BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A11

Length=538
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011076588.1|  PREDICTED: glutamine--tRNA ligase                  217   1e-62   Sesamum indicum [beniseed]
emb|CAN77709.1|  hypothetical protein VITISV_017112                     196   4e-60   Vitis vinifera
ref|XP_011070787.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...    206   1e-58   
gb|EYU33108.1|  hypothetical protein MIMGU_mgv1a018809mg                196   1e-57   Erythranthe guttata [common monkey flower]
ref|XP_002283636.1|  PREDICTED: glutamine--tRNA ligase                  202   4e-57   Vitis vinifera
ref|XP_002270305.1|  PREDICTED: glutamine--tRNA ligase                  199   4e-56   Vitis vinifera
gb|KDP42069.1|  hypothetical protein JCGZ_01857                         197   1e-55   Jatropha curcas
gb|EYU40769.1|  hypothetical protein MIMGU_mgv1a001563mg                196   3e-55   Erythranthe guttata [common monkey flower]
ref|XP_011022290.1|  PREDICTED: glutamine--tRNA ligase isoform X2       196   4e-55   Populus euphratica
ref|XP_011022282.1|  PREDICTED: glutamine--tRNA ligase isoform X1       196   4e-55   Populus euphratica
ref|XP_010320758.1|  PREDICTED: glutamine--tRNA ligase isoform X1       196   5e-55   Solanum lycopersicum
ref|XP_010044253.1|  PREDICTED: glutamine--tRNA ligase                  196   6e-55   Eucalyptus grandis [rose gum]
ref|XP_007225665.1|  hypothetical protein PRUPE_ppa001599mg             195   9e-55   Prunus persica
ref|XP_010460393.1|  PREDICTED: glutamine--tRNA ligase-like             194   3e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010477943.1|  PREDICTED: glutamine--tRNA ligase-like             193   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006303908.1|  hypothetical protein CARUB_v10008339mg             193   4e-54   
ref|XP_010499120.1|  PREDICTED: glutamine--tRNA ligase-like             193   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_006344143.1|  PREDICTED: glutamine--tRNA ligase-like             193   5e-54   Solanum tuberosum [potatoes]
ref|XP_010099748.1|  Glutamine--tRNA ligase                             183   5e-54   
ref|XP_010106860.1|  Glutamine--tRNA ligase                             195   5e-54   
ref|XP_002312407.1|  tRNA-glutamine synthetase family protein           192   7e-54   
ref|XP_008243256.1|  PREDICTED: glutamine--tRNA ligase                  192   1e-53   Prunus mume [ume]
ref|XP_007022144.1|  Glutamine-tRNA ligase / glutaminyl-tRNA synt...    191   2e-53   
ref|XP_007022143.1|  Glutamine-tRNA ligase / glutaminyl-tRNA synt...    191   2e-53   
ref|XP_002890694.1|  hypothetical protein ARALYDRAFT_472840             191   2e-53   
ref|XP_006448448.1|  hypothetical protein CICLE_v10014320mg             191   3e-53   
ref|XP_009356249.1|  PREDICTED: glutamine--tRNA ligase-like             191   3e-53   Pyrus x bretschneideri [bai li]
ref|XP_006448449.1|  hypothetical protein CICLE_v10014320mg             191   3e-53   
ref|XP_006448447.1|  hypothetical protein CICLE_v10014320mg             191   3e-53   Citrus clementina [clementine]
ref|XP_006448446.1|  hypothetical protein CICLE_v10014320mg             191   4e-53   Citrus clementina [clementine]
gb|KDO76967.1|  hypothetical protein CISIN_1g003751mg                   189   6e-53   Citrus sinensis [apfelsine]
gb|KJB61243.1|  hypothetical protein B456_009G347600                    189   1e-52   Gossypium raimondii
gb|KJB61242.1|  hypothetical protein B456_009G347600                    189   1e-52   Gossypium raimondii
gb|KJB61241.1|  hypothetical protein B456_009G347600                    189   2e-52   Gossypium raimondii
gb|KDO76966.1|  hypothetical protein CISIN_1g003751mg                   188   2e-52   Citrus sinensis [apfelsine]
gb|KDO76963.1|  hypothetical protein CISIN_1g003751mg                   189   2e-52   Citrus sinensis [apfelsine]
ref|XP_006468715.1|  PREDICTED: glutamine--tRNA ligase-like             189   2e-52   Citrus sinensis [apfelsine]
ref|NP_173906.2|  putative tRNA-glutamine ligase                        188   2e-52   Arabidopsis thaliana [mouse-ear cress]
gb|AAG28806.2|AC079374_9  tRNA-glutamine synthetase, putative           188   2e-52   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001185094.1|  putative tRNA-glutamine ligase                     188   3e-52   Arabidopsis thaliana [mouse-ear cress]
pir||D86383  probable glutaminyl-tRNA synthetase (glnrs) [importe...    188   3e-52
ref|XP_008389271.1|  PREDICTED: glutamine--tRNA ligase                  187   7e-52   
ref|XP_010551245.1|  PREDICTED: glutamine--tRNA ligase                  187   8e-52   Tarenaya hassleriana [spider flower]
ref|XP_002526992.1|  glutaminyl-tRNA synthetase, putative               186   1e-51   Ricinus communis
sp|P52780.2|SYQ_LUPLU  RecName: Full=Glutamine--tRNA ligase; AltN...    185   4e-51   Lupinus luteus
ref|XP_003536678.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    185   5e-51   Glycine max [soybeans]
ref|XP_009356957.1|  PREDICTED: glutamine--tRNA ligase-like             184   1e-50   Pyrus x bretschneideri [bai li]
gb|AES62889.2|  glutamine-tRNA ligase                                   183   2e-50   Medicago truncatula
ref|XP_003592638.1|  Glutaminyl-tRNA synthetase                         183   2e-50   
ref|XP_006378476.1|  hypothetical protein POPTR_0010s13280g             182   2e-50   
gb|KHN05557.1|  Glutamine--tRNA ligase                                  182   2e-50   Glycine soja [wild soybean]
ref|XP_004497076.1|  PREDICTED: glutamine--tRNA ligase-like             181   7e-50   
ref|XP_007142926.1|  hypothetical protein PHAVU_007G028800g             181   2e-49   Phaseolus vulgaris [French bean]
ref|XP_011464100.1|  PREDICTED: glutamine--tRNA ligase                  180   2e-49   Fragaria vesca subsp. vesca
ref|XP_010272844.1|  PREDICTED: glutamine--tRNA ligase                  180   2e-49   Nelumbo nucifera [Indian lotus]
ref|XP_008460942.1|  PREDICTED: glutamine--tRNA ligase-like             179   3e-49   Cucumis melo [Oriental melon]
gb|KFK44542.1|  hypothetical protein AALP_AA1G270200                    179   4e-49   Arabis alpina [alpine rockcress]
gb|KHG03894.1|  Glutamine--tRNA ligase                                  178   1e-48   Gossypium arboreum [tree cotton]
emb|CDP00642.1|  unnamed protein product                                178   1e-48   Coffea canephora [robusta coffee]
ref|XP_008457734.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    177   2e-48   Cucumis melo [Oriental melon]
ref|XP_004148841.1|  PREDICTED: glutamine--tRNA ligase-like             177   2e-48   Cucumis sativus [cucumbers]
ref|XP_008457735.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    177   2e-48   Cucumis melo [Oriental melon]
ref|XP_004164827.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...    177   2e-48   
ref|XP_008457733.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    177   2e-48   Cucumis melo [Oriental melon]
ref|XP_004158365.1|  PREDICTED: glutamine--tRNA ligase-like             177   2e-48   
ref|XP_004147055.1|  PREDICTED: glutamine--tRNA ligase-like             177   2e-48   Cucumis sativus [cucumbers]
gb|KHN11406.1|  Glutamine--tRNA ligase                                  176   5e-48   Glycine soja [wild soybean]
ref|XP_009797950.1|  PREDICTED: glutamine--tRNA ligase                  172   1e-46   Nicotiana sylvestris
ref|XP_009626236.1|  PREDICTED: glutamine--tRNA ligase                  171   4e-46   Nicotiana tomentosiformis
ref|XP_009115303.1|  PREDICTED: glutamine--tRNA ligase-like             169   1e-45   Brassica rapa
emb|CDY42114.1|  BnaA09g28460D                                          169   2e-45   Brassica napus [oilseed rape]
ref|XP_010684954.1|  PREDICTED: glutamine--tRNA ligase-like             169   2e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009405807.1|  PREDICTED: glutamine--tRNA ligase-like             168   3e-45   Musa acuminata subsp. malaccensis [pisang utan]
emb|CDX84982.1|  BnaC05g20730D                                          169   3e-45   
ref|XP_010695806.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    167   9e-45   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006415861.1|  hypothetical protein EUTSA_v10006840mg             167   1e-44   Eutrema salsugineum [saltwater cress]
ref|XP_006844061.1|  hypothetical protein AMTR_s00006p00246940          167   1e-44   Amborella trichopoda
ref|XP_009404845.1|  PREDICTED: glutamine--tRNA ligase-like             164   1e-43   Musa acuminata subsp. malaccensis [pisang utan]
gb|ABR17752.1|  unknown                                                 163   3e-43   Picea sitchensis
ref|XP_010940139.1|  PREDICTED: glutamine--tRNA ligase-like             162   9e-43   Elaeis guineensis
ref|XP_010915141.1|  PREDICTED: glutamine--tRNA ligase-like             161   1e-42   Elaeis guineensis
ref|XP_006655062.1|  PREDICTED: glutamine--tRNA ligase-like             154   4e-40   Oryza brachyantha
ref|XP_008795989.1|  PREDICTED: glutamine--tRNA ligase                  154   8e-40   Phoenix dactylifera
ref|NP_001054822.1|  Os05g0182800                                       151   7e-39   
ref|NP_001042238.1|  Os01g0185200                                       150   2e-38   
ref|XP_004960871.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    149   3e-38   
ref|XP_004960872.1|  PREDICTED: glutamine--tRNA ligase-like isofo...    149   4e-38   Setaria italica
gb|EMT18506.1|  Glutaminyl-tRNA synthetase                              148   6e-38   
emb|CDM81662.1|  unnamed protein product                                143   7e-36   Triticum aestivum [Canadian hard winter wheat]
ref|XP_010431359.1|  PREDICTED: glutamine--tRNA ligase-like             142   1e-35   
ref|XP_002440725.1|  hypothetical protein SORBIDRAFT_09g005690          142   2e-35   Sorghum bicolor [broomcorn]
gb|EEC70073.1|  hypothetical protein OsI_00686                          139   9e-35   Oryza sativa Indica Group [Indian rice]
ref|XP_008809726.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...    139   2e-34   
ref|XP_001760606.1|  predicted protein                                  139   2e-34   
ref|XP_004968490.1|  PREDICTED: glutamine--tRNA ligase-like             138   2e-34   Setaria italica
gb|EMT15092.1|  Glutaminyl-tRNA synthetase                              137   5e-34   
gb|KDO76965.1|  hypothetical protein CISIN_1g003751mg                   134   9e-33   Citrus sinensis [apfelsine]
ref|XP_006643850.1|  PREDICTED: glutamine--tRNA ligase-like             134   1e-32   Oryza brachyantha
ref|XP_008672779.1|  PREDICTED: uncharacterized protein LOC100280...    134   1e-32   
ref|XP_002455040.1|  hypothetical protein SORBIDRAFT_03g003420          133   1e-32   Sorghum bicolor [broomcorn]
ref|XP_010265099.1|  PREDICTED: glutamine--tRNA ligase-like             122   3e-32   
ref|NP_001152305.1|  glutaminyl-tRNA synthetase                         130   2e-31   Zea mays [maize]
ref|XP_002888654.1|  predicted protein                                  128   8e-31   
ref|XP_006301816.1|  hypothetical protein CARUB_v10022284mg             125   9e-30   
ref|XP_002871902.1|  predicted protein                                  124   2e-29   
tpg|DAA53110.1|  TPA: hypothetical protein ZEAMMB73_029969              124   2e-29   
ref|XP_003564537.1|  PREDICTED: glutamine--tRNA ligase                  124   3e-29   Brachypodium distachyon [annual false brome]
gb|EMS52881.1|  Glutaminyl-tRNA synthetase                              117   5e-27   Triticum urartu
ref|XP_002966775.1|  hypothetical protein SELMODRAFT_168502             114   8e-26   
ref|XP_002977973.1|  hypothetical protein SELMODRAFT_108529             114   1e-25   
gb|EPS67602.1|  hypothetical protein M569_07173                         109   7e-25   Genlisea aurea
ref|XP_003290976.1|  glutamine-tRNA ligase                              110   2e-24   Dictyostelium purpureum
ref|XP_002945662.1|  hypothetical protein VOLCADRAFT_78635              108   8e-24   Volvox carteri f. nagariensis
emb|CAA33446.1|  unnamed protein product                                105   9e-24   Dictyostelium discoideum AX3
gb|KIY99203.1|  glutaminyl-tRNA synthetase                              105   2e-23   Monoraphidium neglectum
emb|CDY47088.1|  BnaC03g64100D                                          100   4e-23   Brassica napus [oilseed rape]
ref|XP_005850046.1|  hypothetical protein CHLNCDRAFT_30027              106   4e-23   Chlorella variabilis
ref|XP_636180.1|  glutamine-tRNA ligase                                 105   1e-22   Dictyostelium discoideum AX4
ref|XP_005649888.1|  glutaminyl-tRNA synthetase                       99.0    2e-20   Coccomyxa subellipsoidea C-169
ref|XP_001699050.1|  hypothetical protein CHLREDRAFT_193475           95.5    4e-20   Chlamydomonas reinhardtii
gb|KDP29433.1|  hypothetical protein JCGZ_18354                       93.2    2e-19   Jatropha curcas
gb|ELU08311.1|  hypothetical protein CAPTEDRAFT_221989                95.1    3e-19   Capitella teleta
ref|XP_011402329.1|  Glutamine-tRNA ligase                            93.6    1e-18   Auxenochlorella protothecoides
emb|CDX77723.1|  BnaC07g19770D                                        86.3    3e-18   
dbj|GAM21997.1|  hypothetical protein SAMD00019534_051720             92.0    5e-18   Acytostelium subglobosum LB1
emb|CDY23862.1|  BnaC04g01750D                                        85.1    7e-18   Brassica napus [oilseed rape]
emb|CDY23000.1|  BnaC03g40690D                                        82.0    9e-17   Brassica napus [oilseed rape]
ref|XP_002962789.1|  hypothetical protein SELMODRAFT_404079           87.4    2e-16   Selaginella moellendorffii
gb|KDD76352.1|  class I (E and Q) tRNA synthetase                     87.0    3e-16   Helicosporidium sp. ATCC 50920
ref|XP_643772.1|  asparagine-tRNA ligase                              86.7    3e-16   Dictyostelium discoideum AX4
emb|CDS13604.1|  hypothetical protein LRAMOSA05780                    85.9    6e-16   Lichtheimia ramosa
gb|EFA83742.1|  glutamine-tRNA ligase                                 85.5    7e-16   Heterostelium album PN500
ref|XP_004363149.1|  glutamine-tRNA ligase                            85.1    1e-15   Cavenderia fasciculata
ref|XP_002962496.1|  hypothetical protein SELMODRAFT_78641            84.3    2e-15   
ref|XP_009057926.1|  hypothetical protein LOTGIDRAFT_228742           84.0    3e-15   Lottia gigantea
ref|XP_009009763.1|  hypothetical protein HELRODRAFT_63797            83.6    4e-15   Helobdella robusta
ref|XP_004350432.1|  asparagine-tRNA ligase                           82.0    8e-15   Cavenderia fasciculata
emb|CDH50331.1|  probable glutamine-trna ligase                       82.4    1e-14   Lichtheimia corymbifera JMRC:FSU:9682
gb|ESA08892.1|  hypothetical protein GLOINDRAFT_31189                 79.3    1e-14   
gb|EXX50887.1|  glutamine--tRNA ligase                                82.0    1e-14   Rhizophagus irregularis DAOM 197198w
ref|XP_006822206.1|  PREDICTED: glutamine--tRNA ligase                80.9    3e-14   Saccoglossus kowalevskii
ref|XP_005101664.1|  PREDICTED: probable glutamine--tRNA ligase-like  80.5    4e-14   
gb|EFA81274.1|  asparagine-tRNA ligase                                79.3    8e-14   Heterostelium album PN500
dbj|GAN03587.1|  cytoplasmic glutaminyl-tRNA ligase Qrs1              79.3    1e-13   Mucor ambiguus
ref|XP_008558062.1|  PREDICTED: probable glutamine--tRNA ligase       79.0    1e-13   
gb|EIE86796.1|  hypothetical protein RO3G_11507                       78.2    2e-13   Rhizopus delemar RA 99-880
gb|EFX87065.1|  hypothetical protein DAPPUDRAFT_307141                78.2    3e-13   Daphnia pulex
ref|XP_003087425.1|  hypothetical protein CRE_26035                   74.7    3e-13   Caenorhabditis remanei
ref|XP_002430078.1|  glutaminyl-tRNA synthetase, putative             77.8    3e-13   Pediculus humanus corporis [human body lice]
gb|EPB93125.1|  hypothetical protein HMPREF1544_00199                 77.8    3e-13   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_003706095.1|  PREDICTED: probable glutamine--tRNA ligase-like  77.4    4e-13   Megachile rotundata
ref|XP_011149130.1|  PREDICTED: probable glutamine--tRNA ligase       77.0    6e-13   Harpegnathos saltator
emb|CEG63087.1|  Putative Glutaminyl-tRNA synthetase                  76.6    8e-13   Rhizopus microsporus
ref|XP_002632525.1|  C. briggsae CBR-ERS-1 protein                    76.3    1e-12   Caenorhabditis briggsae
ref|XP_011267539.1|  PREDICTED: probable glutamine--tRNA ligase       75.9    1e-12   
ref|XP_011173631.1|  PREDICTED: probable glutamine--tRNA ligase       75.5    2e-12   Solenopsis invicta [imported red fire ant]
gb|EFZ09255.1|  hypothetical protein SINV_09433                       75.5    2e-12   
gb|EGT58460.1|  CBN-QARS-1 protein                                    75.1    2e-12   Caenorhabditis brenneri
dbj|GAM17593.1|  hypothetical protein SAMD00019534_007680             74.7    3e-12   Acytostelium subglobosum LB1
ref|XP_004351610.1|  glutamine-tRNA ligase                            75.1    3e-12   Acanthamoeba castellanii str. Neff
ref|XP_009857693.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  73.9    5e-12   
ref|XP_002131102.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  73.9    5e-12   Ciona intestinalis [sea vase]
ref|NP_001255843.1|  Protein QARS-1, isoform a                        73.9    5e-12   Caenorhabditis elegans [roundworm]
ref|XP_006677573.1|  hypothetical protein BATDEDRAFT_86970            73.9    5e-12   Batrachochytrium dendrobatidis JAM81
ref|XP_002601720.1|  hypothetical protein BRAFLDRAFT_121196           73.9    6e-12   Branchiostoma floridae
ref|XP_001607476.1|  PREDICTED: probable glutamine--tRNA ligase       73.9    6e-12   Nasonia vitripennis
ref|XP_003092429.1|  hypothetical protein CRE_03478                   73.6    9e-12   Caenorhabditis remanei
emb|CEI94809.1|  Putative Glutamine--tRNA ligase                      72.4    1e-11   Rhizopus microsporus
ref|XP_003383035.1|  PREDICTED: glutamine--tRNA ligase-like           72.8    1e-11   Amphimedon queenslandica
ref|XP_011330844.1|  PREDICTED: probable glutamine--tRNA ligase       72.8    1e-11   
gb|EGT41976.1|  hypothetical protein CAEBREN_05000                    70.1    2e-11   Caenorhabditis brenneri
gb|KFM68600.1|  putative glutamine--tRNA ligase                       72.4    2e-11   Stegodyphus mimosarum
gb|KDR12338.1|  putative glutaminyl-tRNA synthetase                   71.2    4e-11   Zootermopsis nevadensis
ref|NP_957507.1|  glutamine--tRNA ligase                              70.1    6e-11   Danio rerio [leopard danio]
gb|ETN81795.1|  glutamine--tRNA ligase family protein                 70.5    6e-11   Necator americanus
ref|XP_011055429.1|  PREDICTED: probable glutamine--tRNA ligase       70.5    7e-11   Acromyrmex echinatior
ref|XP_004546152.1|  PREDICTED: glutamine--tRNA ligase-like           67.8    8e-11   
ref|XP_003283472.1|  hypothetical protein DICPUDRAFT_44848            70.1    8e-11   Dictyostelium purpureum
ref|XP_004184350.1|  glutaminyl-tRNA synthetase, putative             70.1    1e-10   Entamoeba invadens IP1
ref|NP_001012800.1|  glutaminyl-tRNA synthetase                       69.7    1e-10   Gallus gallus [bantam]
gb|AAT68085.1|  glutaminyl-tRNA synthetase                            69.7    1e-10   Danio rerio [leopard danio]
ref|XP_007431438.1|  PREDICTED: glutamine--tRNA ligase                69.7    1e-10   Python bivittatus
ref|XP_008186909.1|  PREDICTED: probable glutamine--tRNA ligase i...  69.7    1e-10   Acyrthosiphon pisum
ref|XP_008186908.1|  PREDICTED: probable glutamine--tRNA ligase i...  69.7    1e-10   Acyrthosiphon pisum
emb|CDJ85156.1|  Glutaminyl-tRNA synthetase and Glutamyl glutamin...  68.9    2e-10   Haemonchus contortus [red stomach worm]
ref|XP_003394481.1|  PREDICTED: probable glutaminyl-tRNA syntheta...  69.3    2e-10   Bombus terrestris [large earth bumblebee]
ref|XP_008479890.1|  PREDICTED: probable glutamine--tRNA ligase       68.9    2e-10   
ref|XP_004451967.1|  PREDICTED: glutamine--tRNA ligase isoform 2      68.9    2e-10   Dasypus novemcinctus
ref|XP_007953510.1|  PREDICTED: glutamine--tRNA ligase isoform X2     68.9    2e-10   Orycteropus afer afer
ref|XP_004070579.1|  PREDICTED: glutamine--tRNA ligase                68.9    2e-10   
ref|XP_004914154.1|  PREDICTED: glutamine--tRNA ligase                68.9    3e-10   Xenopus tropicalis [western clawed frog]
ref|XP_004283976.1|  PREDICTED: glutamine--tRNA ligase isoform 2      68.9    3e-10   Orcinus orca [Orca]
ref|XP_004319924.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  68.9    3e-10   
gb|AAI10785.1|  LOC734179 protein                                     68.6    3e-10   Xenopus laevis [clawed frog]
ref|NP_001079979.1|  glutaminyl-tRNA synthetase                       68.2    5e-10   Xenopus laevis [clawed frog]
ref|XP_005931787.1|  PREDICTED: glutamine--tRNA ligase-like           68.2    5e-10   
ref|XP_008412209.1|  PREDICTED: glutamine--tRNA ligase                68.2    5e-10   Poecilia reticulata
gb|AAI61792.1|  LOC100145804 protein                                  67.8    5e-10   Xenopus tropicalis [western clawed frog]
ref|XP_006796475.1|  PREDICTED: glutamine--tRNA ligase-like           67.8    5e-10   Neolamprologus brichardi [lyretail cichlid]
ref|XP_002073864.1|  GK14344                                          67.8    6e-10   Drosophila willistoni
ref|XP_005448788.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  67.8    6e-10   
ref|XP_003439051.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  67.8    6e-10   Oreochromis niloticus
ref|XP_006892985.1|  PREDICTED: glutamine--tRNA ligase isoform X1     67.8    7e-10   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_005969306.1|  PREDICTED: glutamine--tRNA ligase isoform X1     67.4    8e-10   Pantholops hodgsonii [Tibetan antelope]
ref|XP_003217895.1|  PREDICTED: glutamine--tRNA ligase                67.4    9e-10   
gb|EPZ32575.1|  Glutamyl/glutaminyl-tRNA synthetase, class Ib, ca...  66.6    1e-09   Rozella allomycis CSF55
ref|XP_007129947.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  67.0    1e-09   
ref|NP_596745.1|  cytoplasmic glutaminyl-tRNA ligase Qrs1 (predic...  67.0    1e-09   Schizosaccharomyces pombe
gb|KHJ45111.1|  glutamine--tRNA ligase                                67.0    1e-09   Trichuris suis
ref|XP_006171047.1|  PREDICTED: glutamine--tRNA ligase                66.6    1e-09   Tupaia chinensis
