KRLIGRKF + +VQ+D+K  P+ +VNKDGKP++
Sbjct  84   FTDDERLVGDAAKNQAAANPKRTIFDIKRLIGRKFSESDVQKDIKHFPFDVVNKDGKPHV  143

Query  531  QVKI  542
            +V++
Sbjct  144  KVEV  147



>ref|XP_001701884.1| binding protein 2 [Chlamydomonas reinhardtii]
 gb|EDP06859.1| binding protein 2 [Chlamydomonas reinhardtii]
Length=662

 Score =   176 bits (447),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 103/137 (75%), Gaps = 9/137 (7%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSI---------AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIAN  314
            + G+ +I +L A S          A     KLGTVIGIDLGTTYSCVGVYK+ RVEIIAN
Sbjct  1    MVGLGLIATLVAASALASIPQAKAASPTTDKLGTVIGIDLGTTYSCVGVYKNGRVEIIAN  60

Query  315  DQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVP  494
            DQGNRITPS+VAFTD ERLIG+AAKN A   P+RTI+DVKRLIGRKF D +VQRD KLV 
Sbjct  61   DQGNRITPSYVAFTDEERLIGDAAKNQATVNPKRTIYDVKRLIGRKFSDADVQRDRKLVS  120

Query  495  YKIVNKDGKPYIQVKIK  545
            Y IV++ GKPY+ V +K
Sbjct  121  YDIVDRQGKPYVAVDVK  137



>ref|XP_002466589.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
 gb|EER93587.1| hypothetical protein SORBIDRAFT_01g010460 [Sorghum bicolor]
Length=676

 Score =   176 bits (446),  Expect = 4e-48, Method: Compositional matrix adjust.
 Identities = 77/105 (73%), Positives = 94/105 (90%), Gaps = 0/105 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
            G VIGIDLGTTYSCVGVY++  V+I+ANDQGNRITPSWVAFTD ERL+GEAAKN A   P
Sbjct  43   GPVIGIDLGTTYSCVGVYRNGHVDIVANDQGNRITPSWVAFTDEERLVGEAAKNQAPLNP  102

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            +RTIFD+KRLIGR+F+D+EVQRD++ +PYK+VNK GKPY++V +K
Sbjct  103  QRTIFDIKRLIGRRFDDEEVQRDVRYLPYKVVNKGGKPYVEVPMK  147



>ref|XP_004351156.1| heat shock protein Hsp70 family protein [Dictyostelium fasciculatum]
 gb|EGG14648.1| heat shock protein Hsp70 family protein [Dictyostelium fasciculatum]
Length=1193

 Score =   179 bits (453),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 90/168 (54%), Positives = 119/168 (71%), Gaps = 1/168 (1%)
 Frame = +3

Query  42   KIHGKVEIEQWNHF*LARTKTQSDPRAMAGGAWKRRTSSILFGIVVIGSLFAFSIAKEEA  221
            ++H ++   Q N F      T  +         K ++  +LF I ++ + F  S A E+ 
Sbjct  507  EVHRRLFFVQQNSFFTLSIYTIYNINLSLSQRMKLQSLFVLFTIALLATSF-ISTATEDE  565

Query  222  SKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAA  401
              +G VIGIDLGTTYSCVG++K+ RVEII N+QGNRITPS+VAFTD+ERLIGEAAKN A 
Sbjct  566  KVIGDVIGIDLGTTYSCVGIFKNGRVEIIPNEQGNRITPSYVAFTDTERLIGEAAKNQAT  625

Query  402  SKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
              PE T+FD+KRLIGRKF D+EVQ+D+KL+PYKI++K  KP+I VK+K
Sbjct  626  LNPENTVFDIKRLIGRKFSDQEVQKDLKLLPYKIISKGDKPHIVVKVK  673



>ref|XP_002971962.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
 gb|EFJ26879.1| hypothetical protein SELMODRAFT_412732 [Selaginella moellendorffii]
Length=654