ref|XP_003800684.1|  PREDICTED: glutamine--tRNA ligase                66.6    1e-09   
ref|XP_009492563.1|  hypothetical protein H696_00435                  66.6    1e-09   Fonticula alba
ref|XP_003936722.2|  PREDICTED: glutamine--tRNA ligase                66.6    2e-09   Saimiri boliviensis boliviensis
dbj|BAG61988.1|  unnamed protein product                              63.2    2e-09   Homo sapiens [man]
ref|XP_005740582.1|  PREDICTED: glutamine--tRNA ligase-like           66.2    2e-09   Pundamilia nyererei
gb|EPX73219.1|  cytoplasmic glutaminyl-tRNA ligase Qrs1               66.2    2e-09   Schizosaccharomyces octosporus yFS286
ref|XP_007562344.1|  PREDICTED: glutamine--tRNA ligase isoform X2     66.2    2e-09   
ref|XP_007562343.1|  PREDICTED: glutamine--tRNA ligase isoform X1     66.2    2e-09   Poecilia formosa
ref|XP_011307953.1|  PREDICTED: probable glutamine--tRNA ligase i...  66.2    2e-09   Fopius arisanus
ref|XP_001999390.1|  GI24483                                          66.2    2e-09   Drosophila mojavensis
emb|CDW79726.1|  glutamine-trna ligase                                65.9    3e-09   Stylonychia lemnae
ref|XP_005053408.1|  PREDICTED: glutamine--tRNA ligase                65.9    3e-09   Ficedula albicollis
ref|XP_001632077.1|  predicted protein                                65.5    3e-09   Nematostella vectensis
ref|XP_008066341.1|  PREDICTED: glutamine--tRNA ligase                65.5    3e-09   Carlito syrichta
ref|XP_008564001.1|  PREDICTED: glutamine--tRNA ligase                65.5    3e-09   Galeopterus variegatus [Malayan flying lemur]
emb|CDW53172.1|  Glutaminyl-tRNA synthetase                           65.5    3e-09   Trichuris trichiura
ref|XP_007982378.1|  PREDICTED: glutamine--tRNA ligase isoform X2     65.5    4e-09   Chlorocebus sabaeus
ref|XP_005696027.1|  PREDICTED: glutamine--tRNA ligase isoform X1     65.5    4e-09   Capra hircus [domestic goat]
ref|XP_004018519.1|  PREDICTED: glutamine--tRNA ligase isoform 1      65.5    4e-09   
ref|XP_007982377.1|  PREDICTED: glutamine--tRNA ligase isoform X1     65.5    4e-09   Chlorocebus sabaeus
ref|XP_003734890.1|  PREDICTED: glutamine--tRNA ligase isoform X1     65.5    4e-09   Callithrix jacchus [common marmoset]
ref|XP_005801766.1|  PREDICTED: glutamine--tRNA ligase-like           65.5    4e-09   Xiphophorus maculatus
dbj|BAH13826.1|  unnamed protein product                              63.5    4e-09   Homo sapiens [man]
emb|CEP15816.1|  hypothetical protein                                 65.5    4e-09   Parasitella parasitica
tpg|DAA16919.1|  TPA: glutaminyl-tRNA synthetase                      65.1    4e-09   Bos taurus [bovine]
ref|XP_011505774.1|  PREDICTED: LOW QUALITY PROTEIN: probable glu...  65.1    4e-09   Ceratosolen solmsi marchali
ref|XP_010850184.1|  PREDICTED: glutamine--tRNA ligase                65.1    4e-09   Bison bison bison
ref|NP_001029640.1|  glutamine--tRNA ligase                           65.1    4e-09   Bos taurus [bovine]
ref|XP_006631127.1|  PREDICTED: glutamine--tRNA ligase-like           65.1    4e-09   Lepisosteus oculatus
gb|EIF49537.1|  glutaminyl-trna synthetase                            65.1    4e-09   Brettanomyces bruxellensis AWRI1499
ref|XP_006053296.1|  PREDICTED: glutamine--tRNA ligase                65.1    4e-09   
emb|CDQ75073.1|  unnamed protein product                              65.1    5e-09   Oncorhynchus mykiss
ref|XP_001953009.1|  GF17431                                          65.1    5e-09   Drosophila ananassae
ref|XP_004581509.1|  PREDICTED: glutamine--tRNA ligase isoform X1     65.1    5e-09   Ochotona princeps [southern American pika]
ref|XP_002713459.2|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  65.1    5e-09   
ref|XP_004419741.1|  PREDICTED: glutamine--tRNA ligase isoform 1      65.1    5e-09   Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_010368326.1|  PREDICTED: glutamine--tRNA ligase isoform X2     64.7    5e-09   Rhinopithecus roxellana
ref|XP_009199073.1|  PREDICTED: glutamine--tRNA ligase isoform X1     64.7    5e-09   
ref|XP_010368316.1|  PREDICTED: glutamine--tRNA ligase isoform X1     64.7    5e-09   Rhinopithecus roxellana
dbj|BAE87806.1|  unnamed protein product                              64.7    5e-09   Macaca fascicularis [crab eating macaque]
ref|XP_005547132.1|  PREDICTED: glutamine--tRNA ligase isoform X2     64.7    5e-09   Macaca fascicularis [crab eating macaque]
ref|XP_003894499.2|  PREDICTED: glutamine--tRNA ligase isoform X2     64.7    5e-09   Papio anubis [baboon]
ref|XP_001110256.2|  PREDICTED: glutaminyl-tRNA synthetase isoform 2  64.7    5e-09   
ref|XP_650546.1|  glutaminyl-tRNA synthetase                          64.7    5e-09   Entamoeba histolytica HM-1:IMSS
gb|EMD47218.1|  glutaminyl-tRNA synthetase, putative                  64.7    5e-09   Entamoeba histolytica KU27
ref|XP_008856337.1|  glutamine--tRNA ligase                           64.7    5e-09   Entamoeba nuttalli P19
ref|XP_005522095.1|  PREDICTED: glutamine--tRNA ligase                64.7    6e-09   
ref|XP_623880.1|  PREDICTED: probable glutamine--tRNA ligase          64.7    6e-09   Apis mellifera [bee]
ref|XP_010740385.1|  PREDICTED: glutamine--tRNA ligase                64.7    6e-09   
ref|XP_008287737.1|  PREDICTED: glutamine--tRNA ligase                64.7    7e-09   Stegastes partitus
ref|XP_002813807.2|  PREDICTED: glutamine--tRNA ligase isoform X3     64.7    7e-09   Pongo abelii [orang utan]
ref|XP_005420305.1|  PREDICTED: glutamine--tRNA ligase                64.3    8e-09   
ref|XP_001433005.1|  hypothetical protein                             64.3    9e-09   Paramecium tetraurelia strain d4-2
ref|XP_006174201.1|  PREDICTED: glutamine--tRNA ligase isoform X2     64.3    9e-09   Camelus ferus
ref|XP_010976861.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  64.3    9e-09   Camelus dromedarius [camel]
ref|XP_010967499.1|  PREDICTED: glutamine--tRNA ligase                64.3    9e-09   Camelus bactrianus [camel]
ref|XP_010779066.1|  PREDICTED: glutamine--tRNA ligase isoform X1     63.9    9e-09   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_785259.3|  PREDICTED: glutamine--tRNA ligase-like              63.5    1e-08   Strongylocentrotus purpuratus [purple urchin]
ref|NP_001271103.1|  uncharacterized protein LOC101865617             63.9    1e-08   Macaca fascicularis [crab eating macaque]
ref|XP_004368573.1|  PREDICTED: glutamine--tRNA ligase isoform 2      63.9    1e-08   Trichechus manatus latirostris
ref|XP_004928054.1|  PREDICTED: probable glutamine--tRNA ligase-like  63.9    1e-08   
ref|XP_003486579.1|  PREDICTED: probable glutaminyl-tRNA syntheta...  63.5    1e-08   
ref|XP_533833.2|  PREDICTED: glutamine--tRNA ligase isoformX1         63.5    1e-08   Canis lupus familiaris [dogs]
ref|XP_006750254.1|  PREDICTED: glutamine--tRNA ligase isoform X2     63.5    1e-08   Leptonychotes weddellii
ref|XP_003486578.1|  PREDICTED: probable glutaminyl-tRNA syntheta...  63.5    1e-08   
ref|XP_004760740.1|  PREDICTED: glutamine--tRNA ligase                63.5    1e-08   Mustela putorius furo [black ferret]
ref|XP_005632622.1|  PREDICTED: glutamine--tRNA ligase isoform X2     63.5    1e-08   Canis lupus familiaris [dogs]
ref|XP_004820073.1|  PREDICTED: glutamine--tRNA ligase isoform X1     63.5    1e-08   
ref|XP_002408061.1|  tRNA synthetases class I, putative               63.5    1e-08   Ixodes scapularis [blacklegged tick]
ref|NP_001267348.1|  glutamine--tRNA ligase                           63.5    1e-08   
ref|NP_005042.1|  glutamine--tRNA ligase isoform a                    63.5    1e-08   
dbj|BAF83212.1|  unnamed protein product                              63.5    1e-08   
dbj|BAD96230.1|  glutaminyl-tRNA synthetase variant                   63.5    1e-08   
ref|XP_004034169.1|  PREDICTED: glutamine--tRNA ligase                63.5    1e-08   
ref|XP_003818428.2|  PREDICTED: glutamine--tRNA ligase isoform X1     63.5    1e-08   
gb|EAW64954.1|  glutaminyl-tRNA synthetase, isoform CRA_b             63.5    1e-08   
pdb|4R3Z|C  Chain C, Crystal Structure Of Human Argrs-glnrs-aimp1...  63.5    1e-08   
ref|XP_001429291.1|  hypothetical protein                             63.5    1e-08   
ref|XP_011183936.1|  PREDICTED: probable glutamine--tRNA ligase       63.5    2e-08   
gb|EYC10419.1|  hypothetical protein Y032_0055g2548                   63.2    2e-08   
gb|EYC10420.1|  hypothetical protein Y032_0055g2548                   63.2    2e-08   
gb|EYC10418.1|  hypothetical protein Y032_0055g2548                   63.2    2e-08   
ref|XP_007088554.1|  PREDICTED: glutamine--tRNA ligase                63.2    2e-08   
ref|XP_003982262.1|  PREDICTED: glutamine--tRNA ligase                63.2    2e-08   
ref|XP_004399280.1|  PREDICTED: glutamine--tRNA ligase isoform 1      63.2    2e-08   
ref|XP_008702021.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  63.2    2e-08   
ref|XP_002099074.1|  GE10719                                          63.2    2e-08   
ref|XP_008317654.1|  PREDICTED: glutamine--tRNA ligase                63.2    2e-08   
ref|NP_524841.1|  Glutaminyl-tRNA synthetase                          62.8    2e-08   
ref|XP_010900394.1|  PREDICTED: glutamine--tRNA ligase                62.8    3e-08   
ref|XP_006196350.1|  PREDICTED: glutamine--tRNA ligase isoform X2     62.8    3e-08   
emb|CCC47550.1|  putative asparaginyl-tRNA synthetase                 62.8    3e-08   
ref|XP_004903507.1|  PREDICTED: glutamine--tRNA ligase isoform X1     62.8    3e-08   
ref|XP_001737778.1|  glutaminyl-tRNA synthetase                       62.4    3e-08   
ref|XP_002159154.2|  PREDICTED: glutamine--tRNA ligase-like           62.4    3e-08   
ref|XP_002043907.1|  GM17736                                          62.4    3e-08   
gb|EPY50290.1|  cytoplasmic glutaminyl-tRNA ligase Qrs1               62.4    3e-08   
ref|XP_008500445.1|  PREDICTED: glutamine--tRNA ligase                62.4    3e-08   
ref|XP_008153966.1|  PREDICTED: glutamine--tRNA ligase isoform X1     62.4    4e-08   
ref|XP_001359293.1|  GA10360                                          62.4    4e-08   
ref|XP_002017080.1|  GL22108                                          62.4    4e-08   
ref|XP_002920597.1|  PREDICTED: glutamine--tRNA ligase                62.4    4e-08   
ref|XP_006010926.1|  PREDICTED: glutamine--tRNA ligase                62.0    4e-08   
ref|XP_005296032.1|  PREDICTED: glutamine--tRNA ligase isoform X2     62.0    4e-08   
ref|XP_005296031.1|  PREDICTED: glutamine--tRNA ligase isoform X1     62.0    4e-08   
ref|XP_004834055.1|  PREDICTED: glutamine--tRNA ligase isoform X1     62.0    5e-08   
ref|XP_006873679.1|  PREDICTED: glutamine--tRNA ligase isoform X2     62.0    5e-08   
ref|XP_003409716.1|  PREDICTED: glutamine--tRNA ligase                62.0    5e-08   
ref|XP_005326958.1|  PREDICTED: glutamine--tRNA ligase isoform X1     62.0    5e-08   
ref|XP_004676238.1|  PREDICTED: glutamine--tRNA ligase isoform X2     61.6    5e-08   
ref|XP_003696365.1|  PREDICTED: probable glutamine--tRNA ligase-like  61.6    6e-08   
ref|XP_003976505.1|  PREDICTED: glutamine--tRNA ligase-like           61.6    6e-08   
gb|EHB14795.1|  Glutaminyl-tRNA synthetase                            61.6    6e-08   
ref|XP_008851428.1|  PREDICTED: glutamine--tRNA ligase                61.6    7e-08   
ref|XP_011373701.1|  PREDICTED: glutamine--tRNA ligase                61.2    7e-08   
ref|XP_002104883.1|  GD18218                                          61.2    7e-08   
ref|XP_004615313.1|  PREDICTED: glutamine--tRNA ligase isoform X1     61.2    7e-08   
ref|XP_010613904.1|  PREDICTED: glutamine--tRNA ligase                61.2    7e-08   
ref|XP_006978370.1|  PREDICTED: glutamine--tRNA ligase                61.2    8e-08   
gb|EJY69076.1|  Glutamine-tRNA ligase                                 61.2    8e-08   
ref|XP_004625138.1|  PREDICTED: glutamine--tRNA ligase isoform X1     61.2    8e-08   
ref|XP_003476710.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  61.2    9e-08   
ref|XP_001498346.1|  PREDICTED: glutamine--tRNA ligase isoform X1     61.2    9e-08   
ref|XP_005074998.1|  PREDICTED: glutamine--tRNA ligase isoform X1     60.8    1e-07   
ref|XP_005705938.1|  glutaminyl-tRNA synthetase                       60.8    1e-07   
ref|NP_001007625.1|  glutamine--tRNA ligase                           60.5    1e-07   
ref|XP_008764699.1|  PREDICTED: glutamine--tRNA ligase isoform X1     60.5    1e-07   
ref|XP_007248021.1|  PREDICTED: glutamine--tRNA ligase-like           60.5    1e-07   
ref|XP_001981833.1|  GG12270                                          60.5    1e-07   
ref|XP_004537348.1|  PREDICTED: probable glutamine--tRNA ligase-like  60.5    2e-07   
ref|XP_011203729.1|  PREDICTED: probable glutamine--tRNA ligase       60.1    2e-07   
emb|CCC90123.1|  unnamed protein product                              60.1    2e-07   
emb|CCK72963.1|  hypothetical protein KNAG_0M01100                    60.1    2e-07   
ref|XP_005410244.1|  PREDICTED: glutamine--tRNA ligase isoform X1     60.1    2e-07   
ref|XP_006106163.1|  PREDICTED: glutamine--tRNA ligase isoform X1     60.1    2e-07   
ref|XP_007168823.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  60.1    2e-07   
gb|EDL21298.1|  glutaminyl-tRNA synthetase, isoform CRA_b             59.7    2e-07   
ref|XP_004664222.1|  PREDICTED: glutamine--tRNA ligase                59.7    2e-07   
dbj|BAE38195.1|  unnamed protein product                              59.7    2e-07   
dbj|BAE39814.1|  unnamed protein product                              59.7    2e-07   
dbj|BAC40118.1|  unnamed protein product                              59.7    2e-07   
ref|NP_598555.2|  glutamine--tRNA ligase isoform 1                    59.7    2e-07   
ref|XP_005347978.1|  PREDICTED: glutamine--tRNA ligase isoform X1     59.3    3e-07   
gb|ERL85641.1|  hypothetical protein D910_03058                       59.3    3e-07   
gb|KGG50248.1|  hypothetical protein DI09_7p270                       58.9    4e-07   
gb|KFH62472.1|  hypothetical protein MVEG_11681                       58.9    4e-07   
ref|XP_972452.1|  PREDICTED: probable glutamine--tRNA ligase          58.2    7e-07   
ref|XP_005448789.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  57.8    1e-06   
ref|XP_002054609.1|  GJ24549                                          57.8    1e-06   
emb|CCW66550.1|  unnamed protein product                              57.4    1e-06   
ref|XP_004715208.1|  PREDICTED: glutamine--tRNA ligase-like isofo...  57.0    1e-06   
ref|XP_003512212.1|  PREDICTED: glutamine--tRNA ligase isoform X1     57.4    2e-06   
ref|XP_007888596.1|  PREDICTED: glutamine--tRNA ligase                57.0    2e-06   
ref|XP_001996269.1|  GH22398                                          57.0    2e-06   
ref|XP_001384963.2|  glutaminyl-tRNA synthetase                       57.0    2e-06   
ref|XP_009089536.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  56.6    2e-06   
ref|XP_007533629.1|  PREDICTED: glutamine--tRNA ligase isoform X2     56.6    2e-06   
ref|XP_005183657.1|  PREDICTED: probable glutamine--tRNA ligase       56.6    2e-06   
gb|ENN76683.1|  hypothetical protein YQE_06749                        56.6    3e-06   
ref|XP_003645456.1|  hypothetical protein Ecym_3135                   56.2    3e-06   
ref|XP_004283977.1|  PREDICTED: glutamine--tRNA ligase isoform 3      56.2    3e-06   
ref|XP_003762328.1|  PREDICTED: glutamine--tRNA ligase                56.2    3e-06   
ref|XP_002552669.1|  KLTH0C10340p                                     56.2    4e-06   
ref|XP_001661633.1|  AAEL011395-PA                                    55.8    4e-06   
ref|XP_006909137.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  55.5    5e-06   
ref|XP_001367789.2|  PREDICTED: glutamine--tRNA ligase                55.5    5e-06   
ref|XP_001842299.1|  glutaminyl-tRNA synthetase                       55.1    6e-06   
ref|XP_001564466.1|  putative asparaginyl-tRNA synthetase             55.1    7e-06   
ref|XP_003682997.1|  hypothetical protein TDEL_0G04190                55.1    8e-06   
ref|XP_002108918.1|  hypothetical protein TRIADDRAFT_37025            55.1    8e-06   
ref|XP_010698403.1|  asparaginyl-tRNA synthetase, putative            55.1    8e-06   
ref|XP_001645299.1|  hypothetical protein Kpol_1037p38                54.7    9e-06   
ref|XP_003878787.1|  putative asparaginyl-tRNA synthetase             54.7    1e-05   
ref|XP_003864370.1|  asparaginyl-tRNA synthetase, putative            54.3    2e-05   
ref|XP_001468582.1|  putative asparaginyl-tRNA synthetase             54.3    2e-05   
ref|XP_005141608.1|  PREDICTED: glutamine--tRNA ligase                53.9    2e-05   
emb|CDO96304.1|  unnamed protein product                              53.9    2e-05   
emb|CBH10525.1|  asparaginyl-trna synthetase, putative                53.5    2e-05   
ref|XP_844381.1|  asparaginyl-tRNA synthetase                         53.5    2e-05   
ref|XP_005969307.1|  PREDICTED: glutamine--tRNA ligase isoform X2     53.5    3e-05   
ref|XP_003742677.1|  PREDICTED: glutamine--tRNA ligase-like           53.5    3e-05   
gb|EGA60485.1|  Gln4p                                                 52.8    4e-05   
gb|AHY77459.1|  Gln4p                                                 52.8    4e-05   
gb|EDN64028.1|  glutamyl-tRNA synthetase                              52.8    4e-05   
ref|XP_007343528.1|  glutaminyl-tRNA synthetase                       52.8    5e-05   
ref|XP_001686332.1|  putative asparaginyl-tRNA synthetase             52.4    6e-05   
gb|EGA72935.1|  Gln4p                                                 52.4    6e-05   
emb|CAY86458.1|  Gln4p                                                52.4    6e-05   
gb|EWG93597.1|  Gln4p                                                 52.4    6e-05   
ref|NP_014811.3|  glutamine--tRNA ligase                              52.4    6e-05   
dbj|GAA26484.1|  K7_Gln4p                                             52.4    6e-05   
gb|EGA80856.1|  Gln4p                                                 52.4    6e-05   
gb|EGA76839.1|  Gln4p                                                 52.4    6e-05   
pdb|4H3S|A  Chain A, The Structure Of Glutaminyl-trna Synthetase ...  52.4    6e-05   
ref|XP_007446246.1|  PREDICTED: LOW QUALITY PROTEIN: glutamine--t...  52.0    9e-05   
gb|EJD73912.1|  CBR-ERS-1 protein                                     51.6    9e-05   
ref|XP_006174200.1|  PREDICTED: glutamine--tRNA ligase isoform X1     51.6    1e-04   
ref|XP_006260362.1|  PREDICTED: glutamine--tRNA ligase                51.6    1e-04   
pdb|3TL4|X  Chain X, Crystal Structure Of The Trna Binding Domain...  50.1    1e-04   
gb|EPY28182.1|  asparaginyl-tRNA synthetase                           51.6    1e-04   
emb|CCO30624.1|  glutaminyl-tRNA synthetase                           51.2    1e-04   
ref|XP_006750253.1|  PREDICTED: glutamine--tRNA ligase isoform X1     51.6    1e-04   
ref|XP_005632623.1|  PREDICTED: glutamine--tRNA ligase isoform X3     51.6    1e-04   
ref|XP_004820075.1|  PREDICTED: glutamine--tRNA ligase isoform X3     51.6    1e-04   
ref|XP_005696028.1|  PREDICTED: glutamine--tRNA ligase isoform X2     51.6    1e-04   
ref|XP_004018520.1|  PREDICTED: glutamine--tRNA ligase isoform 2      51.6    1e-04   
ref|XP_003676864.1|  hypothetical protein NCAS_0F00240                51.6    1e-04   
ref|XP_004419742.1|  PREDICTED: glutamine--tRNA ligase isoform 2      51.6    1e-04   
emb|CEL59392.1|  glutaminyl-tRNA synthetase                           51.6    1e-04   
ref|XP_003141138.1|  hypothetical protein LOAG_05553                  48.5    1e-04   
dbj|BAO40215.1|  glutaminyl-tRNA synthetase                           51.2    1e-04   
dbj|BAP71710.1|  glutaminyl-tRNA synthetase                           51.2    1e-04   
ref|XP_004399281.1|  PREDICTED: glutamine--tRNA ligase isoform 2      51.2    1e-04   
ref|XP_010571746.1|  PREDICTED: glutamine--tRNA ligase                51.2    1e-04   
gb|EHJ72088.1|  hypothetical protein KGM_05260                        50.8    2e-04   
ref|XP_006196349.1|  PREDICTED: glutamine--tRNA ligase isoform X1     50.8    2e-04   
ref|XP_003146937.1|  glutaminyl-tRNA synthetase                       50.4    2e-04   
gb|EHN04638.1|  Gln4p                                                 50.4    2e-04   
emb|CCE41115.1|  hypothetical protein CPAR2_301040                    50.1    3e-04   
ref|XP_004581510.1|  PREDICTED: glutamine--tRNA ligase isoform X2     50.1    3e-04   
ref|XP_003672720.1|  hypothetical protein NDAI_0K02860                50.1    4e-04   
ref|XP_006106164.1|  PREDICTED: glutamine--tRNA ligase isoform X2     50.1    4e-04   
ref|XP_003687312.1|  hypothetical protein TPHA_0J00550                49.7    4e-04   
ref|XP_007953509.1|  PREDICTED: glutamine--tRNA ligase isoform X1     49.7    4e-04   
gb|KHN72416.1|  putative glutamine--tRNA ligase                       49.7    4e-04   
ref|XP_002175579.2|  cytoplasmic glutaminyl-tRNA ligase Qrs1          49.7    4e-04   
emb|CDP92052.1|  Protein Bm13816, isoform a                           49.7    4e-04   
ref|XP_001894060.1|  glutaminyl-tRNA synthetase                       49.7    4e-04   
ref|XP_004676237.1|  PREDICTED: glutamine--tRNA ligase isoform X1     49.7    5e-04   
emb|CEF63981.1|  Probable glutamine--tRNA ligase                      49.7    5e-04   
gb|EJT43774.1|  GLN4-like protein                                     49.7    5e-04   
ref|XP_003871347.1|  Gln4 tRNA-Gln synthetase                         49.3    5e-04   
ref|XP_004194373.1|  Piso0_004862                                     49.3    6e-04   
gb|ETE57998.1|  Glutaminyl-tRNA synthetase                            48.9    7e-04   
ref|XP_002669489.1|  predicted protein                                49.3    7e-04   
ref|XP_011105552.1|  gln4p                                            48.9    7e-04   
gb|ESL07401.1|  asparaginyl-tRNA synthetase                           48.9    7e-04   
ref|XP_001523262.1|  glutaminyl-tRNA synthetase                       48.9    7e-04   
ref|XP_007872899.1|  hypothetical protein PNEG_00985                  48.9    7e-04   
ref|XP_008630595.1|  PREDICTED: glutamine--tRNA ligase                48.9    8e-04   
emb|CBQ72322.1|  probable glutamine-tRNA ligase                       48.9    8e-04   
ref|XP_009904251.1|  PREDICTED: glutamine--tRNA ligase                48.5    0.001   



>ref|XP_011076588.1| PREDICTED: glutamine--tRNA ligase [Sesamum indicum]
Length=795

 Score =   217 bits (553),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 107/128 (84%), Positives = 115/128 (90%), Gaps = 0/128 (0%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K  S  GGE PLDLFLKIGLDERTAKNTVANNKVTANLTA I+EAAVTDGCDRT GN
Sbjct  1    MVGKSESESGGEKPLDLFLKIGLDERTAKNTVANNKVTANLTAVIHEAAVTDGCDRTVGN  60

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY+VATKFP NALVHRPTLLKYIVSSKIKTPAQLEAAF FL+A AS+ LK+++FE ACG
Sbjct  61   LLYSVATKFPTNALVHRPTLLKYIVSSKIKTPAQLEAAFSFLAATASDNLKIDDFEAACG  120

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  121  VGVEVSLE  128



>emb|CAN77709.1| hypothetical protein VITISV_017112 [Vitis vinifera]
Length=152

 Score =   196 bits (497),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 95/118 (81%), Positives = 106/118 (90%), Gaps = 1/118 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E PLDLFLKIGLDERTA+NT+ANNKVT+NLTA I+EAAVTDGC RT GNLLYTVATKFPA
Sbjct  6    ETPLDLFLKIGLDERTARNTIANNKVTSNLTAVIHEAAVTDGCSRTIGNLLYTVATKFPA  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGV-GVEVSIE  536
            NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  ++N+FEEACGV GV+VS E
Sbjct  66   NALVHRPTLLQYIVSSKIKTPAQLEAAFSFFTSTGSENFQLNDFEEACGVAGVDVSAE  123



>ref|XP_011070787.1| PREDICTED: LOW QUALITY PROTEIN: glutamine--tRNA ligase-like [Sesamum 
indicum]
Length=796

 Score =   206 bits (525),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 103/128 (80%), Positives = 112/128 (88%), Gaps = 0/128 (0%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K  S  GG+ PLDLFLKIGLDERTAKNTVAN+KVTANLTA I+EAAVTDGCDRT GN
Sbjct  1    MAGKNESESGGDKPLDLFLKIGLDERTAKNTVANSKVTANLTAVIHEAAVTDGCDRTVGN  60

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATKFPANALVHRPTL+KYIVSSKIKTPAQLEAAF F++A AS+ L V  FE ACG
Sbjct  61   LLYTVATKFPANALVHRPTLVKYIVSSKIKTPAQLEAAFSFVAATASDNLSVVGFEAACG  120

Query  513  VGVEVSIE  536
            VG+EVS+E
Sbjct  121  VGIEVSLE  128



>gb|EYU33108.1| hypothetical protein MIMGU_mgv1a018809mg, partial [Erythranthe 
guttata]
Length=356

 Score =   196 bits (498),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            +P DLFLKIGLDE TAKNTVANNKVTANLTA I+EA V DGCDRT GNLLYTVATKFPAN
Sbjct  3    SPADLFLKIGLDENTAKNTVANNKVTANLTAVIHEAGVADGCDRTVGNLLYTVATKFPAN  62

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ALVHRPTLLKYI+SSKIKTPAQLEAAF FLS  AS+ L V++FE ACG+GVE+S+E
Sbjct  63   ALVHRPTLLKYIISSKIKTPAQLEAAFSFLSTTASDKLNVDDFEAACGIGVEISLE  118



>ref|XP_002283636.1| PREDICTED: glutamine--tRNA ligase [Vitis vinifera]
 emb|CBI27000.3| unnamed protein product [Vitis vinifera]
Length=791

 Score =   202 bits (513),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 94/120 (78%), Positives = 107/120 (89%), Gaps = 0/120 (0%)
 Frame = +3

Query  177  DGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATK  356
            D  E PLDLFLKIGLDERTA+NT+ANNKVTANLTA I+EAA+T+GC+RT GNLLYTVATK
Sbjct  6    DNSEKPLDLFLKIGLDERTARNTIANNKVTANLTAVIHEAALTNGCNRTVGNLLYTVATK  65

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            FPANALVHRPTLL+YIVSSKIKTPAQLEAAF F S+  SE  ++ EFEE+CGVG++V IE
Sbjct  66   FPANALVHRPTLLQYIVSSKIKTPAQLEAAFSFYSSIGSENFELKEFEESCGVGIDVPIE  125



>ref|XP_002270305.1| PREDICTED: glutamine--tRNA ligase [Vitis vinifera]
 emb|CBI16687.3| unnamed protein product [Vitis vinifera]
Length=790

 Score =   199 bits (506),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 95/117 (81%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E PLDLFLKIGLDERTA+NT+ANNKVT+NLTA I+EAAVTDGC RT GNLLYTVATKFPA
Sbjct  6    ETPLDLFLKIGLDERTARNTIANNKVTSNLTAVIHEAAVTDGCSRTIGNLLYTVATKFPA  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  ++N+FEEACGVGV+VS E
Sbjct  66   NALVHRPTLLQYIVSSKIKTPAQLEAAFSFFTSTGSENFQLNDFEEACGVGVDVSAE  122



>gb|KDP42069.1| hypothetical protein JCGZ_01857 [Jatropha curcas]
Length=792

 Score =   197 bits (502),  Expect = 1e-55, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 107/123 (87%), Gaps = 0/123 (0%)
 Frame = +3

Query  168  GSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTV  347
            G  +G   PL+LFLKIGLDERTAKNT+ANNKVT +LT  I+EA VT+GC RT GNL+YTV
Sbjct  3    GKEEGSAAPLELFLKIGLDERTAKNTIANNKVTNSLTTVIHEAGVTEGCTRTIGNLIYTV  62

Query  348  ATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
            ATK+PANALVHRPTLL YIVSSKIKTPAQLEAAF FLS  ASE+ K+NEFEEACGVGVEV
Sbjct  63   ATKYPANALVHRPTLLGYIVSSKIKTPAQLEAAFSFLSRTASESFKLNEFEEACGVGVEV  122

Query  528  SIE  536
            S+E
Sbjct  123  SVE  125



>gb|EYU40769.1| hypothetical protein MIMGU_mgv1a001563mg [Erythranthe guttata]
Length=795

 Score =   196 bits (499),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            +P DLFLKIGLDE TAKNTVANNKVTANLTA I+EA V DGCDRT GNLLYTVATKFPAN
Sbjct  3    SPADLFLKIGLDENTAKNTVANNKVTANLTAVIHEAGVADGCDRTVGNLLYTVATKFPAN  62

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ALVHRPTLLKYI+SSKIKTPAQLEAAF FLS  AS+ L V++FE ACG+GVE+S+E
Sbjct  63   ALVHRPTLLKYIISSKIKTPAQLEAAFSFLSTTASDKLNVDDFEAACGIGVEISLE  118



>ref|XP_011022290.1| PREDICTED: glutamine--tRNA ligase isoform X2 [Populus euphratica]
Length=791

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 2/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K+  S G   PLDLFLKIGLDERTA+NT+ANNKVT NLTA I+EA VT+GC+RT GN
Sbjct  1    MEVKEEESSG--TPLDLFLKIGLDERTARNTIANNKVTNNLTAVIHEAGVTEGCNRTIGN  58

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY VATK+PANAL+HRPTLL YIVS+KIKTPAQLEAAF FLS+ ASE+ ++ EFEEACG
Sbjct  59   LLYMVATKYPANALIHRPTLLGYIVSTKIKTPAQLEAAFSFLSSTASESFELKEFEEACG  118

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  119  VGVEVSEE  126



>ref|XP_011022282.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Populus euphratica]
Length=792

 Score =   196 bits (499),  Expect = 4e-55, Method: Composition-based stats.
 Identities = 96/128 (75%), Positives = 109/128 (85%), Gaps = 2/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K+  S G   PLDLFLKIGLDERTA+NT+ANNKVT NLTA I+EA VT+GC+RT GN
Sbjct  1    MEVKEEESSG--TPLDLFLKIGLDERTARNTIANNKVTNNLTAVIHEAGVTEGCNRTIGN  58

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY VATK+PANAL+HRPTLL YIVS+KIKTPAQLEAAF FLS+ ASE+ ++ EFEEACG
Sbjct  59   LLYMVATKYPANALIHRPTLLGYIVSTKIKTPAQLEAAFSFLSSTASESFELKEFEEACG  118

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  119  VGVEVSEE  126



>ref|XP_010320758.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Solanum lycopersicum]
Length=790

 Score =   196 bits (497),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 96/114 (84%), Positives = 105/114 (92%), Gaps = 0/114 (0%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            N LDLFLKIGLDE+TAKNT+ANNKVT NLTA I+EAAVTDGCDR  GNLLYTVATKFPAN
Sbjct  7    NVLDLFLKIGLDEKTAKNTLANNKVTTNLTAVIHEAAVTDGCDRAVGNLLYTVATKFPAN  66

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            AL HRPTLL+YIVS+KIKTPAQLEAAF FL++ ASE LKV++FEEACGVGVEVS
Sbjct  67   ALNHRPTLLQYIVSTKIKTPAQLEAAFAFLASTASENLKVHDFEEACGVGVEVS  120



>ref|XP_010044253.1| PREDICTED: glutamine--tRNA ligase [Eucalyptus grandis]
 gb|KCW86314.1| hypothetical protein EUGRSUZ_B03004 [Eucalyptus grandis]
Length=791

 Score =   196 bits (497),  Expect = 6e-55, Method: Composition-based stats.
 Identities = 92/117 (79%), Positives = 106/117 (91%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            +  L+LFLKIGLDERTAKNTVANNKVTANLTA I+EA+VTDGCD++ GNLLY+VATK+PA
Sbjct  9    DKALELFLKIGLDERTAKNTVANNKVTANLTAVIHEASVTDGCDKSIGNLLYSVATKYPA  68

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NALVHRPTLL+YIVSSKIKT AQL+AAF F S   SE+ K++EFEEACGVGVEVS+E
Sbjct  69   NALVHRPTLLEYIVSSKIKTTAQLDAAFSFFSDTGSESFKIHEFEEACGVGVEVSVE  125



>ref|XP_007225665.1| hypothetical protein PRUPE_ppa001599mg [Prunus persica]
 gb|EMJ26864.1| hypothetical protein PRUPE_ppa001599mg [Prunus persica]
Length=795

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 107/126 (85%), Gaps = 3/126 (2%)
 Frame = +3

Query  168  GSSDGG---ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLL  338
            G  DGG   E  L+LFLK+GLDERTAKNT+ANNKVTANLTA I+EAAVTDGC RT GNLL
Sbjct  3    GKDDGGSDKEKNLELFLKVGLDERTAKNTIANNKVTANLTAVIHEAAVTDGCSRTVGNLL  62

Query  339  YTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVG  518
            YTVATK PANAL+HRPTL++YIVSSKIKTPAQLEAAF F +    E  K++EFEEACGVG
Sbjct  63   YTVATKHPANALLHRPTLVQYIVSSKIKTPAQLEAAFSFFATTGPENFKLSEFEEACGVG  122

Query  519  VEVSIE  536
            VEVS+E
Sbjct  123  VEVSVE  128



>ref|XP_010460393.1| PREDICTED: glutamine--tRNA ligase-like [Camelina sativa]
Length=795

 Score =   194 bits (492),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  L+LFL IGLDERTA+NT+ NNKVTANLTA IYEAAVTDGCDRT GNLLY+VAT
Sbjct  5    DDNSEKSLELFLSIGLDERTARNTINNNKVTANLTAVIYEAAVTDGCDRTTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+P NALVHRPTLLKYIV+SKIKTPAQLEAAF F +    E  K+NEFEEACGVG+EVS 
Sbjct  65   KYPTNALVHRPTLLKYIVTSKIKTPAQLEAAFAFFANTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|XP_010477943.1| PREDICTED: glutamine--tRNA ligase-like [Camelina sativa]
Length=795

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  L+LFL IGLDERTA+NT+ NNKVTANLTA IYEAAVTDGCDRT GNLLY+VAT
Sbjct  5    DDNSEKSLELFLSIGLDERTARNTINNNKVTANLTAVIYEAAVTDGCDRTTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+P NALVHRPTLLKYIV+SKIKTPAQLEAAF F +    E  K+NEFEEACGVG+EVS 
Sbjct  65   KYPTNALVHRPTLLKYIVTSKIKTPAQLEAAFAFFANTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|XP_006303908.1| hypothetical protein CARUB_v10008339mg [Capsella rubella]
 gb|EOA36806.1| hypothetical protein CARUB_v10008339mg [Capsella rubella]
Length=795

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 108/128 (84%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K G+S   E  L+LFL IGLDERTA NT+ NNKVT+NLTA I+EAAVTDGCDRT GN
Sbjct  1    MVLKDGNS---EKSLELFLSIGLDERTASNTINNNKVTSNLTAVIHEAAVTDGCDRTTGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY+VATK+PANALVHRPTLLKYIV+SKIKTPAQLEAAF F +   SE  K+NEFEEACG
Sbjct  58   LLYSVATKYPANALVHRPTLLKYIVTSKIKTPAQLEAAFSFFANTGSEDFKLNEFEEACG  117

Query  513  VGVEVSIE  536
            VG+EVS E
Sbjct  118  VGIEVSPE  125



>ref|XP_010499120.1| PREDICTED: glutamine--tRNA ligase-like [Camelina sativa]
Length=795

 Score =   193 bits (491),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 93/121 (77%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  L+LFL IGLDERTA+NT+ NNKVTANLTA IYEAAVTDGCDRT GNLLY+VAT
Sbjct  5    DDNSEKSLELFLSIGLDERTARNTINNNKVTANLTAVIYEAAVTDGCDRTTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+P NALVHRPTLLKYIV+SKIKTPAQLEAAF F +    E  K+NEFEEACGVG+EVS 
Sbjct  65   KYPTNALVHRPTLLKYIVTSKIKTPAQLEAAFAFFANTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|XP_006344143.1| PREDICTED: glutamine--tRNA ligase-like [Solanum tuberosum]
Length=790

 Score =   193 bits (490),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 95/116 (82%), Positives = 104/116 (90%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            N LDLFLKIGLDE+TAKNT+ANNKVT NLTA I+EAAV DGCDR  GNLLYTVATKFPAN
Sbjct  7    NVLDLFLKIGLDEKTAKNTLANNKVTTNLTAVIHEAAVIDGCDRAVGNLLYTVATKFPAN  66

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            AL HRPTLL+YIVS+KIKTPAQLEAAF FL++ ASE LK ++FEEACGVGVEVS E
Sbjct  67   ALNHRPTLLQYIVSTKIKTPAQLEAAFAFLASTASENLKAHDFEEACGVGVEVSKE  122



>ref|XP_010099748.1| Glutamine--tRNA ligase [Morus notabilis]
 gb|EXB80325.1| Glutamine--tRNA ligase [Morus notabilis]
Length=261

 Score =   183 bits (465),  Expect = 5e-54, Method: Compositional matrix adjust.
 Identities = 88/117 (75%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  L+LFL+IGLD+RTAKNTVANNKVT NLTA I+EA VTDGC R  GNLLYTVATK+P 
Sbjct  11   EKSLELFLRIGLDDRTAKNTVANNKVTTNLTAVIHEAGVTDGCSRAVGNLLYTVATKYPT  70

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N+LVHRPTL++Y+VSSKIKTPAQLEAAF F +    E  K+NEFEEACGVGVEVS+E
Sbjct  71   NSLVHRPTLVEYVVSSKIKTPAQLEAAFSFFATLGPENFKLNEFEEACGVGVEVSVE  127



>ref|XP_010106860.1| Glutamine--tRNA ligase [Morus notabilis]
 gb|EXC12320.1| Glutamine--tRNA ligase [Morus notabilis]
Length=1108

 Score =   195 bits (496),  Expect = 5e-54, Method: Composition-based stats.
 Identities = 94/124 (76%), Positives = 105/124 (85%), Gaps = 0/124 (0%)
 Frame = +3

Query  165  KGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            K +S   E  L+LFL IGLDERTA+NT+ANNKVTANLTA I EAAVTDGC R  GNLLYT
Sbjct  318  KDNSLDKEKCLELFLLIGLDERTARNTIANNKVTANLTAVINEAAVTDGCSRAVGNLLYT  377

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+PAN+LVHRPTL++YIVSSKIKTPAQLEAAF F +   SE  K+NEFEEACGVGVE
Sbjct  378  VATKYPANSLVHRPTLIEYIVSSKIKTPAQLEAAFSFFATTGSENFKLNEFEEACGVGVE  437

Query  525  VSIE  536
            VS+E
Sbjct  438  VSVE  441



>ref|XP_002312407.1| tRNA-glutamine synthetase family protein [Populus trichocarpa]
 gb|EEE89774.1| tRNA-glutamine synthetase family protein [Populus trichocarpa]
Length=786

 Score =   192 bits (489),  Expect = 7e-54, Method: Composition-based stats.
 Identities = 95/128 (74%), Positives = 108/128 (84%), Gaps = 2/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K+  S G   PL+LFLKIGLDERTA+NT+ANNKVT NLTA I+EA VT+GC+RT GN
Sbjct  1    MEVKEEESSG--TPLELFLKIGLDERTARNTIANNKVTNNLTAVIHEAGVTEGCNRTIGN  58

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY VATK PANAL+HRPTLL YIVS+KIKTPAQLEAAF FLS+ ASE+ ++ EFEEACG
Sbjct  59   LLYMVATKHPANALIHRPTLLGYIVSAKIKTPAQLEAAFSFLSSTASESFELKEFEEACG  118

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  119  VGVEVSEE  126



>ref|XP_008243256.1| PREDICTED: glutamine--tRNA ligase [Prunus mume]
Length=795

 Score =   192 bits (487),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 96/126 (76%), Positives = 105/126 (83%), Gaps = 3/126 (2%)
 Frame = +3

Query  168  GSSDGG---ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLL  338
            G  DGG   E  L+LFL +GLDERTAKNT+ANNKVTANLTA I+EAAVTDGC RT GNLL
Sbjct  3    GKDDGGSDKEKNLELFLNVGLDERTAKNTIANNKVTANLTAVIHEAAVTDGCSRTVGNLL  62

Query  339  YTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVG  518
            YTVATK PANALVHRPTL++YIVSSKIKTPAQLEAAF F +    E  K++EFEEACGVG
Sbjct  63   YTVATKHPANALVHRPTLVQYIVSSKIKTPAQLEAAFSFFATTGPENFKLSEFEEACGVG  122

Query  519  VEVSIE  536
            VEVS E
Sbjct  123  VEVSEE  128



>ref|XP_007022144.1| Glutamine-tRNA ligase / glutaminyl-tRNA synthetas, putative isoform 
2 [Theobroma cacao]
 gb|EOY13669.1| Glutamine-tRNA ligase / glutaminyl-tRNA synthetas, putative isoform 
2 [Theobroma cacao]
Length=797

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K  +SD     L+LF+KIGLDERTA+NT+ANNKVTANLTA I+EAA+T+GCDRT GN
Sbjct  1    MVVKDENSD---KTLELFVKIGLDERTARNTIANNKVTANLTAVIHEAALTEGCDRTIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K +EFEEACG
Sbjct  58   LLYTVATKYPANALVHRPDLLEYVVSSKIKTPAQLEAAFLFLSNIASEDFKRSEFEEACG  117

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  118  VGVEVSVE  125



>ref|XP_007022143.1| Glutamine-tRNA ligase / glutaminyl-tRNA synthetas, putative isoform 
1 [Theobroma cacao]
 gb|EOY13668.1| Glutamine-tRNA ligase / glutaminyl-tRNA synthetas, putative isoform 
1 [Theobroma cacao]
Length=794

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 111/128 (87%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K  +SD     L+LF+KIGLDERTA+NT+ANNKVTANLTA I+EAA+T+GCDRT GN
Sbjct  1    MVVKDENSD---KTLELFVKIGLDERTARNTIANNKVTANLTAVIHEAALTEGCDRTIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K +EFEEACG
Sbjct  58   LLYTVATKYPANALVHRPDLLEYVVSSKIKTPAQLEAAFLFLSNIASEDFKRSEFEEACG  117

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  118  VGVEVSVE  125



>ref|XP_002890694.1| hypothetical protein ARALYDRAFT_472840 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH66953.1| hypothetical protein ARALYDRAFT_472840 [Arabidopsis lyrata subsp. 
lyrata]
Length=795

 Score =   191 bits (486),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LFL IGLDE+TA+NT+ NNKVTANLTA I+EAAVTDGCDR  GNLLY+VAT
Sbjct  5    DDNSEKSIELFLSIGLDEKTARNTINNNKVTANLTAVIHEAAVTDGCDRNTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+PANALVHRPTLLKYIV+SKIKTPAQLEAAF F +  +SE  K+NEFEEACGVG+EVS 
Sbjct  65   KYPANALVHRPTLLKYIVTSKIKTPAQLEAAFAFFANTSSEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|XP_006448448.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
 gb|ESR61688.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
Length=710

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>ref|XP_009356249.1| PREDICTED: glutamine--tRNA ligase-like [Pyrus x bretschneideri]
Length=796

 Score =   191 bits (485),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 96/123 (78%), Positives = 106/123 (86%), Gaps = 1/123 (1%)
 Frame = +3

Query  168  GSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTV  347
            GSS+  +N L+LFLK+GLDERTAKNT+ANNKVTANLTA I+EAAVTDGC RT GNLLYTV
Sbjct  8    GSSEKEKN-LELFLKVGLDERTAKNTIANNKVTANLTAVIHEAAVTDGCSRTVGNLLYTV  66

Query  348  ATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
            ATK PANALVHRPTL +YIVSSKIKTPAQLEAAF F +    E  +VN+FEEACGVGVEV
Sbjct  67   ATKHPANALVHRPTLAQYIVSSKIKTPAQLEAAFSFFATTGPENFEVNKFEEACGVGVEV  126