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 87/128 (68%), Positives = 101/128 (79%), Gaps = 7/128 (5%)
 Frame = +3

Query  159  ILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  338
            IL  + +   LF  +I         T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITP
Sbjct  7    ILPCLFITAWLFLITIN-------ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITP  59

Query  339  SWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDG  518
            SWVAFT++ERLIGEAAKN A S P RTI DVKRLIG K++DKEVQRDMK + +KIVNKDG
Sbjct  60   SWVAFTENERLIGEAAKNQATSNPTRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDG  119

Query  519  KPYIQVKI  542
            KPYI+V++
Sbjct  120  KPYIEVEV  127



>ref|XP_002977324.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
 gb|EFJ21328.1| hypothetical protein SELMODRAFT_417280 [Selaginella moellendorffii]
Length=654

 Score =   176 bits (445),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 82/104 (79%), Positives = 93/104 (89%), Gaps = 0/104 (0%)
 Frame = +3

Query  231  GTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKP  410
             T IGIDLGTTYSCVGVYK+ +VEIIANDQGNRITPSWVAFT++ERLIGEAAKN A S P
Sbjct  24   ATSIGIDLGTTYSCVGVYKNGKVEIIANDQGNRITPSWVAFTENERLIGEAAKNQATSNP  83

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
             RTI DVKRLIG K++DKEVQRDMK + +KIVNKDGKPYI+V++
Sbjct  84   TRTIHDVKRLIGMKYDDKEVQRDMKHLGFKIVNKDGKPYIEVEV  127



>ref|XP_004986284.1| PREDICTED: luminal-binding protein 4-like [Setaria italica]
Length=679

 Score =   176 bits (445),  Expect = 6e-48, Method: Compositional matrix adjust.
 Identities = 78/109 (72%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +3

Query  219  ASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAAKNLA  398
            AS  G VIGIDLGTTYSCVG Y++  V+IIANDQGNRITPSWVAFTD ERL+GEAAKN A
Sbjct  38   ASASGPVIGIDLGTTYSCVGAYQNGHVDIIANDQGNRITPSWVAFTDDERLVGEAAKNQA  97

Query  399  ASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
               P+RTIFD+KRLIGR+F+D+EVQRD++ +PYK+VN+ GKPY++V +K
Sbjct  98   PLNPQRTIFDIKRLIGRRFDDEEVQRDIRYLPYKVVNRGGKPYVEVPMK  146



>gb|EEC83049.1| hypothetical protein OsI_28153 [Oryza sativa Indica Group]
Length=529

 Score =   174 bits (440),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 79/105 (75%), Positives = 95/105 (90%), Gaps = 1/105 (1%)
 Frame = +3

Query  234  TVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS-ERLIGEAAKNLAASKP  410
            TVIGIDLGTTYSCVGVY++  VEIIANDQGNRITPSWVAFTD  ERLIGEAAKN AA+ P
Sbjct  133  TVIGIDLGTTYSCVGVYRNGHVEIIANDQGNRITPSWVAFTDGGERLIGEAAKNQAAANP  192

Query  411  ERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKIK  545
            ERTI+D KRLIGR+F D EVQRDMKL+P+ +V+++GKP+++V++K
Sbjct  193  ERTIYDAKRLIGRQFSDAEVQRDMKLLPFAVVDRNGKPHVRVEVK  237



>gb|AER57864.1| heat shock 70 family protein [Acytostelium subglobosum]
 dbj|GAM18155.1| hypothetical protein SAMD00019534_013300 [Acytostelium subglobosum 
LB1]
Length=655

 Score =   175 bits (443),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 85/131 (65%), Positives = 107/131 (82%), Gaps = 4/131 (3%)
 Frame = +3

Query  162  LFGIVVIGSLFAFSI---AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            +FG+V I +L   SI   A+EE   +G VIGIDLGTTYSCVG++++  VEII NDQGNRI
Sbjct  6    IFGLVFI-ALVCTSIIAHAEEEEKVVGDVIGIDLGTTYSCVGIFRNGHVEIIPNDQGNRI  64