Query  528  SIE  536
            S E
Sbjct  127  SEE  129



>ref|XP_006448449.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
 gb|ESR61689.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
Length=762

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>ref|XP_006448447.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
 gb|ESR61687.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
Length=796

 Score =   191 bits (484),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>ref|XP_006448446.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
 gb|ESR61686.1| hypothetical protein CICLE_v10014320mg [Citrus clementina]
Length=797

 Score =   191 bits (484),  Expect = 4e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 108/124 (87%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL+YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLRYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>gb|KDO76967.1| hypothetical protein CISIN_1g003751mg [Citrus sinensis]
Length=628

 Score =   189 bits (479),  Expect = 6e-53, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLLYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>gb|KJB61243.1| hypothetical protein B456_009G347600 [Gossypium raimondii]
Length=706

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K   SD     L+LFLKIGLDERTA+NT+ANNKVTANLTA I+EAA+ +GCDR  GN
Sbjct  1    MVVKGEESD---KILELFLKIGLDERTARNTIANNKVTANLTAVIHEAALANGCDRAIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
             LYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K NEFEEACG
Sbjct  58   FLYTVATKYPANALVHRPKLLEYVVSSKIKTPAQLEAAFSFLSNVASEEFKRNEFEEACG  117

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  118  VGVEVSLE  125



>gb|KJB61242.1| hypothetical protein B456_009G347600 [Gossypium raimondii]
Length=779

 Score =   189 bits (480),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K   SD     L+LFLKIGLDERTA+NT+ANNKVTANLTA I+EAA+ +GCDR  GN
Sbjct  1    MVVKGEESD---KILELFLKIGLDERTARNTIANNKVTANLTAVIHEAALANGCDRAIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
             LYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K NEFEEACG
Sbjct  58   FLYTVATKYPANALVHRPKLLEYVVSSKIKTPAQLEAAFSFLSNVASEEFKRNEFEEACG  117

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  118  VGVEVSLE  125



>gb|KJB61241.1| hypothetical protein B456_009G347600 [Gossypium raimondii]
Length=793

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 97/128 (76%), Positives = 107/128 (84%), Gaps = 3/128 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K   SD     L+LFLKIGLDERTA+NT+ANNKVTANLTA I+EAA+ +GCDR  GN
Sbjct  1    MVVKGEESD---KILELFLKIGLDERTARNTIANNKVTANLTAVIHEAALANGCDRAIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
             LYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K NEFEEACG
Sbjct  58   FLYTVATKYPANALVHRPKLLEYVVSSKIKTPAQLEAAFSFLSNVASEEFKRNEFEEACG  117

Query  513  VGVEVSIE  536
            VGVEVS+E
Sbjct  118  VGVEVSLE  125



>gb|KDO76966.1| hypothetical protein CISIN_1g003751mg [Citrus sinensis]
Length=745

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLLYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>gb|KDO76963.1| hypothetical protein CISIN_1g003751mg [Citrus sinensis]
Length=798

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLLYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>ref|XP_006468715.1| PREDICTED: glutamine--tRNA ligase-like [Citrus sinensis]
 gb|KDO76964.1| hypothetical protein CISIN_1g003751mg [Citrus sinensis]
Length=797

 Score =   189 bits (479),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 95/124 (77%), Positives = 107/124 (86%), Gaps = 1/124 (1%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRPTLL YIVSSKIKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   VATKYPTNALVHRPTLLLYIVSSKIKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  122

Query  525  VSIE  536
            VS E
Sbjct  123  VSSE  126



>ref|NP_173906.2| putative tRNA-glutamine ligase [Arabidopsis thaliana]
 gb|AAL32672.1| Unknown protein [Arabidopsis thaliana]
 gb|AAM47972.1| unknown protein [Arabidopsis thaliana]
 gb|AEE30610.1| putative tRNA-glutamine ligase [Arabidopsis thaliana]
Length=795

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LF+ IGLDE+TA+NT+ NNKVTANLTA I+EAAVTDGCDR  GNLLY+VAT
Sbjct  5    DDNSEKSIELFISIGLDEKTARNTINNNKVTANLTAVIHEAAVTDGCDRNTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            KFP NALVHRPTLLKYIV+SKIKTPAQLEAAF F ++   E  K+NEFEEACGVG+EVS 
Sbjct  65   KFPTNALVHRPTLLKYIVNSKIKTPAQLEAAFAFFASTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>gb|AAG28806.2|AC079374_9 tRNA-glutamine synthetase, putative [Arabidopsis thaliana]
Length=786

 Score =   188 bits (478),  Expect = 2e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LF+ IGLDE+TA+NT+ NNKVTANLTA I+EAAVTDGCDR  GNLLY+VAT
Sbjct  5    DDNSEKSIELFISIGLDEKTARNTINNNKVTANLTAVIHEAAVTDGCDRNTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            KFP NALVHRPTLLKYIV+SKIKTPAQLEAAF F ++   E  K+NEFEEACGVG+EVS 
Sbjct  65   KFPTNALVHRPTLLKYIVNSKIKTPAQLEAAFAFFASTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|NP_001185094.1| putative tRNA-glutamine ligase [Arabidopsis thaliana]
 gb|AEE30611.1| putative tRNA-glutamine ligase [Arabidopsis thaliana]
Length=800

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LF+ IGLDE+TA+NT+ NNKVTANLTA I+EAAVTDGCDR  GNLLY+VAT
Sbjct  5    DDNSEKSIELFISIGLDEKTARNTINNNKVTANLTAVIHEAAVTDGCDRNTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            KFP NALVHRPTLLKYIV+SKIKTPAQLEAAF F ++   E  K+NEFEEACGVG+EVS 
Sbjct  65   KFPTNALVHRPTLLKYIVNSKIKTPAQLEAAFAFFASTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>pir||D86383 probable glutaminyl-tRNA synthetase (glnrs) [imported] - Arabidopsis 
thaliana
Length=729

 Score =   188 bits (477),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LF+ IGLDE+TA+NT+ NNKVTANLTA I+EAAVTDGCDR  GNLLY+VAT
Sbjct  5    DDNSEKSIELFISIGLDEKTARNTINNNKVTANLTAVIHEAAVTDGCDRNTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            KFP NALVHRPTLLKYIV+SKIKTPAQLEAAF F ++   E  K+NEFEEACGVG+EVS 
Sbjct  65   KFPTNALVHRPTLLKYIVNSKIKTPAQLEAAFAFFASTGPEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>ref|XP_008389271.1| PREDICTED: glutamine--tRNA ligase [Malus domestica]
Length=796

 Score =   187 bits (475),  Expect = 7e-52, Method: Compositional matrix adjust.
 Identities = 94/123 (76%), Positives = 105/123 (85%), Gaps = 1/123 (1%)
 Frame = +3

Query  168  GSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTV  347
            GSS+  +N L+LFLK+GLDERTAKNT+AN KVTANLTA I+EA VTDGC+RT GNLLYTV
Sbjct  8    GSSEKEKN-LELFLKVGLDERTAKNTIANXKVTANLTAVIHEAXVTDGCNRTVGNLLYTV  66

Query  348  ATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
            ATK PANALVHRPTL +YIVSSKIKTPAQLEAAF F +    E  +VN+FEEACGVGVEV
Sbjct  67   ATKHPANALVHRPTLAQYIVSSKIKTPAQLEAAFSFFATTGPEXFEVNKFEEACGVGVEV  126

Query  528  SIE  536
            S E
Sbjct  127  SEE  129



>ref|XP_010551245.1| PREDICTED: glutamine--tRNA ligase [Tarenaya hassleriana]
Length=796

 Score =   187 bits (474),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 99/127 (78%), Positives = 109/127 (86%), Gaps = 3/127 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K+GSSD     L+LFLKIGLDERTA+NTVANNKVT+NLTA I+EAAVTDGCDRT GN
Sbjct  1    MVAKEGSSD---RSLELFLKIGLDERTARNTVANNKVTSNLTAVIHEAAVTDGCDRTTGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FL+    E    NEFEEACG
Sbjct  58   LLYTVATKYPANALVHRPKLLEYVVSSKIKTPAQLEAAFSFLANTGPEEFNPNEFEEACG  117

Query  513  VGVEVSI  533
            VGVEVS+
Sbjct  118  VGVEVSL  124



>ref|XP_002526992.1| glutaminyl-tRNA synthetase, putative [Ricinus communis]
 gb|EEF35364.1| glutaminyl-tRNA synthetase, putative [Ricinus communis]
Length=793

 Score =   186 bits (472),  Expect = 1e-51, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 106/128 (83%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K+ SS     PL+LFLKIGLDERTAKNT+ANNKVT NLT  I+EA V +GC RT GN
Sbjct  1    MVVKEESS-AATPPLELFLKIGLDERTAKNTIANNKVTNNLTTVIHEAGVNEGCSRTVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+P NALVHRP LL+YIVSSKIKT AQLEAAF FLS  ASE+ K+N+FEEACG
Sbjct  60   LLYTVATKYPTNALVHRPALLEYIVSSKIKTSAQLEAAFSFLSNTASESFKLNDFEEACG  119

Query  513  VGVEVSIE  536
            VGVEVS +
Sbjct  120  VGVEVSAD  127



>sp|P52780.2|SYQ_LUPLU RecName: Full=Glutamine--tRNA ligase; AltName: Full=Glutaminyl-tRNA 
synthetase; Short=GlnRS [Lupinus luteus]
 emb|CAA62901.1| tRNA-glutamine synthetase [Lupinus luteus]
Length=794

 Score =   185 bits (469),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 93/128 (73%), Positives = 104/128 (81%), Gaps = 0/128 (0%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K  +S   E  L+LFLKIGLDERTAKNTVANNKVT NLT+ I +A VTDGC RT GN
Sbjct  1    MPAKDDTSSDKEKSLELFLKIGLDERTAKNTVANNKVTTNLTSVINDAGVTDGCSRTVGN  60

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANAL HRPTLL+YIV+SK+KT AQL+AA  FLSA  SE L +N+FEEACG
Sbjct  61   LLYTVATKYPANALPHRPTLLQYIVNSKVKTTAQLDAALSFLSATGSENLDLNKFEEACG  120

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  121  VGVEVSTE  128



>ref|XP_003536678.1| PREDICTED: glutamine--tRNA ligase-like isoform 1 [Glycine max]
Length=794

 Score =   185 bits (469),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 96/128 (75%), Positives = 103/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K   SD  E  LDLFLKIGLDERTAKNTVANNKVTANLTA IYEA V DGC R  GN
Sbjct  1    MPAKDDGSDK-EKCLDLFLKIGLDERTAKNTVANNKVTANLTAVIYEAGVIDGCSRAVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANAL HRPTLL+YIVS K+KT AQL+AA  FL+   SE L +N+FEEACG
Sbjct  60   LLYTVATKYPANALPHRPTLLQYIVSLKVKTTAQLDAALSFLAITGSENLDLNKFEEACG  119

Query  513  VGVEVSIE  536
            VGVEVSIE
Sbjct  120  VGVEVSIE  127



>ref|XP_009356957.1| PREDICTED: glutamine--tRNA ligase-like [Pyrus x bretschneideri]
Length=797

 Score =   184 bits (466),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 90/126 (71%), Positives = 103/126 (82%), Gaps = 0/126 (0%)
 Frame = +3

Query  159  EKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLL  338
            ++ GSS   E  L+LFLK+GLDERTAKNT+ANNKVTANLT  I+EAAV +GC RT GNLL
Sbjct  5    DEGGSSSEKEKNLELFLKVGLDERTAKNTIANNKVTANLTTVIHEAAVAEGCSRTVGNLL  64

Query  339  YTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVG  518
            YTVATK PANA+VHRP L +YIVSSKIKTPAQLEAAF FL+    E   +++FEEACGVG
Sbjct  65   YTVATKHPANAIVHRPKLAQYIVSSKIKTPAQLEAAFSFLATRGPENFDIHKFEEACGVG  124

Query  519  VEVSIE  536
            VEVS E
Sbjct  125  VEVSEE  130



>gb|AES62889.2| glutamine-tRNA ligase [Medicago truncatula]
Length=794

 Score =   183 bits (465),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  LDLFLKIGLDERTAKNT+ANNKVT NLTA I+EAAVTDGC RT GNL+YTVATK+P 
Sbjct  11   EKCLDLFLKIGLDERTAKNTIANNKVTTNLTAVIHEAAVTDGCTRTVGNLIYTVATKYPG  70

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NAL HRPTLL+Y+VSSK+KT AQL+AA  FL+   SE L VN+FEEACGVGVEVS E
Sbjct  71   NALPHRPTLLEYVVSSKVKTTAQLDAALSFLANTGSENLDVNKFEEACGVGVEVSTE  127



>ref|XP_003592638.1| Glutaminyl-tRNA synthetase [Medicago truncatula]
Length=804

 Score =   183 bits (464),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/117 (77%), Positives = 100/117 (85%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  LDLFLKIGLDERTAKNT+ANNKVT NLTA I+EAAVTDGC RT GNL+YTVATK+P 
Sbjct  11   EKCLDLFLKIGLDERTAKNTIANNKVTTNLTAVIHEAAVTDGCTRTVGNLIYTVATKYPG  70

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NAL HRPTLL+Y+VSSK+KT AQL+AA  FL+   SE L VN+FEEACGVGVEVS E
Sbjct  71   NALPHRPTLLEYVVSSKVKTTAQLDAALSFLANTGSENLDVNKFEEACGVGVEVSTE  127



>ref|XP_006378476.1| hypothetical protein POPTR_0010s13280g [Populus trichocarpa]
 ref|XP_006378477.1| hypothetical protein POPTR_0010s13280g [Populus trichocarpa]
 gb|ERP56273.1| hypothetical protein POPTR_0010s13280g [Populus trichocarpa]
 gb|ERP56274.1| hypothetical protein POPTR_0010s13280g [Populus trichocarpa]
Length=683

 Score =   182 bits (462),  Expect = 2e-50, Method: Composition-based stats.
 Identities = 86/117 (74%), Positives = 101/117 (86%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  L+LFLK GLDERTA++T+ANNKVT NLTA I+EA VT+GC+RT GNLLYTVATK+PA
Sbjct  6    EERLELFLKTGLDERTARHTIANNKVTNNLTAVIHEAGVTEGCNRTIGNLLYTVATKYPA  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NAL+HRP LL YIV++KIK PAQLEAAF FLS+ ASE+ ++  FEEACGVGVEVS E
Sbjct  66   NALIHRPALLGYIVTTKIKNPAQLEAAFSFLSSTASESFELKGFEEACGVGVEVSEE  122



>gb|KHN05557.1| Glutamine--tRNA ligase [Glycine soja]
Length=769

 Score =   182 bits (463),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 95/128 (74%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K   SD  E  LDLFLKIGLDERTAKNTVANNKVTANLTA IYEA V DGC R  GN
Sbjct  1    MPAKDDGSDK-EKCLDLFLKIGLDERTAKNTVANNKVTANLTAVIYEAGVIDGCSRAVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANAL HRPTLL+YIVS K+KT AQL+AA  FL+   SE L +N+FEEACG
Sbjct  60   LLYTVATKYPANALPHRPTLLQYIVSLKVKTTAQLDAALSFLAITGSENLDLNKFEEACG  119

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  120  VGVEVSTE  127



>ref|XP_004497076.1| PREDICTED: glutamine--tRNA ligase-like [Cicer arietinum]
Length=794

 Score =   181 bits (460),  Expect = 7e-50, Method: Compositional matrix adjust.
 Identities = 90/128 (70%), Positives = 104/128 (81%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K  +SD  E  LDLFLKIGLDERTAKNT+ANNKVT NLT+ I+EA VTDGC RT GN
Sbjct  1    MPTKDDNSDK-EKCLDLFLKIGLDERTAKNTIANNKVTNNLTSVIHEAGVTDGCSRTVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            L+YTVATK+P NAL HRPTLL+Y+VSSK+KT AQL+AA  FL+   SE L +N+FEEACG
Sbjct  60   LIYTVATKYPGNALSHRPTLLQYVVSSKVKTTAQLDAALAFLATTGSENLDLNKFEEACG  119

Query  513  VGVEVSIE  536
            VG+EVS E
Sbjct  120  VGIEVSTE  127



>ref|XP_007142926.1| hypothetical protein PHAVU_007G028800g [Phaseolus vulgaris]
 gb|ESW14920.1| hypothetical protein PHAVU_007G028800g [Phaseolus vulgaris]
Length=793

 Score =   181 bits (458),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 94/128 (73%), Positives = 102/128 (80%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K G SD  E  LDLFLKIGLDERTA+NTVANNKVTANLT+ I EA VTDGC RT GN
Sbjct  1    MPAKDGGSDK-EKCLDLFLKIGLDERTARNTVANNKVTANLTSVINEAGVTDGCSRTVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANAL HRPTLL+YIVSSK+KT AQL+AA  FL++   E L    FEEACG
Sbjct  60   LLYTVATKYPANALPHRPTLLQYIVSSKVKTTAQLDAALSFLASTGLENLDSKTFEEACG  119

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  120  VGVEVSTE  127



>ref|XP_011464100.1| PREDICTED: glutamine--tRNA ligase [Fragaria vesca subsp. vesca]
Length=794

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 99/125 (79%), Gaps = 0/125 (0%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K+  +   E  L+LFLK+GLDERTAKNT+ANNKVTANLTA I+EAAVTDGC R  GN
Sbjct  1    MPSKEDGASDKEKILELFLKVGLDERTAKNTIANNKVTANLTAVIHEAAVTDGCSRNVGN  60

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATKFPANALVHRP L +YIVSSKIK PAQL+AA  F +    E  K +EFEEACG
Sbjct  61   LLYTVATKFPANALVHRPVLTQYIVSSKIKIPAQLDAALSFFANTGPENFKTSEFEEACG  120

Query  513  VGVEV  527
            VGVEV
Sbjct  121  VGVEV  125



>ref|XP_010272844.1| PREDICTED: glutamine--tRNA ligase [Nelumbo nucifera]
Length=792

 Score =   180 bits (456),  Expect = 2e-49, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 99/120 (83%), Gaps = 0/120 (0%)
 Frame = +3

Query  177  DGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATK  356
            D  E  L+LFL+IGLDERTA+NT+ANNKVT NLTA I+EA VTDGC R  GNLLYTVATK
Sbjct  6    DSNEKSLELFLRIGLDERTARNTIANNKVTGNLTAVIHEAGVTDGCSRAVGNLLYTVATK  65

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            FPANALVHRPTLL+Y+VS KIKTPAQLEAAF F ++   E  ++N+FE  CGVGV+VS E
Sbjct  66   FPANALVHRPTLLEYVVSLKIKTPAQLEAAFSFFTSVGQEKFQLNDFEVTCGVGVDVSSE  125



>ref|XP_008460942.1| PREDICTED: glutamine--tRNA ligase-like [Cucumis melo]
Length=794

 Score =   179 bits (455),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 97/114 (85%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL+IGLDERTA+NTVANNKVTANL A I+EA V DGC+R  GNLLYTVATK+P NAL
Sbjct  14   LEQFLRIGLDERTARNTVANNKVTANLNAVIHEAGVLDGCNRAVGNLLYTVATKYPTNAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            VHRP LLKYI S+K+K PAQLEAAF F SA   E +K+NEFE+ACGVGVEVS+E
Sbjct  74   VHRPILLKYITSNKVKMPAQLEAAFSFFSAAGQEDIKLNEFEDACGVGVEVSVE  127



>gb|KFK44542.1| hypothetical protein AALP_AA1G270200 [Arabis alpina]
Length=795

 Score =   179 bits (455),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 100/121 (83%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             D  E  ++LFL IGL+E+TA+NT+ N KVT+NLT  I EA VTDGCDRT GNLLY+VAT
Sbjct  5    DDNSEKSVELFLSIGLEEKTARNTINNPKVTSNLTVVINEAGVTDGCDRTTGNLLYSVAT  64

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+PANALVHRPTLLKYIVSSKIKTPAQL+AAF F +   SE  K+NEFEEACGVG+EVS 
Sbjct  65   KYPANALVHRPTLLKYIVSSKIKTPAQLDAAFLFFANTGSEDFKLNEFEEACGVGIEVSP  124

Query  534  E  536
            E
Sbjct  125  E  125



>gb|KHG03894.1| Glutamine--tRNA ligase [Gossypium arboreum]
Length=736

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 91/121 (75%), Positives = 101/121 (83%), Gaps = 3/121 (2%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K   SD     L+LFLKIGLDERTA+NT+ANNKVTANLTA ++EAA+ +GCDR  GN
Sbjct  1    MVVKGEESD---KILELFLKIGLDERTARNTIANNKVTANLTAVVHEAALANGCDRAIGN  57

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATK+PANALVHRP LL+Y+VSSKIKTPAQLEAAF FLS  ASE  K NEFEEACG
Sbjct  58   LLYTVATKYPANALVHRPKLLEYVVSSKIKTPAQLEAAFSFLSNVASEEFKRNEFEEACG  117

Query  513  V  515
            V
Sbjct  118  V  118



>emb|CDP00642.1| unnamed protein product [Coffea canephora]
Length=799

 Score =   178 bits (451),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 98/128 (77%), Positives = 109/128 (85%), Gaps = 2/128 (2%)
 Frame = +3

Query  159  EKKGSSDGGENP--LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            +K  +S GG+    +++FLKIGL+E+TAKNT+ANNKVTANL A I EA VTDGCDRT GN
Sbjct  6    DKDSNSGGGDKAEMVEMFLKIGLEEKTAKNTIANNKVTANLLAVIQEAEVTDGCDRTVGN  65

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLYTVATKFPANALVHRP LLKYIVSSKIKTPAQLEAAF FL+A A E LK NEFE+ACG
Sbjct  66   LLYTVATKFPANALVHRPILLKYIVSSKIKTPAQLEAAFAFLAAIAGENLKANEFEDACG  125

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  126  VGVEVSAE  133



>ref|XP_008457734.1| PREDICTED: glutamine--tRNA ligase-like isoform X2 [Cucumis melo]
Length=794

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LFL+IGLDERTA+NTVANNKVTANL+A I+EA V DGC R  GNLLY+VATK+PANAL
Sbjct  14   LELFLRIGLDERTARNTVANNKVTANLSAVIHEAGVLDGCHRAVGNLLYSVATKYPANAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +HRP LL YI S+K+KTPAQLEAAF F SA  SE +K+NEFE ACGVGVEVS+E
Sbjct  74   IHRPILLDYITSNKVKTPAQLEAAFSFFSAAGSE-IKLNEFESACGVGVEVSVE  126



>ref|XP_004148841.1| PREDICTED: glutamine--tRNA ligase-like [Cucumis sativus]
 gb|KGN61800.1| hypothetical protein Csa_2G247610 [Cucumis sativus]
Length=794

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL+IGLDERTA+NTVANNKVTANL A I+EA V DGC++T GNLLYTVATK+P NAL
Sbjct  14   LEQFLRIGLDERTARNTVANNKVTANLNAVIHEAGVLDGCNKTVGNLLYTVATKYPTNAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            VHRP LL+YI S+K+K PAQLEAAF F SA   E +K+N+FE+ACGVGVEVS+E
Sbjct  74   VHRPILLQYITSNKVKMPAQLEAAFSFFSAAGQEDIKLNDFEDACGVGVEVSVE  127



>ref|XP_008457735.1| PREDICTED: glutamine--tRNA ligase-like isoform X3 [Cucumis melo]
Length=793

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LFL+IGLDERTA+NTVANNKVTANL+A I+EA V DGC R  GNLLY+VATK+PANAL
Sbjct  14   LELFLRIGLDERTARNTVANNKVTANLSAVIHEAGVLDGCHRAVGNLLYSVATKYPANAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +HRP LL YI S+K+KTPAQLEAAF F SA  SE +K+NEFE ACGVGVEVS+E
Sbjct  74   IHRPILLDYITSNKVKTPAQLEAAFSFFSAAGSE-IKLNEFESACGVGVEVSVE  126



>ref|XP_004164827.1| PREDICTED: LOW QUALITY PROTEIN: glutamine--tRNA ligase-like [Cucumis 
sativus]
Length=794

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 83/114 (73%), Positives = 98/114 (86%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL+IGLDERTA+NTVANNKVTANL A I+EA V DGC++T GNLLYTVATK+P NAL
Sbjct  14   LEQFLRIGLDERTARNTVANNKVTANLNAVIHEAGVLDGCNKTVGNLLYTVATKYPTNAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            VHRP LL+YI S+K+K PAQLEAAF F SA   E +K+N+FE+ACGVGVEVS+E
Sbjct  74   VHRPILLQYITSNKVKMPAQLEAAFSFFSAAGQEDIKLNDFEDACGVGVEVSVE  127



>ref|XP_008457733.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Cucumis melo]
Length=796

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 86/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LFL+IGLDERTA+NTVANNKVTANL+A I+EA V DGC R  GNLLY+VATK+PANAL
Sbjct  14   LELFLRIGLDERTARNTVANNKVTANLSAVIHEAGVLDGCHRAVGNLLYSVATKYPANAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +HRP LL YI S+K+KTPAQLEAAF F SA  SE +K+NEFE ACGVGVEVS+E
Sbjct  74   IHRPILLDYITSNKVKTPAQLEAAFSFFSAAGSE-IKLNEFESACGVGVEVSVE  126



>ref|XP_004158365.1| PREDICTED: glutamine--tRNA ligase-like [Cucumis sativus]
Length=800

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL+IGLDERTA+NTVANNKVTANL+A I+EA V DGCDR  GNLLY+VATK+PANAL
Sbjct  14   LEQFLRIGLDERTARNTVANNKVTANLSAVIHEAGVLDGCDRAVGNLLYSVATKYPANAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +HRP LL YI S+K+KTPAQLEAAF F SA  SE +++NEFE ACGVGVEVS+E
Sbjct  74   IHRPILLDYITSNKVKTPAQLEAAFSFFSAAGSE-IRLNEFESACGVGVEVSVE  126



>ref|XP_004147055.1| PREDICTED: glutamine--tRNA ligase-like [Cucumis sativus]
 gb|KGN61952.1| hypothetical protein Csa_2G271450 [Cucumis sativus]
Length=793

 Score =   177 bits (449),  Expect = 2e-48, Method: Compositional matrix adjust.
 Identities = 85/114 (75%), Positives = 99/114 (87%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL+IGLDERTA+NTVANNKVTANL+A I+EA V DGCDR  GNLLY+VATK+PANAL
Sbjct  14   LEQFLRIGLDERTARNTVANNKVTANLSAVIHEAGVLDGCDRAVGNLLYSVATKYPANAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +HRP LL YI S+K+KTPAQLEAAF F SA  SE +++NEFE ACGVGVEVS+E
Sbjct  74   IHRPILLDYITSNKVKTPAQLEAAFSFFSAAGSE-IRLNEFESACGVGVEVSVE  126



>gb|KHN11406.1| Glutamine--tRNA ligase [Glycine soja]
Length=794

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 92/128 (72%), Positives = 100/128 (78%), Gaps = 1/128 (1%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            M  K   SD  E  LDLFLKIGLDERTAKNTVANNKVTANLT+ I EA  TDGC RT GN
Sbjct  1    MPAKDDGSDK-EKCLDLFLKIGLDERTAKNTVANNKVTANLTSVIDEAGATDGCSRTVGN  59

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
             LYTVATK+PANAL HRPTLL+YIVS K+KT AQL+AA  FL+   SE L ++ FEEACG
Sbjct  60   FLYTVATKYPANALPHRPTLLQYIVSLKVKTTAQLDAALSFLATTGSENLDLDRFEEACG  119

Query  513  VGVEVSIE  536
            VGVEVS E
Sbjct  120  VGVEVSEE  127



>ref|XP_009797950.1| PREDICTED: glutamine--tRNA ligase [Nicotiana sylvestris]
Length=791

 Score =   172 bits (436),  Expect = 1e-46, Method: Compositional matrix adjust.
 Identities = 93/112 (83%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LFLKIGLDE+TAKNT+ANNKVT NLTA I+EAAVTDGCDRT GNL+YTVATKFPANAL
Sbjct  10   LELFLKIGLDEKTAKNTLANNKVTTNLTAVIHEAAVTDGCDRTVGNLIYTVATKFPANAL  69

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
             HRPTLL+YIVS+KIKTPAQLEAAF FL+A AS  L   EFEEACGVGVEVS
Sbjct  70   NHRPTLLQYIVSTKIKTPAQLEAAFTFLAATASGDLNTQEFEEACGVGVEVS  121



>ref|XP_009626236.1| PREDICTED: glutamine--tRNA ligase [Nicotiana tomentosiformis]
Length=791

 Score =   171 bits (433),  Expect = 4e-46, Method: Compositional matrix adjust.
 Identities = 92/112 (82%), Positives = 101/112 (90%), Gaps = 0/112 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LFLKIGLDE+TAKNT+ANNKVT NLTA I+EAAVTDGCDRT GNL+YTVATKFPANAL
Sbjct  10   LELFLKIGLDEKTAKNTLANNKVTTNLTAVIHEAAVTDGCDRTVGNLIYTVATKFPANAL  69

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
             HRPTLL+YIVS+KIKTPAQLEAAF FL+A AS  L   EF+EACGVGVEVS
Sbjct  70   NHRPTLLQYIVSTKIKTPAQLEAAFTFLAATASGNLNTQEFDEACGVGVEVS  121



>ref|XP_009115303.1| PREDICTED: glutamine--tRNA ligase-like [Brassica rapa]
Length=793

 Score =   169 bits (429),  Expect = 1e-45, Method: Composition-based stats.
 Identities = 82/118 (69%), Positives = 93/118 (79%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  GENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
             +  + LFL IGLDE+TA  T+ N KVTANLTA I+EA VTDGCDRT GNLLYTVATK  
Sbjct  5    ADESVKLFLSIGLDEKTAATTINNPKVTANLTAVIHEAGVTDGCDRTTGNLLYTVATKHH  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +N L+HRPTL  YIVSSKIKTPAQL+AA  F   +A+E  K+NEFEEACGVGVEVS E
Sbjct  65   SNLLLHRPTLFDYIVSSKIKTPAQLDAAVSFFDNHAAEDFKLNEFEEACGVGVEVSAE  122



>emb|CDY42114.1| BnaA09g28460D [Brassica napus]
Length=816

 Score =   169 bits (429),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 82/117 (70%), Positives = 93/117 (79%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            +  + LFL IGLDE+TA  T+ N KVTANLTA I+EA VTDGCDRT GNLLYTVATK  +
Sbjct  6    DESVKLFLSIGLDEKTAATTINNPKVTANLTAVIHEAGVTDGCDRTTGNLLYTVATKHHS  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N L+HRPTL  YIVSSKIKTPAQL+AA  F   +A+E  K+NEFEEACGVGVEVS E
Sbjct  66   NLLLHRPTLFDYIVSSKIKTPAQLDAAVSFFDNHAAEDFKLNEFEEACGVGVEVSAE  122



>ref|XP_010684954.1| PREDICTED: glutamine--tRNA ligase-like [Beta vulgaris subsp. 
vulgaris]
 ref|XP_010684955.1| PREDICTED: glutamine--tRNA ligase-like [Beta vulgaris subsp. 
vulgaris]
Length=792

 Score =   169 bits (428),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 82/122 (67%), Positives = 100/122 (82%), Gaps = 0/122 (0%)
 Frame = +3

Query  171  SSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVA  350
            +++   N ++LFLKIGLDE+ A NT+ANNKVT NL A I+EA VT+GCDRT GNLLYTVA
Sbjct  5    TAENSNNAVELFLKIGLDEKVAHNTIANNKVTNNLLAVIHEAGVTNGCDRTTGNLLYTVA  64

Query  351  TKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            TKFPANAL+HRPTL  Y+VSSKIKT AQLEAAF F ++   E L +++FE+ACGVG+EVS
Sbjct  65   TKFPANALMHRPTLAGYVVSSKIKTQAQLEAAFTFFASVGPEELNLSDFEKACGVGIEVS  124

Query  531  IE  536
             E
Sbjct  125  NE  126



>ref|XP_009405807.1| PREDICTED: glutamine--tRNA ligase-like [Musa acuminata subsp. 
malaccensis]
Length=790

 Score =   168 bits (426),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 83/121 (69%), Positives = 96/121 (79%), Gaps = 1/121 (1%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             DG   PLDLFL IGLD+RTA+N + N KVT+NLTA I EA V + C +T GNLLY VAT
Sbjct  4    EDGDAKPLDLFLSIGLDKRTAENALVNQKVTSNLTAVIAEAGVNE-CSKTIGNLLYMVAT  62

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+PANALVHRPTL++YIVSSKIK PAQL+AA  FL     ET K+NEFEEACG+GV+VSI
Sbjct  63   KYPANALVHRPTLIQYIVSSKIKNPAQLDAALAFLGTVGPETFKLNEFEEACGIGVDVSI  122

Query  534  E  536
            E
Sbjct  123  E  123



>emb|CDX84982.1| BnaC05g20730D [Brassica napus]
Length=819

 Score =   169 bits (427),  Expect = 3e-45, Method: Composition-based stats.
 Identities = 81/118 (69%), Positives = 94/118 (80%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  GENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
             +  + LFL IGLDE+TA  T+ N KVTANLTA I+EA VTDGCDRT GNLLYTVATK  
Sbjct  5    ADESVKLFLSIGLDEKTATTTINNPKVTANLTAVIHEAGVTDGCDRTTGNLLYTVATKHH  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +N L+HRPTL  YIVSSKIKTPAQL+AA  F   +A+E  K++EFEEACGVGVEVS+E
Sbjct  65   SNLLLHRPTLFSYIVSSKIKTPAQLDAAVWFFDNHAAEDFKLDEFEEACGVGVEVSVE  122



>ref|XP_010695806.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Beta vulgaris 
subsp. vulgaris]
Length=792

 Score =   167 bits (424),  Expect = 9e-45, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 97/116 (84%), Gaps = 0/116 (0%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            N ++LFLKIGLDE+ A NT+ANNKVT NL A I+EA VT+GCDRT GNLLYTVATKFPAN
Sbjct  11   NAVELFLKIGLDEKVAHNTIANNKVTNNLLAVIHEAGVTNGCDRTTGNLLYTVATKFPAN  70

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ALVHR TL+ Y+VSSKIKTPAQLEAAF F ++   E L +++FE ACGVG+EVS E
Sbjct  71   ALVHRLTLVGYVVSSKIKTPAQLEAAFTFFASVGPEDLNLSDFELACGVGIEVSNE  126



>ref|XP_006415861.1| hypothetical protein EUTSA_v10006840mg [Eutrema salsugineum]
 gb|ESQ34214.1| hypothetical protein EUTSA_v10006840mg [Eutrema salsugineum]
Length=795

 Score =   167 bits (423),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 79/120 (66%), Positives = 92/120 (77%), Gaps = 0/120 (0%)
 Frame = +3

Query  177  DGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATK  356
            D  E  + LFL IGLDE+TA  TV N+K+T NLTA I+EA VT+GCDRT GNLLYTVA K
Sbjct  6    DNSEKSVKLFLSIGLDEKTASTTVNNDKLTTNLTAVIHEAGVTNGCDRTTGNLLYTVAAK  65

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +N  +HRPTL KYIVSSKIKTPAQL+AA  F +    E  K+NEFEEACGVG+EVS+E
Sbjct  66   HHSNVHLHRPTLFKYIVSSKIKTPAQLDAAIAFFNNTTPEDFKLNEFEEACGVGIEVSLE  125



>ref|XP_006844061.1| hypothetical protein AMTR_s00006p00246940 [Amborella trichopoda]
 gb|ERN05736.1| hypothetical protein AMTR_s00006p00246940 [Amborella trichopoda]
Length=791

 Score =   167 bits (422),  Expect = 1e-44, Method: Composition-based stats.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 0/120 (0%)
 Frame = +3

Query  177  DGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATK  356
            D G   L LF+KIGLDERTA+N + N+KVT+NLTA I+EA V DGC ++ GNLLY V TK
Sbjct  5    DEGNELLQLFVKIGLDERTARNALVNSKVTSNLTAVIHEAGVADGCSKSVGNLLYMVGTK  64

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            FPANALVHRP LL+YI SSKIKT AQL++A  FL+ +  E+  V EFEEACGVGV++S E
Sbjct  65   FPANALVHRPFLLEYIASSKIKTSAQLDSALSFLANSGPESFNVKEFEEACGVGVDISTE  124



>ref|XP_009404845.1| PREDICTED: glutamine--tRNA ligase-like [Musa acuminata subsp. 
malaccensis]
Length=790

 Score =   164 bits (415),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 78/120 (65%), Positives = 94/120 (78%), Gaps = 1/120 (1%)
 Frame = +3

Query  177  DGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATK  356
            DG   PLDLFL IGLD RTA+  + N +VT+NLTA I EA V DGC +T GNLLY VATK
Sbjct  5    DGDAKPLDLFLSIGLDRRTAEGALVNQRVTSNLTAVIKEAGV-DGCSKTIGNLLYMVATK  63

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            FPANAL+HRPTL++YIVSSKIK PAQL+ A  F+ A   E+  ++EFE+ACGVGV+VS+E
Sbjct  64   FPANALIHRPTLVQYIVSSKIKNPAQLDVALLFVGAFGPESFSLDEFEQACGVGVDVSVE  123



>gb|ABR17752.1| unknown [Picea sitchensis]
Length=832

 Score =   163 bits (413),  Expect = 3e-43, Method: Composition-based stats.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 3/142 (2%)
 Frame = +3

Query  108  LADPLGFVIFFWIGIMVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFI  287
            L  PL + +   I  MV     S+ GE  L LFLKIGLDERTA+N + N KV++NLT  I
Sbjct  24   LTQPLRYSLRTSISKMV--TSDSNSGE-ILQLFLKIGLDERTAQNAIVNGKVSSNLTDVI  80

Query  288  YEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSAN  467
            +EA V DGC ++ GNLLY VATK+PANAL HRP LL+YI+SSKIK P QLE A  FLS  
Sbjct  81   HEAGVEDGCIKSVGNLLYMVATKYPANALKHRPFLLQYIISSKIKNPNQLEKALSFLSNT  140

Query  468  ASETLKVNEFEEACGVGVEVSI  533
              E+L+V++FEE+CG+GVEVS+
Sbjct  141  GPESLEVDDFEESCGIGVEVSV  162



>ref|XP_010940139.1| PREDICTED: glutamine--tRNA ligase-like [Elaeis guineensis]
Length=795

 Score =   162 bits (409),  Expect = 9e-43, Method: Compositional matrix adjust.
 Identities = 81/121 (67%), Positives = 91/121 (75%), Gaps = 0/121 (0%)
 Frame = +3

Query  174  SDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVAT  353
             +G   PL LFL IGLD RTA+N + N KVTANLTA I EA V DGC +T GNLLYTVAT
Sbjct  6    EEGEVQPLGLFLSIGLDRRTAENALVNPKVTANLTAVIKEAKVVDGCSKTVGNLLYTVAT  65

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
            K+PANALVHRP LL+YI+S KIK PAQL+AA  FLS    E  +  +FEE CGVGVEVSI
Sbjct  66   KYPANALVHRPVLLEYIISLKIKNPAQLDAALTFLSNVGPEAFQSKDFEETCGVGVEVSI  125

Query  534  E  536
            E
Sbjct  126  E  126



>ref|XP_010915141.1| PREDICTED: glutamine--tRNA ligase-like [Elaeis guineensis]
Length=795

 Score =   161 bits (408),  Expect = 1e-42, Method: Composition-based stats.
 Identities = 80/129 (62%), Positives = 96/129 (74%), Gaps = 3/129 (2%)
 Frame = +3

Query  150  IMVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAG  329
            ++ E+KG   G    LD+FL IGLD RTA+N + N KVTANLTA I EA V DGC +T G
Sbjct  2    VVSEEKG---GEVQLLDMFLSIGLDRRTAENALVNPKVTANLTAVIKEAKVVDGCSKTVG  58

Query  330  NLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEAC  509
            NLLY VATK+PA+AL+HRP LL+YI+S KIK PAQL+AA  FLS    E  +  +FEE+C
Sbjct  59   NLLYMVATKYPAHALIHRPVLLEYIISLKIKNPAQLDAALTFLSNVGPEAFQSKDFEESC  118

Query  510  GVGVEVSIE  536
            GVGVEVSIE
Sbjct  119  GVGVEVSIE  127



>ref|XP_006655062.1| PREDICTED: glutamine--tRNA ligase-like [Oryza brachyantha]
Length=800

 Score =   154 bits (390),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 75/111 (68%), Positives = 89/111 (80%), Gaps = 0/111 (0%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHR  383
            FL IGLD+RTA+N +AN KVTANLTA I EA V  GCD++ GNLLYTVATK+PANALVHR
Sbjct  22   FLAIGLDQRTAENALANRKVTANLTAVITEAGVVSGCDKSVGNLLYTVATKYPANALVHR  81

Query  384  PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            P +++YIVSSKIK+PAQL+AA  FLS    ++L   +FEE CGVGV VS E
Sbjct  82   PVVIQYIVSSKIKSPAQLDAALSFLSTLGPDSLDTAKFEETCGVGVVVSTE  132



>ref|XP_008795989.1| PREDICTED: glutamine--tRNA ligase [Phoenix dactylifera]
Length=795

 Score =   154 bits (388),  Expect = 8e-40, Method: Composition-based stats.
 Identities = 75/119 (63%), Positives = 85/119 (71%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
            G   PLD+FL IGLD RTA+N + N KVTANLT  I EA V DGC +T GNLLY VATK+
Sbjct  8    GKVQPLDMFLSIGLDRRTAENALVNPKVTANLTTVIKEAKVVDGCSKTVGNLLYMVATKY  67

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            PANALVHRP LL+YI   KIK PAQL+AA  FL        ++ + EE CGVGVEVSIE
Sbjct  68   PANALVHRPVLLEYITLLKIKNPAQLDAALTFLLNVGPGAFQLKDLEETCGVGVEVSIE  126



>ref|NP_001054822.1| Os05g0182800 [Oryza sativa Japonica Group]
 gb|AAU44312.1| putative glutaminyl-tRNA synthetase [Oryza sativa Japonica Group]
 dbj|BAF16736.1| Os05g0182800 [Oryza sativa Japonica Group]
 gb|EAY96800.1| hypothetical protein OsI_18728 [Oryza sativa Indica Group]
 gb|EEE62566.1| hypothetical protein OsJ_17365 [Oryza sativa Japonica Group]
Length=796

 Score =   151 bits (382),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 76/111 (68%), Positives = 89/111 (80%), Gaps = 1/111 (1%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHR  383
            FL IGLD+RTA+N +AN KVTANLTA I EA V+ GCD++ GNLLYTVATK+PANALVHR
Sbjct  19   FLAIGLDQRTAENALANRKVTANLTAVIAEAGVS-GCDKSVGNLLYTVATKYPANALVHR  77

Query  384  PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            P +++YIVSSKIKTPAQL+AA  FLS    + L   +FEE CGVGV VS E
Sbjct  78   PVVIQYIVSSKIKTPAQLDAALSFLSTLGPDPLDTAKFEETCGVGVVVSTE  128



>ref|NP_001042238.1| Os01g0185200 [Oryza sativa Japonica Group]
 dbj|BAD67797.1| putative tRNA-glutamine synthetase [Oryza sativa Japonica Group]
 dbj|BAF04152.1| Os01g0185200 [Oryza sativa Japonica Group]
 dbj|BAG89372.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEE54010.1| hypothetical protein OsJ_00666 [Oryza sativa Japonica Group]
 gb|AGW30397.1| tRNA-glutamine synthetase [Oryza sativa]
Length=796

 Score =   150 bits (378),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 73/115 (63%), Positives = 90/115 (78%), Gaps = 1/115 (1%)
 Frame = +3

Query  192  PLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANA  371
            PL+  L +GLD+RTA+N + N+KVTANL A I EA ++ GCD+T GNLLYTVATK+P NA
Sbjct  15   PLEALLALGLDQRTAENALVNSKVTANLAAVIAEAGIS-GCDKTVGNLLYTVATKYPTNA  73

Query  372  LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            LVHRP L+ YIVS+KIK PAQL+AA  FL+    ++L   +FEEACGVGV VSIE
Sbjct  74   LVHRPVLIDYIVSTKIKNPAQLDAALSFLTNTGPDSLDTGKFEEACGVGVVVSIE  128



>ref|XP_004960871.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Setaria italica]
Length=820

 Score =   149 bits (377),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 9/130 (7%)
 Frame = +3

Query  171  SSDGGENP--------LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTA  326
            +SDGG+ P        L+ FL IGLD+RTA+N +AN KVTANLTA I EA VT+ C ++ 
Sbjct  4    ASDGGKGPGAAAVPPQLESFLAIGLDQRTAENALANRKVTANLTAVIAEAGVTE-CHKSV  62

Query  327  GNLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEA  506
            GNLLYTVATK+PANALVHRP L+KYI+S KIK  AQL+AA  FLS    ++L   +FEEA
Sbjct  63   GNLLYTVATKYPANALVHRPDLIKYILSEKIKNSAQLDAALSFLSTLGPDSLDPVKFEEA  122

Query  507  CGVGVEVSIE  536
            CGVGV VS E
Sbjct  123  CGVGVVVSFE  132



>ref|XP_004960872.1| PREDICTED: glutamine--tRNA ligase-like isoform X2 [Setaria italica]
Length=797

 Score =   149 bits (376),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 80/130 (62%), Positives = 96/130 (74%), Gaps = 9/130 (7%)
 Frame = +3

Query  171  SSDGGENP--------LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTA  326
            +SDGG+ P        L+ FL IGLD+RTA+N +AN KVTANLTA I EA VT+ C ++ 
Sbjct  4    ASDGGKGPGAAAVPPQLESFLAIGLDQRTAENALANRKVTANLTAVIAEAGVTE-CHKSV  62

Query  327  GNLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEA  506
            GNLLYTVATK+PANALVHRP L+KYI+S KIK  AQL+AA  FLS    ++L   +FEEA
Sbjct  63   GNLLYTVATKYPANALVHRPDLIKYILSEKIKNSAQLDAALSFLSTLGPDSLDPVKFEEA  122

Query  507  CGVGVEVSIE  536
            CGVGV VS E
Sbjct  123  CGVGVVVSFE  132



>gb|EMT18506.1| Glutaminyl-tRNA synthetase [Aegilops tauschii]
Length=761

 Score =   148 bits (374),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 94/124 (76%), Gaps = 5/124 (4%)
 Frame = +3

Query  177  DGGENP----LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            DG ++P    L+  L +GLD+RTA+N + N+KVTANL A + EA +T GCD++ GNLLY 
Sbjct  3    DGEKDPAPLRLETLLALGLDQRTAENALVNSKVTANLAAVLAEAGIT-GCDKSVGNLLYA  61

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK+P NALVHRP L+ YIVS+KIK PAQL+AA  FL+    E+L + +FEEACGVGV 
Sbjct  62   VATKYPNNALVHRPALISYIVSTKIKNPAQLDAALSFLTNTGPESLDIGKFEEACGVGVV  121

Query  525  VSIE  536
            VSIE
Sbjct  122  VSIE  125



>emb|CDM81662.1| unnamed protein product [Triticum aestivum]
Length=795

 Score =   143 bits (360),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 85/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  216  GLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLL  395
            GLD+RTA+N + N+KVTANL A + EA +T GCD++ GNLLY VATK+P NALVHRP L+
Sbjct  22   GLDQRTAENALVNSKVTANLAAVVAEAGIT-GCDKSVGNLLYAVATKYPNNALVHRPALI  80