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPS+VAFT++ERLIGEAAKN A   PE TIFD+KRLIGRKF D+EVQRD+K++PYK+++K
Sbjct  65   TPSYVAFTETERLIGEAAKNQATLNPENTIFDIKRLIGRKFSDQEVQRDLKMLPYKVISK  124

Query  513  DGKPYIQVKIK  545
              KP+I VK+K
Sbjct  125  SDKPHIVVKVK  135



>ref|XP_001416181.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
 gb|ABO94474.1| Luminal binding protein precursor, probable [Ostreococcus lucimarinus 
CCE9901]
Length=662

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 103/131 (79%), Gaps = 6/131 (5%)
 Frame = +3

Query  171  IVVIGSLFAFSI------AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRI  332
            +    SLF F++      A+      GTVIGIDLGTTYSCVG Y + +VEIIANDQGNRI
Sbjct  13   VCACASLFLFAVCALPINAENPTEITGTVIGIDLGTTYSCVGAYVNGKVEIIANDQGNRI  72

Query  333  TPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNK  512
            TPS+VAFTDSERLIG++AKN A++ P RT+FD KRLIGRKF DKEVQRD+K+ P+K+V+K
Sbjct  73   TPSYVAFTDSERLIGDSAKNQASANPTRTVFDAKRLIGRKFTDKEVQRDLKMFPFKVVDK  132

Query  513  DGKPYIQVKIK  545
            D KP I+V++K
Sbjct  133  DSKPCIEVELK  143



>gb|EIE87053.1| heat shock 70 kDa protein, partial [Rhizopus delemar RA 99-880]
Length=271

 Score =   167 bits (424),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 82/134 (61%), Positives = 103/134 (77%), Gaps = 3/134 (2%)
 Frame = +3

Query  153  SSILFGIVVIGSLFAFSI---AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQG  323
            +S+L     I +LF  S    A E+    GTVIGIDLGTTYSCV V K+ RVEIIANDQG
Sbjct  5    ASLLALFAFIFTLFIASNVVEAAEDKESYGTVIGIDLGTTYSCVAVQKNGRVEIIANDQG  64

Query  324  NRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKI  503
            +RITPS+VAFTD ERLIG+AAKN  ++ P RT+FD KRLIGR++EDKEVQ+DMK  P+ +
Sbjct  65   HRITPSYVAFTDDERLIGDAAKNQYSANPRRTVFDAKRLIGRRYEDKEVQQDMKHFPFDV  124

Query  504  VNKDGKPYIQVKIK  545
            V+++G P+IQV +K
Sbjct  125  VSRNGAPHIQVPVK  138



>gb|ELU38685.1| HSP70 domain-containing protein [Rhizoctonia solani AG-1 IA]
Length=155

 Score =   164 bits (415),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/129 (63%), Positives = 98/129 (76%), Gaps = 1/129 (1%)
 Frame = +3

Query  159  ILFGIVVIGSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITP  338
            ILF ++    L   + A ++ +  GTVIGIDLGTTYSCVGV++  RVEIIANDQGNRITP
Sbjct  16   ILFAVIAAICLVPVARANDDKN-YGTVIGIDLGTTYSCVGVHRGGRVEIIANDQGNRITP  74

Query  339  SWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDG  518
            SWV F D ERLIG+AAK    + P +T+FD KRLIGRK++D E++RDMK  P+KIVNK G
Sbjct  75   SWVQFGDDERLIGDAAKAAFHTSPSQTVFDAKRLIGRKYDDPELKRDMKHWPFKIVNKGG  134

Query  519  KPYIQVKIK  545
            KP IQVK K
Sbjct  135  KPMIQVKNK  143



>gb|EWC46399.1| glucose-regulated-like protein [Drechslerella stenobrocha 248]
Length=684