Query  396  KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             YIVS+KIK PAQL+AA  FL+    E+L + +FEEACGVGV VSIE
Sbjct  81   NYIVSTKIKNPAQLDAALSFLTNTGPESLDIGKFEEACGVGVVVSIE  127



>ref|XP_010431359.1| PREDICTED: glutamine--tRNA ligase-like [Camelina sativa]
Length=800

 Score =   142 bits (357),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 72/117 (62%), Positives = 90/117 (77%), Gaps = 4/117 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANN-KVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
            +NPL+LF KI LDERT KNT+ N+ K+T++L A I++A V+ GCDRT G LL+TVAT + 
Sbjct  6    DNPLELFRKISLDERTVKNTIGNSSKITSDLIAVIHQAGVSGGCDRTIGYLLHTVATTYY  65

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
              ALVHRPTLL YI SSKIKT AQL+AA+ FL    ++   + EFEEACGVGVEVS+
Sbjct  66   GKALVHRPTLLNYIASSKIKTRAQLDAAYSFLD---NKDFNLTEFEEACGVGVEVSL  119



>ref|XP_002440725.1| hypothetical protein SORBIDRAFT_09g005690 [Sorghum bicolor]
 gb|EES19155.1| hypothetical protein SORBIDRAFT_09g005690 [Sorghum bicolor]
Length=799

 Score =   142 bits (357),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 74/114 (65%), Positives = 87/114 (76%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+ FL IGLD+RTA+N +AN KVTANLTA I EA VT  CD++ GNLLYTVATK+P NAL
Sbjct  21   LESFLSIGLDQRTAENALANRKVTANLTAVIAEAGVT-RCDKSVGNLLYTVATKYPTNAL  79

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            VHRP L+KYI+S KIK  AQL+AA  FLS    ++L   +FEEACGVGV V  E
Sbjct  80   VHRPDLIKYILSEKIKNSAQLDAALTFLSTLGPDSLDSVKFEEACGVGVVVLFE  133



>gb|EEC70073.1| hypothetical protein OsI_00686 [Oryza sativa Indica Group]
Length=796

 Score =   139 bits (351),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N+KVTANL A I EA ++ GCD+T GNLLYTVATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNSKVTANLAAVIAEAGIS-GCDKTVGNLLYTVATKYPTNALVHRPVLIDY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            IVS+KIK PAQL+AA  FL+    ++L   +FEEACGVGV VSIE
Sbjct  84   IVSTKIKNPAQLDAALSFLTNTGPDSLDTGKFEEACGVGVVVSIE  128



>ref|XP_008809726.1| PREDICTED: LOW QUALITY PROTEIN: uncharacterized protein LOC103721336 
[Phoenix dactylifera]
Length=1037

 Score =   139 bits (351),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 83/114 (73%), Gaps = 1/114 (1%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
            G   PL +FL IGLD RTA+N + N KVTANLTA I E  V DGC +T GNLL+ VATK+
Sbjct  8    GEVQPLGMFLSIGLDRRTAENAIVNPKVTANLTAVIKEVFV-DGCSKTVGNLLFMVATKY  66

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGV  521
            PA+AL+HRP LL+YI+S KIK PAQL+AA  FLS    E  ++  FEE CGVG+
Sbjct  67   PAHALIHRPVLLEYIISLKIKNPAQLDAALTFLSNVGPEAFQLKHFEETCGVGI  120



>ref|XP_001760606.1| predicted protein [Physcomitrella patens]
 gb|EDQ74681.1| predicted protein [Physcomitrella patens]
Length=798

 Score =   139 bits (349),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 71/127 (56%), Positives = 87/127 (69%), Gaps = 2/127 (2%)
 Frame = +3

Query  150  IMVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAG  329
            + VE KG  D     L LF  IGLD +TA N VAN KVTANLT  ++EA V +GCD++ G
Sbjct  3    VEVESKGVRDPA--ALALFKGIGLDAKTAANAVANPKVTANLTNVVHEAGVENGCDKSVG  60

Query  330  NLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEAC  509
            NLLYTVATKFPANAL HR  L +YI  ++IKT  Q+EAA GF +    ++    +FE+ C
Sbjct  61   NLLYTVATKFPANALSHRADLCRYISRNQIKTIPQVEAALGFFALVGPDSYDAADFEKKC  120

Query  510  GVGVEVS  530
            GVGVEVS
Sbjct  121  GVGVEVS  127



>ref|XP_004968490.1| PREDICTED: glutamine--tRNA ligase-like [Setaria italica]
Length=796

 Score =   138 bits (348),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 67/107 (63%), Positives = 84/107 (79%), Gaps = 1/107 (1%)
 Frame = +3

Query  216  GLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLL  395
            GLD+RTA+N + N+KVTANL A I EA + + CD++ GNLLY VATK+P NALVHRP L+
Sbjct  23   GLDQRTAENALVNSKVTANLAAVIAEAGIKE-CDKSVGNLLYAVATKYPTNALVHRPVLI  81

Query  396  KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            KY++S KIK PAQL+AA  FL+    ++L V +FEEACGVGV VSIE
Sbjct  82   KYVLSIKIKNPAQLDAALSFLTNTGPDSLDVEKFEEACGVGVVVSIE  128



>gb|EMT15092.1| Glutaminyl-tRNA synthetase [Aegilops tauschii]
Length=710

 Score =   137 bits (345),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 69/114 (61%), Positives = 85/114 (75%), Gaps = 1/114 (1%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+  L +GLD+RTA+N + N+KVTANL A I EA ++  CD++ GNLLY VATK+P NAL
Sbjct  15   LEKLLALGLDQRTAENALVNSKVTANLAAVIAEAGIS-WCDKSVGNLLYAVATKYPNNAL  73

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            VHRP L+ YIVS KIK PAQL+AA  FL+    + L   +FEEACGVGV VSIE
Sbjct  74   VHRPALIDYIVSMKIKNPAQLDAALSFLTNVGPDPLDTGKFEEACGVGVVVSIE  127



>gb|KDO76965.1| hypothetical protein CISIN_1g003751mg [Citrus sinensis]
Length=773

 Score =   134 bits (336),  Expect = 9e-33, Method: Compositional matrix adjust.
 Identities = 74/124 (60%), Positives = 85/124 (69%), Gaps = 25/124 (20%)
 Frame = +3

Query  168  GSSDGGENP-LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYT  344
            G S G ++  L+LFLKIGLD+RTAKNT+ANNKVTANLTA I+EAAVTDGC+R  GNLLYT
Sbjct  3    GVSKGDKSEILELFLKIGLDDRTAKNTIANNKVTANLTAVIHEAAVTDGCERRIGNLLYT  62

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
                                    IKTPAQLEAAF F ++  SE  +V+EFEEACGVGVE
Sbjct  63   ------------------------IKTPAQLEAAFSFFASTGSENFEVDEFEEACGVGVE  98

Query  525  VSIE  536
            VS E
Sbjct  99   VSSE  102



>ref|XP_006643850.1| PREDICTED: glutamine--tRNA ligase-like [Oryza brachyantha]
Length=796

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 65/105 (62%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N+KVTANL A I EA ++  CD++ GNLLYTVATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNSKVTANLAAVIAEAGIS-RCDKSVGNLLYTVATKYPTNALVHRPVLIDY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +VS KIK PAQL+AA  FL+    ++L   +FEEACGVGV VSIE
Sbjct  84   VVSMKIKNPAQLDAALSFLTNTGPDSLDTGKFEEACGVGVVVSIE  128



>ref|XP_008672779.1| PREDICTED: uncharacterized protein LOC100280365 isoform X2 [Zea 
mays]
Length=798

 Score =   134 bits (336),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 83/105 (79%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N KVTANL A I EA + + CD++ GNLLY VATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNAKVTANLAAVIAEAGIKE-CDKSIGNLLYAVATKYPTNALVHRPVLISY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ++S+KIK+PAQL+AA  FL+    ++L V++FEEACGVGV VSIE
Sbjct  84   VLSTKIKSPAQLDAALSFLTNTGPDSLDVDKFEEACGVGVVVSIE  128



>ref|XP_002455040.1| hypothetical protein SORBIDRAFT_03g003420 [Sorghum bicolor]
 gb|EES00160.1| hypothetical protein SORBIDRAFT_03g003420 [Sorghum bicolor]
Length=796

 Score =   133 bits (335),  Expect = 1e-32, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 82/105 (78%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N+KVTANL A I EA + + CD++ GNLLY VATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNSKVTANLAAVIAEAGIKE-CDKSVGNLLYAVATKYPTNALVHRPVLISY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ++S+KIK PAQL+AA  FL+    ++L V +FEEACGVGV VSIE
Sbjct  84   VLSTKIKNPAQLDAALSFLTNTGPDSLDVGKFEEACGVGVVVSIE  128



>ref|XP_010265099.1| PREDICTED: glutamine--tRNA ligase-like [Nelumbo nucifera]
Length=84

 Score =   122 bits (305),  Expect = 3e-32, Method: Compositional matrix adjust.
 Identities = 62/80 (78%), Positives = 67/80 (84%), Gaps = 3/80 (4%)
 Frame = +3

Query  153  MVEKKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGN  332
            MV K  SS   E  L+LFLKIGLDERTA+NT+ANNKVTANLTA I+EA VT+GC R  GN
Sbjct  1    MVAKDESS---EKSLELFLKIGLDERTARNTIANNKVTANLTAVIHEAGVTNGCSRAIGN  57

Query  333  LLYTVATKFPANALVHRPTL  392
            LLYTVATKFPANALVHRPTL
Sbjct  58   LLYTVATKFPANALVHRPTL  77



>ref|NP_001152305.1| glutaminyl-tRNA synthetase [Zea mays]
 gb|ACG46917.1| glutaminyl-tRNA synthetase [Zea mays]
 gb|AFW80308.1| glutaminyl-tRNA synthetase [Zea mays]
Length=796

 Score =   130 bits (328),  Expect = 2e-31, Method: Compositional matrix adjust.
 Identities = 63/105 (60%), Positives = 81/105 (77%), Gaps = 1/105 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N KVTANL + I EA + + CD++ GNLLY VATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNAKVTANLASVIAEAGIKE-CDKSVGNLLYAVATKYPTNALVHRPVLISY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ++S+KIK PAQL+AA  FL+    ++L V +FEEACGVGV VSIE
Sbjct  84   VLSTKIKNPAQLDAALSFLTNTGPDSLDVVKFEEACGVGVVVSIE  128



>ref|XP_002888654.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH64913.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=721

 Score =   128 bits (322),  Expect = 8e-31, Method: Composition-based stats.
 Identities = 62/114 (54%), Positives = 83/114 (73%), Gaps = 2/114 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            ++LFLKIGLD +TA+ T+ +N++T++LTA IYEA V DGCD+T GNLLY+VAT+ P +A 
Sbjct  1    MELFLKIGLDNKTARKTIDDNELTSDLTAIIYEAGVCDGCDKTTGNLLYSVATRLPISAR  60

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +H   L+K I+S K+  PAQ  AA  +     S+   +NEFEEACGVGVEV  E
Sbjct  61   MHHSKLIKCIMSFKL--PAQRNAAIKYFEDIESKDFNMNEFEEACGVGVEVLAE  112



>ref|XP_006301816.1| hypothetical protein CARUB_v10022284mg [Capsella rubella]
 gb|EOA34714.1| hypothetical protein CARUB_v10022284mg [Capsella rubella]
Length=762

 Score =   125 bits (314),  Expect = 9e-30, Method: Composition-based stats.
 Identities = 63/116 (54%), Positives = 79/116 (68%), Gaps = 6/116 (5%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            N  +LFLKIGLDE+TA + +      ++LT  IYEA V+DGC++T G+LLY+VA  FP +
Sbjct  10   NSKELFLKIGLDEKTATDIIRFKDKASDLTDIIYEAGVSDGCEKTTGDLLYSVANGFPKD  69

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            ALVHR  L+KYI+SSKI      EAAF +     S    VNEFEE CGVGV+VS E
Sbjct  70   ALVHRSELIKYIMSSKI------EAAFKYFKNLESNDFNVNEFEEVCGVGVDVSAE  119



>ref|XP_002871902.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|EFH48161.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=785

 Score =   124 bits (312),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 62/98 (63%), Positives = 76/98 (78%), Gaps = 1/98 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNK-VTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
            E  L+LFL IGLDERTA++ V NN+ +T++LTA I++A VTDGCDRT G LLY V TK+ 
Sbjct  6    EKSLELFLCIGLDERTARDIVKNNRNLTSDLTALIHQARVTDGCDRTTGILLYWVVTKYG  65

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASE  476
              ALVHRPTLL+YIVSSKIKT +QL+AA+ F    A E
Sbjct  66   GKALVHRPTLLEYIVSSKIKTSSQLDAAYSFFGNTAVE  103



>tpg|DAA53110.1| TPA: hypothetical protein ZEAMMB73_029969 [Zea mays]
Length=764

 Score =   124 bits (311),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 58/98 (59%), Positives = 77/98 (79%), Gaps = 1/98 (1%)
 Frame = +3

Query  222  DERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKY  401
            D+RTA+N + N KVTANL A I EA + + CD++ GNLLY VATK+P NALVHRP L+ Y
Sbjct  25   DQRTAENALVNAKVTANLAAVIAEAGIKE-CDKSIGNLLYAVATKYPTNALVHRPVLISY  83

Query  402  IVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGV  515
            ++S+KIK+PAQL+AA  FL+    ++L V++FEEACGV
Sbjct  84   VLSTKIKSPAQLDAALSFLTNTGPDSLDVDKFEEACGV  121



>ref|XP_003564537.1| PREDICTED: glutamine--tRNA ligase [Brachypodium distachyon]
Length=795

 Score =   124 bits (310),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 74/123 (60%), Positives = 93/123 (76%), Gaps = 4/123 (3%)
 Frame = +3

Query  177  DGGENP---LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTV  347
            DG + P   L+  L +GLD+RTA+N + N+KVTANL A I EA ++ GCD++ GNLLY V
Sbjct  6    DGEKAPALQLETLLALGLDQRTAENALVNSKVTANLAAVIAEAGIS-GCDKSVGNLLYAV  64

Query  348  ATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
            ATK+P NALVHRP L+ YIVS+KIK PAQL+AA  FL+   S++L V +FEE CGVGV V
Sbjct  65   ATKYPTNALVHRPALINYIVSTKIKNPAQLDAALLFLNNIGSDSLDVGKFEEVCGVGVVV  124

Query  528  SIE  536
            SIE
Sbjct  125  SIE  127



>gb|EMS52881.1| Glutaminyl-tRNA synthetase [Triticum urartu]
Length=789

 Score =   117 bits (294),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 54/83 (65%), Positives = 66/83 (80%), Gaps = 1/83 (1%)
 Frame = +3

Query  288  YEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSAN  467
            +EA +T GCD++ GNLLY VATK+P NALVHRP L+ YIVS+KIK PAQL+AA  FL+  
Sbjct  40   FEAGIT-GCDKSVGNLLYAVATKYPNNALVHRPALINYIVSTKIKNPAQLDAALSFLTNT  98

Query  468  ASETLKVNEFEEACGVGVEVSIE  536
              E+L + +FEEACGVGV VSIE
Sbjct  99   GPESLDIGKFEEACGVGVVVSIE  121



>ref|XP_002966775.1| hypothetical protein SELMODRAFT_168502 [Selaginella moellendorffii]
 gb|EFJ32802.1| hypothetical protein SELMODRAFT_168502 [Selaginella moellendorffii]
Length=767

 Score =   114 bits (285),  Expect = 8e-26, Method: Compositional matrix adjust.
 Identities = 61/120 (51%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP-  362
            E  ++LF +IG++E TA+N + N KV +++ A I EA V +GC+++ GN+LYTVATK+P 
Sbjct  2    EASVELFCRIGIEETTAQNIMVNPKVRSSVLAVIKEAGVQNGCNKSVGNVLYTVATKYPA  61

Query  363  --ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              ANAL HRP  L Y+ S KIK+  QL+AAF + S++  E L V +FE  CGVGV VS E
Sbjct  62   NRANALRHRPKFLSYVTSGKIKS-HQLDAAFRYFSSDPEEFL-VEDFERVCGVGVVVSPE  119



>ref|XP_002977973.1| hypothetical protein SELMODRAFT_108529 [Selaginella moellendorffii]
 gb|EFJ20630.1| hypothetical protein SELMODRAFT_108529 [Selaginella moellendorffii]
Length=766

 Score =   114 bits (284),  Expect = 1e-25, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 84/120 (70%), Gaps = 5/120 (4%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP-  362
            E  ++LF +IG++E TA+N + N KV +++ A I EA V +GC+++ GN+LYT+ATK+P 
Sbjct  2    EASVELFCRIGIEETTAQNIMVNPKVRSSVLAVIKEAGVQNGCNKSVGNVLYTIATKYPA  61

Query  363  --ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              ANAL HRP  L Y+ S KIK+  QL+AAF + S++  E L V +FE  CGVGV VS E
Sbjct  62   NRANALRHRPKFLSYVTSGKIKS-HQLDAAFRYFSSDPEEFL-VEDFERVCGVGVVVSPE  119



>gb|EPS67602.1| hypothetical protein M569_07173, partial [Genlisea aurea]
Length=425

 Score =   109 bits (272),  Expect = 7e-25, Method: Compositional matrix adjust.
 Identities = 57/81 (70%), Positives = 70/81 (86%), Gaps = 0/81 (0%)
 Frame = +3

Query  291  EAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANA  470
            +A V DGC+RT GNLLYTVATK+P+NALVHRPT +KYIVS KIK+ AQLEAAF FL+A A
Sbjct  1    QAGVADGCERTVGNLLYTVATKYPSNALVHRPTFVKYIVSLKIKSSAQLEAAFLFLAAVA  60

Query  471  SETLKVNEFEEACGVGVEVSI  533
            S+ L +++FE ACGVG+EVS+
Sbjct  61   SDKLDIDDFEAACGVGIEVSV  81



>ref|XP_003290976.1| glutamine-tRNA ligase [Dictyostelium purpureum]
 gb|EGC32483.1| glutamine-tRNA ligase [Dictyostelium purpureum]
Length=767

 Score =   110 bits (275),  Expect = 2e-24, Method: Compositional matrix adjust.
 Identities = 60/117 (51%), Positives = 74/117 (63%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  + LF +IGLD   AK T  NN ++ NL   I EA V  GC+++ G LLYT+ATK+PA
Sbjct  5    EELIKLFSEIGLDNSKAKETTNNNTLSKNLKDIIVEAGVEKGCEKSIGLLLYTLATKYPA  64

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NAL HRPTL KYIV+  + T   L A   FL   A+E L V EFE  CGVGV ++ E
Sbjct  65   NALKHRPTLCKYIVNKTV-TAINLTACLEFLRRTANEELDVAEFESQCGVGVVITRE  120



>ref|XP_002945662.1| hypothetical protein VOLCADRAFT_78635 [Volvox carteri f. nagariensis]
 gb|EFJ52657.1| hypothetical protein VOLCADRAFT_78635 [Volvox carteri f. nagariensis]
Length=779

 Score =   108 bits (270),  Expect = 8e-24, Method: Compositional matrix adjust.
 Identities = 55/114 (48%), Positives = 70/114 (61%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LF+ IGL+E  AKN   N K +  L   I+EA    GC +  GNLLYTVA+KFPANAL
Sbjct  1    MSLFMGIGLEETVAKNATRNAKFSKTLEEVIHEAGAASGCPKAKGNLLYTVASKFPANAL  60

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             HRP LL YI+   +K+ AQL+ AF +L    +  +     EEA GVGV V+ E
Sbjct  61   CHRPMLLGYIMCEHMKSNAQLDGAFEYLRKVGTTEVDKKALEEASGVGVVVTPE  114



>emb|CAA33446.1| unnamed protein product, partial [Dictyostelium discoideum AX3]
Length=287

 Score =   105 bits (261),  Expect = 9e-24, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF +IGLD   AK T  N  +++NL   I EA    GC+++ G LLYT+ATK+PANA+ H
Sbjct  15   LFSQIGLDSSKAKETTNNATLSSNLQEIIKEAGAESGCEKSVGLLLYTLATKYPANAMKH  74

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            R TL+ YI + K      L+A   +L   A+E L V EFE++CGVGV ++ E
Sbjct  75   RATLVDYIANKKSVNSINLQACLDYLRRTANEELNVAEFEQSCGVGVVITRE  126



>gb|KIY99203.1| glutaminyl-tRNA synthetase [Monoraphidium neglectum]
Length=455

 Score =   105 bits (262),  Expect = 2e-23, Method: Compositional matrix adjust.
 Identities = 55/112 (49%), Positives = 70/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            +FL IGLDE+  + ++ N K T  L     EA V +GC +  GNL+YTVA+K PANAL H
Sbjct  21   VFLAIGLDEKVVEQSLRNPKFTQALLDTAKEAGVVEGCAKAKGNLIYTVASKHPANALAH  80

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            RP LL Y+VS +IK+ AQL+ AF +L       +   E EEA GVGV V  E
Sbjct  81   RPLLLTYVVSEQIKSNAQLDGAFEYLKRVGPGEVSSAELEEAAGVGVVVGPE  132



>emb|CDY47088.1| BnaC03g64100D [Brassica napus]
Length=145

 Score =   100 bits (249),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 58/117 (50%), Positives = 68/117 (58%), Gaps = 25/117 (21%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            +  + LFL IGLDE+TA  T+ N KVTANLTA I+E  VTDGCDRT GNLLYTV      
Sbjct  6    DESVKLFLSIGLDEKTATTTINNPKVTANLTAIIHETGVTDGCDRTTGNLLYTV------  59

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 R  L+  ++S              F   +A E  K+NEFEEAC VGVEVS E
Sbjct  60   -----RFVLISVLIS--------------FFDNHAPENFKLNEFEEACSVGVEVSAE  97



>ref|XP_005850046.1| hypothetical protein CHLNCDRAFT_30027 [Chlorella variabilis]
 gb|EFN57944.1| hypothetical protein CHLNCDRAFT_30027 [Chlorella variabilis]
Length=814

 Score =   106 bits (265),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 55/111 (50%), Positives = 68/111 (61%), Gaps = 0/111 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L LF  IGL E+TA+  +   K    L   I EA   DGC +  G LLYT A+K+PANAL
Sbjct  12   LRLFAGIGLAEQTAQQAIVKPKFRQALVDLIKEAGAADGCPKPQGALLYTTASKYPANAL  71

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
            VHR  LL YI   +I++ AQL+ A  +L    SE + V +FEEA GVGVEV
Sbjct  72   VHRGELLAYINDERIRSNAQLDGALEYLGKVGSEPIDVAKFEEAAGVGVEV  122



>ref|XP_636180.1| glutamine-tRNA ligase [Dictyostelium discoideum AX4]
 sp|P14325.2|SYQ_DICDI RecName: Full=Probable glutamine--tRNA ligase; AltName: Full=Glutaminyl-tRNA 
synthetase; Short=GlnRS; AltName: Full=Vegetative-specific 
protein H4 [Dictyostelium discoideum]
 gb|EAL62672.1| glutamine-tRNA ligase [Dictyostelium discoideum AX4]
Length=779

 Score =   105 bits (261),  Expect = 1e-22, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 71/112 (63%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF +IGLD   AK T  N  +++NL   I EA    GC+++ G LLYT+ATK+PANA+ H
Sbjct  15   LFSQIGLDSSKAKETTNNATLSSNLQEIIKEAGAESGCEKSVGLLLYTLATKYPANAMKH  74

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            R TL+ YI + K      L+A   +L   A+E L V EFE++CGVGV ++ E
Sbjct  75   RATLVDYIANKKSVNSINLQACLDYLRRTANEELNVAEFEQSCGVGVVITRE  126



>ref|XP_005649888.1| glutaminyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
 gb|EIE25344.1| glutaminyl-tRNA synthetase [Coccomyxa subellipsoidea C-169]
Length=805

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 53/113 (47%), Positives = 70/113 (62%), Gaps = 1/113 (1%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            +FL IGL E+TA+  V+  K    L   I EA + +GCD+T G LLY+ A+ +P NA  H
Sbjct  14   IFLGIGLAEKTAETAVSKKKFRGILLEIIKEAGLENGCDKTRGTLLYSSASTYPDNARAH  73

Query  381  RPTLLK-YIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            R   L+ YI S K+K+  QLEAAF  LS+  SE +   + EEA GVGV V+ E
Sbjct  74   RSHFLREYISSGKLKSSEQLEAAFKVLSSYGSEPVDWQKLEEAAGVGVVVTPE  126



>ref|XP_001699050.1| hypothetical protein CHLREDRAFT_193475 [Chlamydomonas reinhardtii]
 gb|EDO99104.1| predicted protein [Chlamydomonas reinhardtii]
Length=369

 Score = 95.5 bits (236),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 45/88 (51%), Positives = 57/88 (65%), Gaps = 0/88 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LFL IGL+E  AKN   N K    L   ++EA    GC +  GNLLYTVA+K+PANAL
Sbjct  12   ISLFLGIGLEETVAKNATKNPKFMKTLEEVVHEAGAASGCPKAKGNLLYTVASKYPANAL  71

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFL  458
             HRP LL YI+   +K+ AQL+ AF +L
Sbjct  72   CHRPMLLGYIMCEHMKSNAQLDGAFEYL  99



>gb|KDP29433.1| hypothetical protein JCGZ_18354 [Jatropha curcas]
Length=317

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 44/53 (83%), Positives = 48/53 (91%), Gaps = 0/53 (0%)
 Frame = +3

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGV  515
            +PANALVHRPTLL +IVSSKIKTPAQLEAAF FLS  ASE+ K+NEFEEACGV
Sbjct  2    YPANALVHRPTLLGHIVSSKIKTPAQLEAAFSFLSRTASESFKLNEFEEACGV  54



>gb|ELU08311.1| hypothetical protein CAPTEDRAFT_221989 [Capitella teleta]
Length=663

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 51/128 (40%), Positives = 72/128 (56%), Gaps = 3/128 (2%)
 Frame = +3

Query  162  KKGSSDGGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG---CDRTAGN  332
            +K + +   + + LF  IGL ++ AK T+ N+ V+ NL   I EA   +      RT GN
Sbjct  13   RKLAGNMATDKMKLFTSIGLSDQKAKETLKNDAVSQNLADVIVEAQKGNQDAVFSRTTGN  72

Query  333  LLYTVATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACG  512
            LLY V T+  A  L HRPTL++YI  +KI +  QL AA  +L  N    + + +FE +CG
Sbjct  73   LLYHVGTRMKAQILAHRPTLIQYITEAKIASETQLNAAMDYLLHNPKPPIAIKDFETSCG  132

Query  513  VGVEVSIE  536
            VG  VS E
Sbjct  133  VGAVVSPE  140



>ref|XP_011402329.1| Glutamine-tRNA ligase [Auxenochlorella protothecoides]
 gb|KFM29276.1| Glutamine-tRNA ligase [Auxenochlorella protothecoides]
Length=756

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 53/115 (46%), Positives = 65/115 (57%), Gaps = 5/115 (4%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF  I L   T    + N K    L   + EA V  GC +  G LLYTVA+K+P NALVH
Sbjct  16   LFEAIQLAPGTLAGAIKNVKFRQALVQTVREAGVESGCTKQQGALLYTVASKYPGNALVH  75

Query  381  RPTLLKYIVSSKIK-----TPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            R TLL+YI S K+K     + AQL+AA  FL+   SE L     +EA GVGV V+
Sbjct  76   RKTLLEYITSDKLKARRAWSNAQLDAALEFLAQTGSEPLDAGALDEAAGVGVVVT  130



>emb|CDX77723.1| BnaC07g19770D [Brassica napus]
Length=104

 Score = 86.3 bits (212),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 53/117 (45%), Positives = 59/117 (50%), Gaps = 44/117 (38%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            + P+ LFL IGLDE+TA  T+ N KVTANLTA I EA VT+GCDRT GNLLYT       
Sbjct  6    DEPVKLFLSIGLDEKTATTTINNPKVTANLTAVINEAGVTNGCDRTTGNLLYT-------  58

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                                                   K+NEFEEACGVGVEVS E
Sbjct  59   -------------------------------------DFKLNEFEEACGVGVEVSTE  78



>dbj|GAM21997.1| hypothetical protein SAMD00019534_051720 [Acytostelium subglobosum 
LB1]
Length=784

 Score = 92.0 bits (227),  Expect = 5e-18, Method: Compositional matrix adjust.
 Identities = 49/115 (43%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAV-TDGCDRTAGNLLYTVATKFPANA  371
            ++ F KIGLD   AK   +NN +++ L   I EA V  DGC++  G LLY ++TK+PANA
Sbjct  14   VERFTKIGLDATKAKEAASNNTMSSTLLDIITEAGVPVDGCEKPVGQLLYLISTKYPANA  73

Query  372  LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            L HR  L +  V+ K  T   ++A+F +L    S+ L V +FE+ CGVGV ++ E
Sbjct  74   LKHRAVLAQ-CVAKKTVTAINIQASFDYLHRVGSQDLDVADFEKQCGVGVVITKE  127



>emb|CDY23862.1| BnaC04g01750D [Brassica napus]
Length=104

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 52/112 (46%), Positives = 57/112 (51%), Gaps = 44/112 (39%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LFL IGLDE+TA  T+ N KVTANLTA I+EA VT+GCDRT GNLLYT            
Sbjct  11   LFLSIGLDEKTATTTINNPKVTANLTAVIHEAGVTNGCDRTTGNLLYT------------  58

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                                              K+NEFEEACGVGVEVS E
Sbjct  59   --------------------------------DFKLNEFEEACGVGVEVSAE  78



>emb|CDY23000.1| BnaC03g40690D [Brassica napus]
Length=93

 Score = 82.0 bits (201),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = +3

Query  345  VATKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVE  524
            VATK  +N L+HRPTL KYIVSSKIKT AQL+AA  F   +A E  K+NEFEEACGVG  
Sbjct  20   VATKHHSNLLLHRPTLFKYIVSSKIKTLAQLDAAVLFFENHAPEDFKLNEFEEACGVGKS  79

Query  525  VSI  533
            V +
Sbjct  80   VWV  82



>ref|XP_002962789.1| hypothetical protein SELMODRAFT_404079 [Selaginella moellendorffii]
 gb|EFJ36252.1| hypothetical protein SELMODRAFT_404079 [Selaginella moellendorffii]
Length=760

 Score = 87.4 bits (215),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 47/111 (42%), Positives = 71/111 (64%), Gaps = 8/111 (7%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L L   IGL+E TA++ + N K+ ++L A I EA V +GCD+  G LLYTVA ++     
Sbjct  4    LKLLTCIGLEETTARSALENPKLLSDLIAIIQEAGVDNGCDKHIGKLLYTVAARYMNG--  61

Query  375  VHRP----TLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGV  515
             HRP    T+L+YI S K+++  QLEAA  +++A   E++ + +FE ACG+
Sbjct  62   -HRPQHLSTVLRYIASGKMRS-HQLEAALEYITAARRESVDLAKFERACGI  110



>gb|KDD76352.1| class I (E and Q) tRNA synthetase [Helicosporidium sp. ATCC 50920]
Length=844

 Score = 87.0 bits (214),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 53/112 (47%), Positives = 64/112 (57%), Gaps = 0/112 (0%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF ++ L   T +  V N K+   L   I EA V  GC +  G LLYTVA K+P NAL H
Sbjct  66   LFERLQLAPGTLQGAVKNVKLRDGLVEIIKEAGVEAGCAKHQGALLYTVAGKYPTNALTH  125

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            R   L YI S KIK+ AQL+AAF FL+   +E L     E A GVGV V+ E
Sbjct  126  RKAFLSYITSDKIKSNAQLDAAFEFLTQTGAEALDAAALEAASGVGVVVTPE  177



>ref|XP_643772.1| asparagine-tRNA ligase [Dictyostelium discoideum AX4]
 sp|Q554D9.1|SYNC_DICDI RecName: Full=Asparagine--tRNA ligase, cytoplasmic; AltName: 
Full=Asparaginyl-tRNA synthetase; Short=AsnRS [Dictyostelium 
discoideum]
 gb|EAL69912.1| asparagine-tRNA ligase [Dictyostelium discoideum AX4]
Length=653

 Score = 86.7 bits (213),  Expect = 3e-16, Method: Composition-based stats.
 Identities = 50/117 (43%), Positives = 70/117 (60%), Gaps = 3/117 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E    LFL IGLDE+ AK+T+ N  +TA L   I EA+V+ GCD++ GNLLY++AT    
Sbjct  4    EEDQKLFLSIGLDEKRAKDTLKNKDLTALLKTIIEEASVSKGCDKSIGNLLYSLATCQQV  63

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N+ + R  + K I   KIKT  Q +AA  +L  N  +    + F + CGVGV ++ E
Sbjct  64   NSPI-RSNVSKAIGEEKIKTTIQFQAATQYLKDN--KEFNQDTFNDFCGVGVVITPE  117



>emb|CDS13604.1| hypothetical protein LRAMOSA05780 [Absidia idahoensis var. thermophila]
Length=800

 Score = 85.9 bits (211),  Expect = 6e-16, Method: Composition-based stats.
 Identities = 49/113 (43%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFPANALV  377
            +F+KIGL E+ AK+TV N K+   L A I EA V D GCD+  GNLLY +A+    +AL 
Sbjct  4    VFVKIGLSEQKAKDTVKNKKLAPLLEAVIDEANVRDSGCDKDQGNLLYQLASTITKDALP  63

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            HR  ++  I++  +KT  Q+ AA  +L  +  E +   EF  A GVGV V+ E
Sbjct  64   HRAYIVNSIMAGDLKTADQVSAAIKYLE-DVQEPINKEEFNAAAGVGVVVTPE  115



>gb|EFA83742.1| glutamine-tRNA ligase [Polysphondylium pallidum PN500]
Length=797

 Score = 85.5 bits (210),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 68/117 (58%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  ++ F KIGLD   AK   +N  ++ +L   + EA   DGCD+  G LLY ++ K+PA
Sbjct  25   EELVEKFKKIGLDATKAKEAASNANLSTSLQEVMKEAETVDGCDKDVGQLLYLISIKYPA  84

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            NAL HR TL K+I ++K  T   +  +  +L   A + L + +F  +CGVGV ++ E
Sbjct  85   NALKHRATLAKFI-AAKTVTSINVTQSMDYLRKVAGQELDLADFTASCGVGVVITRE  140



>ref|XP_004363149.1| glutamine-tRNA ligase [Dictyostelium fasciculatum]
 gb|EGG25298.1| glutamine-tRNA ligase [Dictyostelium fasciculatum]
Length=776

 Score = 85.1 bits (209),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 42/109 (39%), Positives = 64/109 (59%), Gaps = 1/109 (1%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHR  383
            F  +GLD+  AK    N  + + L+  I E+ +   CD++ G +LYT+ATK+PANAL HR
Sbjct  14   FSALGLDQTKAKEAAGNANIASTLSEIIKESGLEGTCDKSVGVILYTLATKYPANALRHR  73

Query  384  PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            P L   +V+ ++ T   L+    +L   A+E L   E+ E CGVG+ +S
Sbjct  74   PQLCSDVVAKRV-TNINLQVCLEYLRMAANEPLNKEEYVEKCGVGIVIS  121



>ref|XP_002962496.1| hypothetical protein SELMODRAFT_78641 [Selaginella moellendorffii]
 gb|EFJ35959.1| hypothetical protein SELMODRAFT_78641 [Selaginella moellendorffii]
Length=763

 Score = 84.3 bits (207),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 45/115 (39%), Positives = 71/115 (62%), Gaps = 2/115 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF-PANA  371
            L L   IGL+E TA++ + N  + + L A I EA V  GCD+  G LLYTVA ++   + 
Sbjct  4    LKLLTGIGLEETTARSALENPTLLSALIAIIQEAGVDSGCDKHIGKLLYTVAARYINGDR  63

Query  372  LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              H  T+L YI S K+++  QLEAA  +++A   +++ + +FE+ACG+G  + +E
Sbjct  64   PQHLSTVLSYIASGKMRS-HQLEAALEYITAARRKSINLTKFEKACGIGKSMPVE  117



>ref|XP_009057926.1| hypothetical protein LOTGIDRAFT_228742 [Lottia gigantea]
 gb|ESO91225.1| hypothetical protein LOTGIDRAFT_228742 [Lottia gigantea]
Length=778

 Score = 84.0 bits (206),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/116 (41%), Positives = 70/116 (60%), Gaps = 2/116 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATKFPAN  368
            +DLF+ IGL E+ AK T+ N++V+ NL + I  A     +G    +G LLY +ATK  + 
Sbjct  6    VDLFVSIGLTEQKAKETIKNDQVSKNLKSAIDSARNVSGEGDLNDSGKLLYHIATKLKSQ  65

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +P L++Y+V  KI +  QL A   +L ++  E L V EFE+A GVG++VS E
Sbjct  66   IKNRQPLLVEYVVKKKITSENQLNAGMEYLLSHPVEKLNVEEFEKASGVGIKVSPE  121



>ref|XP_009009763.1| hypothetical protein HELRODRAFT_63797 [Helobdella robusta]
 gb|ESO13043.1| hypothetical protein HELRODRAFT_63797 [Helobdella robusta]
Length=779

 Score = 83.6 bits (205),  Expect = 4e-15, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 68/117 (58%), Gaps = 3/117 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG-C--DRTAGNLLYTVATKFPA  365
            + LF KIGL E  +K+T+ N  ++ NL   I+EA   D  C  ++T GNLLY + TK  +
Sbjct  8    IQLFGKIGLTENKSKDTIKNTSLSENLKTVIHEAEKVDKECLNNKTVGNLLYVLVTKLKS  67

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                HR  L+KYI S KI +  QL A+  +L  + +  + V +FE+  GVG+ V+ E
Sbjct  68   QIAHHRSFLVKYIASKKINSEIQLNASLDYLLHHPNANVDVKKFEDISGVGIVVTSE  124



>ref|XP_004350432.1| asparagine-tRNA ligase [Dictyostelium fasciculatum]
 gb|EGG13728.1| asparagine-tRNA ligase [Dictyostelium fasciculatum]
Length=648

 Score = 82.0 bits (201),  Expect = 8e-15, Method: Composition-based stats.
 Identities = 46/117 (39%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  + LF  IGLDE+ +K+TV N ++TA L A I EA V+ GCD+  GN +Y +AT   A
Sbjct  3    EADVTLFRSIGLDEKKSKDTVKNPELTATLKAVINEAGVSGGCDKAIGNYVYQLATSAVA  62

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +   R  + KYI     K   Q +AA  +L  +   T   + F+  CG+G EV++E
Sbjct  63   QS-PSRAHVAKYIGQGAFKVTQQFQAALKYLKDHP--TFDDSTFKTECGIGAEVTVE  116



>emb|CDH50331.1| probable glutamine-trna ligase [Lichtheimia corymbifera JMRC:FSU:9682]
Length=799

 Score = 82.4 bits (202),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 48/113 (42%), Positives = 68/113 (60%), Gaps = 2/113 (2%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFPANALV  377
            +F+KIGL E+ AK+TV N K+   L A I EA V D GCD+  GNLLY +A+    +AL 
Sbjct  4    VFVKIGLSEQKAKDTVKNKKLAPLLEAVIDEANVRDSGCDKDRGNLLYQLASTITKDALP  63

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            HR  ++  I++  +KT  Q+ AA  ++  +  E +   EF  A GVGV V+ E
Sbjct  64   HRAYIVNSIMAGDLKTADQVSAAIKYVE-DVQEPINKEEFNTAAGVGVVVTPE  115



>gb|ESA08892.1| hypothetical protein GLOINDRAFT_31189 [Rhizophagus irregularis 
DAOM 181602]
Length=296

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFPANA  371
            + LF  IGL E+ AK T  N K+   L A I EA +++ GCD+  G LLYT+A+    NA
Sbjct  7    VSLFQSIGLTEQRAKETAKNKKLAPTLQATIAEAGISETGCDKAVGALLYTLASTITKNA  66

Query  372  LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              H   + + I+  K+KT  Q+ AA  + + NA + +   +F+ ACGVGV V+ E
Sbjct  67   NKHLGYITRAIIDKKLKTADQVAAAIKY-TENAGDEIIDTDFDNACGVGVVVTHE  120



>gb|EXX50887.1| glutamine--tRNA ligase [Rhizophagus irregularis DAOM 197198w]
Length=795

 Score = 82.0 bits (201),  Expect = 1e-14, Method: Composition-based stats.
 Identities = 46/115 (40%), Positives = 67/115 (58%), Gaps = 2/115 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFPANA  371
            + LF  IGL E+ AK T  N K+   L A I EA +++ GCD+  G LLYT+A+    NA
Sbjct  7    VSLFQSIGLTEQRAKETAKNKKLAPTLQATIAEAGISETGCDKAVGALLYTLASTITKNA  66

Query  372  LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              H   + + I+  K+KT  Q+ AA  + + NA + +   +F+ ACGVGV V+ E
Sbjct  67   NKHLGYITRAIIDKKLKTADQVAAAIKY-TENAGDEIIDTDFDNACGVGVVVTHE  120



>ref|XP_006822206.1| PREDICTED: glutamine--tRNA ligase [Saccoglossus kowalevskii]
Length=773

 Score = 80.9 bits (198),  Expect = 3e-14, Method: Composition-based stats.
 Identities = 45/121 (37%), Positives = 69/121 (57%), Gaps = 6/121 (5%)
 Frame = +3

Query  183  GENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATK  356
             +N + LF  IGL E+ AK T+ N  +  +L   + EA   +    ++T G LLY +AT+
Sbjct  2    ADNLVQLFTGIGLSEQKAKETIKNEGLAEDLRKIVIEAQNKIGSSVEKTVGTLLYNIATR  61

Query  357  FPANALVHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSI  533
                +   R +LL +YI + KI + AQL AAF +  +N  + + ++ FE ACGVGV V+ 
Sbjct  62   LKQKS---RSSLLVEYIATKKISSEAQLTAAFDYFKSNPLDPIDISAFEAACGVGVVVTP  118

Query  534  E  536
            E
Sbjct  119  E  119



>ref|XP_005101664.1| PREDICTED: probable glutamine--tRNA ligase-like [Aplysia californica]
Length=761

 Score = 80.5 bits (197),  Expect = 4e-14, Method: Composition-based stats.
 Identities = 48/117 (41%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG---CDRTAGNLLYTVATKFPA  365
            +DLF+ IGL E+ AK T+ N ++T +L   I  A    G    ++  G LLY + TK  A
Sbjct  57   VDLFVSIGLTEQKAKETLKNEQLTESLKQAIKTADEYGGEGVRNKDVGKLLYNLVTKLKA  116

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                H+  L+KYI + KI + AQL AA  +   N    +    FEEACGVGV VS E
Sbjct  117  QVKGHQNMLVKYIATRKIASEAQLTAALDYCLHNPGLDVDTKSFEEACGVGVVVSPE  173



>gb|EFA81274.1| asparagine-tRNA ligase [Polysphondylium pallidum PN500]
Length=663

 Score = 79.3 bits (194),  Expect = 8e-14, Method: Composition-based stats.
 Identities = 45/115 (39%), Positives = 65/115 (57%), Gaps = 3/115 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E+ + LF  IG DE+ AK+TV N ++T N+   I  A V  GCD++ GNLLY++AT   A
Sbjct  18   ESDISLFQSIGFDEKRAKDTVKNKELTDNIKFLIGAAKVEAGCDKSVGNLLYSLATSPQA  77

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
             + + R     YI   +IK+  Q +A   +L  N+       +FE  CGVGV V+
Sbjct  78   QSPL-RGQAAAYIGDGRIKSQQQYQALVAYLKDNSE--FVAAKFESDCGVGVTVT  129



>dbj|GAN03587.1| cytoplasmic glutaminyl-tRNA ligase Qrs1 [Mucor ambiguus]
Length=797

 Score = 79.3 bits (194),  Expect = 1e-13, Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LF+KIGL E+ AK+T  N K+   L   I EA V DGCD+  G LLYT+AT      +
Sbjct  5    IPLFVKIGLSEQKAKDTAKNKKLAPTLETVINEANVRDGCDKDVGILLYTLATAAAKAPV  64

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             H   + K I++  +KT  Q+ AA  F    +    K  +F+ A GVGV V+ E
Sbjct  65   EHLSFITKKIMNGDLKTTDQITAAIKF----SESGFKEEDFDAATGVGVVVTPE  114



>ref|XP_008558062.1| PREDICTED: probable glutamine--tRNA ligase [Microplitis demolitor]
Length=782

 Score = 79.0 bits (193),  Expect = 1e-13, Method: Compositional matrix adjust.
 Identities = 44/108 (41%), Positives = 64/108 (59%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  IGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTL  392
            IGL E+ AK T+ N +VT NL   I EA      D+ +G LLY +A+K  A  +     +
Sbjct  11   IGLSEQKAKETLKNVQVTKNLMTCIAEAEKHGKIDKDSGILLYHLASKIKAQIIDKLAFV  70

Query  393  LKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +YIV  K+ T  +++AA  +L +N  + + V EFE+ACGVGV V+ E
Sbjct  71   SEYIVKKKLDTTQRVDAALSYLMSNIRDNVDVKEFEDACGVGVVVTPE  118



>gb|EIE86796.1| hypothetical protein RO3G_11507 [Rhizopus delemar RA 99-880]
Length=800

 Score = 78.2 bits (191),  Expect = 2e-13, Method: Composition-based stats.
 Identities = 47/118 (40%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFP  362
            E+ + +F KIGL E+ AK+T  N K+   L   I EA V + GC++  G LLY +A+   
Sbjct  2    EDLIPIFTKIGLSEQKAKDTAKNKKLAPTLETVINEAQVRETGCEKEKGILLYNLASTVT  61

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +AL H   ++K I+   +KT  Q++AA  F    + E  K  EF+ A GVGV VS E
Sbjct  62   KDALTHLGFIVKKIMVGDLKTTDQVQAAIKF----SEEGFKEEEFDAATGVGVVVSPE  115



>gb|EFX87065.1| hypothetical protein DAPPUDRAFT_307141 [Daphnia pulex]
Length=770

 Score = 78.2 bits (191),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 0/118 (0%)
 Frame = +3

Query  183  GENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
            G + + LF+ IGL E  AK T  N+ V+ NL   I  A+      ++ G LLY +ATK  
Sbjct  3    GPDLVKLFVGIGLSEIKAKETAKNSNVSTNLKTCIDAASSAGEISKSHGVLLYNIATKVK  62

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                   P L +Y+V  KI +  +L AA  +L +N    + +  FEE+CGVG+ V+ E
Sbjct  63   PQISAQLPLLSRYVVEGKIDSELRLNAAMDYLLSNPLGDVDIKAFEESCGVGIMVTPE  120



>ref|XP_003087425.1| hypothetical protein CRE_26035 [Caenorhabditis remanei]
 gb|EFP00561.1| hypothetical protein CRE_26035 [Caenorhabditis remanei]
Length=209

 Score = 74.7 bits (182),  Expect = 3e-13, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            DL L +GL E  A  T+ N K+T  + + I  A  +   ++  GNLLY +ATK       
Sbjct  6    DLLL-LGLSEAKAAETLKNVKLTETIGSIIASAKESGELNKQKGNLLYQLATKLKPQVAP  64

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              P ++KYI++  IKT  QL AA  +L ++  + ++V  FE++CGVGV V+I+
Sbjct  65   SAPLVVKYIMNDGIKTEPQLSAAIEYLLSHTVKGIEVPAFEKSCGVGVVVTID  117



>ref|XP_002430078.1| glutaminyl-tRNA synthetase, putative [Pediculus humanus corporis]
 gb|EEB17340.1| glutaminyl-tRNA synthetase, putative [Pediculus humanus corporis]
Length=776