 Score =   175 bits (443),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/120 (68%), Positives = 98/120 (82%), Gaps = 0/120 (0%)
 Frame = +3

Query  183  GSLFAFSIAKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDS  362
            G+  A + A  EA   GTVIGIDLGTTYSCVGV +  +VEI+ANDQGNRITPSWVAFTD 
Sbjct  29   GTAQADTNATNEAETYGTVIGIDLGTTYSCVGVMQKGKVEILANDQGNRITPSWVAFTDE  88

Query  363  ERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            ERL+G+AAKN AA+ P RTIFDVKRLIGRKF D +VQ+D+K  P+ ++NKDGKP I+V++
Sbjct  89   ERLVGDAAKNQAAANPTRTIFDVKRLIGRKFNDPDVQKDIKHFPFNVINKDGKPAIKVEV  148



>ref|XP_011112275.1| hypothetical protein H072_6484 [Dactylellina haptotyla CBS 200.50]
 gb|EPS39730.1| hypothetical protein H072_6484 [Dactylellina haptotyla CBS 200.50]
Length=672

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 81/112 (72%), Positives = 96/112 (86%), Gaps = 0/112 (0%)
 Frame = +3

Query  207  AKEEASKLGTVIGIDLGTTYSCVGVYKDQRVEIIANDQGNRITPSWVAFTDSERLIGEAA  386
            A +EA   GTVIGIDLGTTYSCVGV K  +VEI+ANDQG+RITPSWVAFTD ERL+G+AA
Sbjct  36   AAKEAESYGTVIGIDLGTTYSCVGVMKSGKVEILANDQGHRITPSWVAFTDEERLVGDAA  95

Query  387  KNLAASKPERTIFDVKRLIGRKFEDKEVQRDMKLVPYKIVNKDGKPYIQVKI  542
            KN AA+ P+RTIFDVKRLIGRKF +KEVQ D+K  P+ +VNKDGKP I+V++
Sbjct  96   KNQAAANPKRTIFDVKRLIGRKFSEKEVQADIKHFPFDVVNKDGKPAIKVEV  147



>ref|XP_749594.1| Hsp70 chaperone BiP/Kar2 [Aspergillus fumigatus Af293]
 gb|EAL87556.1| Hsp70 chaperone BiP/Kar2, putative [Aspergillus fumigatus Af293]
 gb|EDP54117.1| ER Hsp70 chaperone BiP, putative [Aspergillus fumigatus A1163]
 gb|KEY77310.1| Hsp70 chaperone BiP/Kar2 [Aspergillus fumigatus var. RP-2014]
Length=672

 Score =   174 bits (442),  Expect = 1e-47, Method: Compositional matrix adjust.
 Identities = 87/140 (62%), Positives = 105/140 (75%), Gaps = 7/140 (5%)
 Frame = +3

Query  135  AWKRRTSSILFGIVVIGSLFAFSIAKEEASKL----GTVIGIDLGTTYSCVGVYKDQRVE  302
            AW   T+     +V I  L  F  A  E   +    GTVIGIDLGTTYSCVGV ++ +VE
Sbjct  16   AW---TTVFYLLLVFIAPLAFFGTAHAEEDSVQENYGTVIGIDLGTTYSCVGVMQNGKVE  72

Query  303  IIANDQGNRITPSWVAFTDSERLIGEAAKNLAASKPERTIFDVKRLIGRKFEDKEVQRDM  482
            IIANDQGNRITPS+VAFTD ERL+G+AAKN  AS P RTIFD+KRLIGRKF+DK+VQ+D 
Sbjct  73   IIANDQGNRITPSYVAFTDEERLVGDAAKNQYASNPTRTIFDIKRLIGRKFDDKDVQKDA  132

Query  483  KLVPYKIVNKDGKPYIQVKI  542
            K  PYK+VNKDGKP ++V++
Sbjct  133  KNFPYKVVNKDGKPVVKVEV  152



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335