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/108 (42%), Positives = 57/108 (53%), Gaps = 0/108 (0%)
 Frame = +3

Query  213  IGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTL  392
            IGL E  AK T+ NN +T NL   I EA      D   G L+Y +A+K  +      P L
Sbjct  15   IGLSESKAKETLKNNGLTQNLLQAITEANKYGPVDSQTGILVYHLASKIKSQIKEQVPLL  74

Query  393  LKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            + YI+S KI +  +LEAA  +L +N         FEE CGVGV VS E
Sbjct  75   VSYIMSQKIDSTVKLEAALDYLLSNIKSDFNKENFEEYCGVGVVVSPE  122



>gb|EPB93125.1| hypothetical protein HMPREF1544_00199 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=797

 Score = 77.8 bits (190),  Expect = 3e-13, Method: Composition-based stats.
 Identities = 45/114 (39%), Positives = 63/114 (55%), Gaps = 4/114 (4%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LF+KIGL E+ AK+T  N K+   L   I EA V +GCD+  G LLYT+AT      +
Sbjct  5    IPLFVKIGLSEQKAKDTAKNKKLAPTLETVINEANVREGCDKDVGILLYTLATAAAKAPV  64

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             H   + K I++  +KT  Q+ AA  F    +    K  +F+ A GVGV V+ E
Sbjct  65   EHLSFITKKIMNGDLKTTDQISAAIKF----SESGFKEEDFDAATGVGVVVTPE  114



>ref|XP_003706095.1| PREDICTED: probable glutamine--tRNA ligase-like [Megachile rotundata]
Length=777

 Score = 77.4 bits (189),  Expect = 4e-13, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 65/117 (56%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E+ + LF  IGL E+ AK T+ N +V++NL   + EA +        G LLY +A+K   
Sbjct  4    EDDVKLFESIGLSEQKAKETLKNKQVSSNLKLAVTEAKIHGTISPEVGILLYHLASKIKN  63

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                  P L KYIV  K+ T  +++A   +L ++  E + ++ FE+ CG+G+ VS E
Sbjct  64   QISDKLPFLTKYIVEKKLDTIQRVDAGLNYLLSHIKENVDISNFEKQCGIGITVSPE  120



>ref|XP_011149130.1| PREDICTED: probable glutamine--tRNA ligase [Harpegnathos saltator]
 gb|EFN78066.1| Probable glutaminyl-tRNA synthetase [Harpegnathos saltator]
Length=781

 Score = 77.0 bits (188),  Expect = 6e-13, Method: Composition-based stats.
 Identities = 46/114 (40%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            EN + LF  IGL E+ AK T+ N  VT NL   I EAA      +  G LLY +A+K   
Sbjct  6    ENDVRLFQTIGLSEQKAKETLKNVNVTKNLKLAINEAAKHGPIIQDVGILLYHLASKIKN  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEV  527
              +   P +  YI+  K+ T  +++AA  +L AN +  + V +FEE CGVGV V
Sbjct  66   QIVDKIPFVTNYIIEKKLDTVQRIDAALTYLLANINNDINVADFEEFCGVGVIV  119



>emb|CEG63087.1| Putative Glutaminyl-tRNA synthetase [Rhizopus microsporus]
Length=796

 Score = 76.6 bits (187),  Expect = 8e-13, Method: Composition-based stats.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFP  362
            E  + +F+KIGL E+ AK+T  N K+   L A I EA V + GC++  G LLY +A+   
Sbjct  2    EELIPIFVKIGLSEQKAKDTAKNKKLAPTLEAVINEAGVRESGCNKDTGILLYNLASTVT  61

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +AL H   ++  +++  +KT  Q++AA  F      E  K  EF+ A GVGV V+ E
Sbjct  62   KDALPHLAFIVGKVMNGDLKTTDQIQAAIKF----CEEGFKEEEFDAATGVGVVVTPE  115



>ref|XP_002632525.1| C. briggsae CBR-ERS-1 protein [Caenorhabditis briggsae]
 emb|CAP32512.1| Protein CBR-QARS-1 [Caenorhabditis briggsae]
Length=782

 Score = 76.3 bits (186),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 39/111 (35%), Positives = 66/111 (59%), Gaps = 0/111 (0%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHR  383
             L++GL E  A  T+ N K++A ++  + EA       +  G LLY ++TK       + 
Sbjct  7    LLQLGLSESKAAETLKNAKLSATISGILKEAKPLGQISKQKGTLLYQLSTKLKPQVAPNA  66

Query  384  PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            P ++KYI++  IKT  QL AAF +L +++ + +++  FE +CGVGV V+I+
Sbjct  67   PLVVKYIMNDGIKTEPQLSAAFEYLLSHSVKGIEIPAFESSCGVGVVVTID  117



>ref|XP_011267539.1| PREDICTED: probable glutamine--tRNA ligase [Camponotus floridanus]
 gb|EFN60585.1| Probable glutaminyl-tRNA synthetase [Camponotus floridanus]
Length=781

 Score = 75.9 bits (185),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 49/119 (41%), Positives = 65/119 (55%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
            G EN + LF  IGL E+ AK T+ N  VT NL   I EA       +  G LLY +A+K 
Sbjct  4    GNENDVKLFQTIGLSEQKAKETLKNGNVTKNLKLAIDEAVKHGPVPQDIGVLLYHLASKI  63

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +   P ++ YI   K+ T  +++AA  +L AN +  L V EFEE CG+GV VS E
Sbjct  64   KNQVVDKIPFIINYINEKKLDTVQRIDAALSYLLANLNNPLNVAEFEEFCGIGVVVSPE  122



>ref|XP_011173631.1| PREDICTED: probable glutamine--tRNA ligase [Solenopsis invicta]
Length=782

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
            G E  + LF  IGL E+ AK T+ N  VT NL   I EA   +   +  G LLY +A+K 
Sbjct  4    GNEEDVKLFQTIGLSEQKAKETLKNVNVTKNLKLAISEAVKHESITQETGVLLYHLASKI  63

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                    P +   IV  K+ +  +++AA  +L AN + T  + +FEE CGVG+ VS E
Sbjct  64   KNQIADKIPFITNCIVEKKLNSVQRVDAALTYLLANVNNTPDIAKFEEFCGVGIVVSPE  122



>gb|EFZ09255.1| hypothetical protein SINV_09433 [Solenopsis invicta]
Length=814

 Score = 75.5 bits (184),  Expect = 2e-12, Method: Composition-based stats.
 Identities = 45/119 (38%), Positives = 63/119 (53%), Gaps = 0/119 (0%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
            G E  + LF  IGL E+ AK T+ N  VT NL   I EA   +   +  G LLY +A+K 
Sbjct  36   GNEEDVKLFQTIGLSEQKAKETLKNVNVTKNLKLAISEAVKHESITQETGVLLYHLASKI  95

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                    P +   IV  K+ +  +++AA  +L AN + T  + +FEE CGVG+ VS E
Sbjct  96   KNQIADKIPFITNCIVEKKLNSVQRVDAALTYLLANVNNTPDIAKFEEFCGVGIVVSPE  154



>gb|EGT58460.1| CBN-QARS-1 protein [Caenorhabditis brenneri]
Length=791

 Score = 75.1 bits (183),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/113 (39%), Positives = 65/113 (58%), Gaps = 1/113 (1%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            DL L +GL E  A  T+ N K+T  +   I  A      ++  GNLLY +ATK       
Sbjct  6    DLIL-LGLSESKAAETLKNAKLTETIGTIIASAKQAGEINKPRGNLLYQLATKLKPQVAP  64

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              P ++KYI++  IKT  QL AA  +L +N  + ++V+ FE++CGVGV V+I+
Sbjct  65   SAPLVVKYIMNDGIKTEPQLSAAIEYLLSNTVKGIEVSAFEKSCGVGVVVTID  117



>dbj|GAM17593.1| hypothetical protein SAMD00019534_007680 [Acytostelium subglobosum 
LB1]
Length=650

 Score = 74.7 bits (182),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 64/117 (55%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  + LF  IGLD++ +K+T+ N ++T  L + I  A V  G D+T GNLLY +AT   A
Sbjct  3    EADIKLFQSIGLDDKRSKDTIKNKELTDLLKSLITAAGVQGGADKTVGNLLYNLATSAQA  62

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             + +    + +YI   +IK+  Q +A    L    +     ++ E  CGVGV V+I+
Sbjct  63   QSPLC-ADVARYIGDGRIKSQPQFQAMIAHLKEAGATPFNASKLEVDCGVGVTVTID  118



>ref|XP_004351610.1| glutamine-tRNA ligase [Acanthamoeba castellanii str. Neff]
 gb|ELR22833.1| glutamine-tRNA ligase [Acanthamoeba castellanii str. Neff]
Length=772

 Score = 75.1 bits (183),  Expect = 3e-12, Method: Composition-based stats.
 Identities = 40/98 (41%), Positives = 53/98 (54%), Gaps = 1/98 (1%)
 Frame = +3

Query  237  KNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHRPTLLKYIVSSK  416
            K T+ N ++T  L A   EA V DGCD+  GNLLY  A KFPA AL HR  L   I + +
Sbjct  22   KETLKNPELTLKLLALAREAGVEDGCDKAVGNLLYETAGKFPAGALEHRAKLCAVIGNGE  81

Query  417  IKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            +K   QL  AF +   N       + F+   G+G+EV+
Sbjct  82   LKKKEQLIEAFNYFK-NLKGDFNEDAFKATAGIGLEVT  118



>ref|XP_009857693.1| PREDICTED: glutamine--tRNA ligase-like isoform X2 [Ciona intestinalis]
Length=767

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            +LF+ +GL E+ AK TV N  V+A     I  A  +   D++ G LLY ++T+       
Sbjct  6    NLFVSVGLTEQKAKETVKNKNVSATFVEAIDLAKKSCEVDKSIGGLLYQISTRLKHKE--  63

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            H P ++K++   KIKT  QL  A  +L  N S  +   +F +A GVGVE+S
Sbjct  64   HLPVIVKFVAGKKIKTEIQLSCALDYLKNNPSIPVDEQKFSDASGVGVEIS  114



>ref|XP_002131102.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Ciona intestinalis]
Length=770

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 41/111 (37%), Positives = 61/111 (55%), Gaps = 2/111 (2%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            +LF+ +GL E+ AK TV N  V+A     I  A  +   D++ G LLY ++T+       
Sbjct  6    NLFVSVGLTEQKAKETVKNKNVSATFVEAIDLAKKSCEVDKSIGGLLYQISTRLKHKE--  63

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            H P ++K++   KIKT  QL  A  +L  N S  +   +F +A GVGVE+S
Sbjct  64   HLPVIVKFVAGKKIKTEIQLSCALDYLKNNPSIPVDEQKFSDASGVGVEIS  114



>ref|NP_001255843.1| Protein QARS-1, isoform a [Caenorhabditis elegans]
 sp|O62431.1|SYQ_CAEEL RecName: Full=Probable glutamine--tRNA ligase; AltName: Full=Glutaminyl-tRNA 
synthetase; Short=GlnRS [Caenorhabditis elegans]
 emb|CAB08998.1| QARS-1, isoform a [Caenorhabditis elegans]
Length=786

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 64/111 (58%), Gaps = 0/111 (0%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVHR  383
             L +GL +     T+ N K+T  + + +  A+ +    +  G LLY +ATK       H 
Sbjct  7    LLSLGLSDSKVAETLKNVKLTETIGSIVKLASESGEISKQKGTLLYQLATKLKPQVAAHT  66

Query  384  PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            P ++KYI++  IKT  QL AA  +L ++  + ++V +FE++CGVGV V+I+
Sbjct  67   PLVVKYIMNDGIKTEPQLSAAIEYLLSHTVKGIQVPDFEKSCGVGVVVTID  117



>ref|XP_006677573.1| hypothetical protein BATDEDRAFT_86970 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF81916.1| hypothetical protein BATDEDRAFT_86970 [Batrachochytrium dendrobatidis 
JAM81]
Length=798

 Score = 73.9 bits (180),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 46/114 (40%), Positives = 64/114 (56%), Gaps = 4/114 (4%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAA---VTDGCDRTAGNLLYTVATKFPAN  368
            DLF +IGL +  AK T AN K+   LT  I EA+     DG +++ G LLYT+A+    +
Sbjct  8    DLFTRIGLSDVKAKETAANKKLAPTLTQVITEASAGVTADGVEKSLGALLYTLASTITKD  67

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            A VH P L K + +  + +  Q+ AA  F S  A+  +    F EACGVGV V+
Sbjct  68   ATVHLPYLAKAVFNGNLTSSDQVSAAIKF-SEKATGPIDDIAFNEACGVGVVVT  120



>ref|XP_002601720.1| hypothetical protein BRAFLDRAFT_121196 [Branchiostoma floridae]
 gb|EEN57732.1| hypothetical protein BRAFLDRAFT_121196 [Branchiostoma floridae]
Length=698

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 43/117 (37%), Positives = 66/117 (56%), Gaps = 3/117 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAV-TDGCDRTAGNLLYTVATKFPA  365
            + LDLF+ +GL E+ AK T+ N  +T  L   I EA       D++ G LLY +AT+  +
Sbjct  3    DTLDLFVSVGLSEQKAKETIKNEVLTGELKNIINEARKHCSTIDKSMGVLLYGMATRLKS  62

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +   L +YI + KI T  QL++A  ++ ++  + +    FEEACGVGV V+ E
Sbjct  63   KGRAN--FLTEYIATKKITTELQLQSALDYVKSHPVDPVDAAGFEEACGVGVVVTPE  117



>ref|XP_001607476.1| PREDICTED: probable glutamine--tRNA ligase [Nasonia vitripennis]
Length=772

 Score = 73.9 bits (180),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 65/117 (56%), Gaps = 2/117 (2%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPAN  368
            + ++LF  IGL ++ A  T+ N +VT NL + I E           G LLY +A+   A 
Sbjct  3    DDIELFTSIGLTKQKAAETLKNAQVTQNLKSVINEVQKHKEISAVNGVLLYHLASNLKAQ  62

Query  369  ALVHR-PTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             + HR P L++Y+V  K+ T  +L+ A  +L  +  E + V EFEE CG+GV +S E
Sbjct  63   -IAHRIPFLVRYVVDEKLNTVQRLDCALDYLLNHLKEDVDVKEFEEFCGIGVVISPE  118



>ref|XP_003092429.1| hypothetical protein CRE_03478 [Caenorhabditis remanei]
 gb|EFO97175.1| hypothetical protein CRE_03478 [Caenorhabditis remanei]
Length=790

 Score = 73.6 bits (179),  Expect = 9e-12, Method: Compositional matrix adjust.
 Identities = 43/113 (38%), Positives = 66/113 (58%), Gaps = 1/113 (1%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            DL L +GL E  A  T+ N K+T  + + I  A  +   ++  GNLLY +ATK       
Sbjct  6    DLLL-LGLSEAKAAETLKNVKLTETIGSIIASAKESGELNKQKGNLLYQLATKLKPQVAP  64

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              P ++KYI++  IKT  QL AA  +L ++  + ++V  FE++CGVGV V+I+
Sbjct  65   SGPLVVKYIMNDGIKTEPQLSAAIEYLLSHTVKGIEVPAFEKSCGVGVVVTID  117



>emb|CEI94809.1| Putative Glutamine--tRNA ligase [Rhizopus microsporus]
Length=522

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 45/118 (38%), Positives = 67/118 (57%), Gaps = 5/118 (4%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKFP  362
            E  + +F+KIGL E+ AK+T  N K+   L A I EA V + GC++  G LLY +A+   
Sbjct  2    EELIPIFVKIGLSEQKAKDTAKNKKLAPTLEAVINEAGVRESGCNKDTGILLYNLASTVT  61

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +AL H   ++  +++  +KT  Q++AA  F      E  K  EF+ A GVGV V+ E
Sbjct  62   KDALPHLAFIVGKVMNGDLKTTDQIQAAIKF----CEEGFKEEEFDAATGVGVVVTPE  115



>ref|XP_003383035.1| PREDICTED: glutamine--tRNA ligase-like [Amphimedon queenslandica]
Length=761

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 44/116 (38%), Positives = 68/116 (59%), Gaps = 6/116 (5%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFI---YEAAVTDGCDRTAGNLLYTVATKFPA  365
            ++LF+KIGL E  AK T+AN  V+  L   I    E+   +  D++ GNLLY +A+++  
Sbjct  3    VELFVKIGLSEAKAKETLANPAVSKQLETAINKCLESLKEEELDKSVGNLLYGIASRYKG  62

Query  366  NALVHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
            ++   R  LL  Y+ + KI +  QL AAF +L ++  + +   EFE  CGVGV V+
Sbjct  63   SS--ERLGLLVDYVSTRKIHSDPQLTAAFDYLKSHPVDPINRFEFEAMCGVGVVVT  116



>ref|XP_011330844.1| PREDICTED: probable glutamine--tRNA ligase [Cerapachys biroi]
 gb|EZA62905.1| putative glutaminyl-tRNA synthetase [Cerapachys biroi]
Length=783

 Score = 72.8 bits (177),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 62/117 (53%), Gaps = 1/117 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E+ + LF  IGL E  AK T  N  VT NL   I EA         +G LLY +A+K   
Sbjct  6    EDDVKLFQTIGLSEEKAKQTFKNTNVTKNLKLAINEAVKHGFVSPDSGILLYHLASKIKQ  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +   P + +YIV  K+    +++AA  +L AN + T  V  FEE+CGVGV VS E
Sbjct  66   QIVDKIPLVSRYIVEKKLSNVERVDAALTYLLANVN-TFNVTNFEESCGVGVVVSPE  121



>gb|EGT41976.1| hypothetical protein CAEBREN_05000 [Caenorhabditis brenneri]
Length=271

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 39/113 (35%), Positives = 61/113 (54%), Gaps = 0/113 (0%)
 Frame = +3

Query  198  DLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALV  377
            D  + +GL E  A   + N K+T  +   I  A      ++  GNLLY +ATK       
Sbjct  5    DNLILLGLSESKAAKVLKNAKLTETIGTIIASAKQAGEINKPRGNLLYQLATKLKPQVAP  64

Query  378  HRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              P ++KYI++  IKT  QL AA  ++  N  + ++ + FE++CGVGV V+I+
Sbjct  65   SAPLVVKYIMNDGIKTKPQLSAAIKYIRRNIGKGIEESAFEKSCGVGVVVTID  117



>gb|KFM68600.1| putative glutamine--tRNA ligase, partial [Stegodyphus mimosarum]
Length=690

 Score = 72.4 bits (176),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/116 (36%), Positives = 63/116 (54%), Gaps = 2/116 (2%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATKFPAN  368
            L+  + IGL E+ AK T  N K+   L   I  A  +  +G  +  GNLLY +A+K    
Sbjct  8    LNNLMSIGLSEQKAKETAKNEKLCKELIHVIELANKSSANGIAKATGNLLYHIASKVKPQ  67

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                   L++Y+V +K+ +  +L AA  +L  +A E + + EFE+ CGVGV VS E
Sbjct  68   IQSKVELLVQYVVENKVDSEIKLNAAITYLMNHADENVNIKEFEKNCGVGVTVSPE  123



>gb|KDR12338.1| putative glutaminyl-tRNA synthetase [Zootermopsis nevadensis]
Length=782

 Score = 71.2 bits (173),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 40/114 (35%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LF+ IGL E+ A  T+ N+ +T +L   I EA    G  +  G LLY +A K      
Sbjct  8    IKLFITIGLSEQKALETLKNDVLTKHLKYAIEEAVGNGGTLQQIGMLLYHLAAKIKVQIN  67

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               P +++YI ++KI +  +++AA  +L ++      V +FE ACGVG+ VS E
Sbjct  68   HFIPVIVEYIAANKIDSQQRIDAALDYLLSHLKGDFNVKDFETACGVGITVSPE  121



>ref|NP_957507.1| glutamine--tRNA ligase [Danio rerio]
 gb|AAH49420.1| Glutaminyl-tRNA synthetase [Danio rerio]
Length=437

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKFPANAL  374
            F+ IGL E+ AK T+ N  +++ L   I  A V  G    D+  G LLY++ T+      
Sbjct  8    FMSIGLSEQKAKETLKNETLSSTLKKAIDLAQVQLGSSAIDKITGTLLYSMVTRLKD---  64

Query  375  VHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +RP  L KYI+S KI T  QL AA  F+ ++    +  ++FE ACGVG+ V+ E
Sbjct  65   TNRPQFLTKYIISRKITTELQLSAALDFVKSHPQGDVDQHKFEVACGVGMVVTPE  119



>gb|ETN81795.1| glutamine--tRNA ligase family protein [Necator americanus]
Length=645

 Score = 70.5 bits (171),  Expect = 6e-11, Method: Compositional matrix adjust.
 Identities = 43/117 (37%), Positives = 61/117 (52%), Gaps = 8/117 (7%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT--------DGCDRTAGNLLYTVATKF  359
             L +GL E+ AK T  N  +   L++ I EA           D   +  G LLY + TK 
Sbjct  4    LLWLGLSEQKAKETEKNATLLKQLSSIIAEAEEVLRKAGKGKDELTKQQGTLLYQLGTKI  63

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
                  + P ++ YI+S +IKT AQ+ AA  +L AN    ++V  FE+ACGVGV V+
Sbjct  64   KQQCAGNIPLVISYIISGEIKTEAQVSAALDYLLANVVHDVEVPAFEKACGVGVVVT  120



>ref|XP_011055429.1| PREDICTED: probable glutamine--tRNA ligase [Acromyrmex echinatior]
 gb|EGI64834.1| Putative glutaminyl-tRNA synthetase [Acromyrmex echinatior]
Length=780

 Score = 70.5 bits (171),  Expect = 7e-11, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 58/112 (52%), Gaps = 0/112 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  + LF  IGL E+ AK ++ N  +T NL   I EA       +  G LLY +A+K   
Sbjct  6    EEDVKLFQTIGLSEQKAKESLKNANITKNLKLAINEATKYGAITQDTGILLYHLASKTKN  65

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGV  521
              +   P +  YIV  K+ +  +++ A   L AN    + + +FEE+CG+GV
Sbjct  66   QIIDKIPFITNYIVEKKLDSVQRIDTALAHLLANVGNAIDIAKFEESCGIGV  117



>ref|XP_004546152.1| PREDICTED: glutamine--tRNA ligase-like [Maylandia zebra]
Length=222

 Score = 67.8 bits (164),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N+ ++++L   I +A    G    D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNDSLSSSLKEAITQAQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L + I   KI T  QL AA  F+  +  + +   EF+EACGVGV ++ E
Sbjct  63   KDTKRL--AFLSESIAQRKICTELQLAAALDFVKGHPQDPINQKEFDEACGVGVVITPE  119



>ref|XP_003283472.1| hypothetical protein DICPUDRAFT_44848 [Dictyostelium purpureum]
 gb|EGC39969.1| hypothetical protein DICPUDRAFT_44848 [Dictyostelium purpureum]
Length=649

 Score = 70.1 bits (170),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 44/112 (39%), Positives = 65/112 (58%), Gaps = 5/112 (4%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LFL IGLD++ AK+T+ N  +T  L + I EA VT  CD++ GN LY++A     + +  
Sbjct  8    LFLSIGLDQKRAKDTLKNEALTQTLKSIITEAGVT-TCDKSIGNNLYSLAVGNINSPI--  64

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            R  + K I   KIK+  QL++A  FL  N S      +F + CGVG+ ++ E
Sbjct  65   RANVSKAIAEEKIKSDLQLKSAIQFLKDNTS--FDEAKFNKDCGVGIVITEE  114



>ref|XP_004184350.1| glutaminyl-tRNA synthetase, putative [Entamoeba invadens IP1]
 gb|ELP85004.1| glutaminyl-tRNA synthetase, putative [Entamoeba invadens IP1]
Length=759

 Score = 70.1 bits (170),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 41/117 (35%), Positives = 61/117 (52%), Gaps = 3/117 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  +  F+KIG+ E  AK TV N +VT  L   I EA    GCD++ G L Y +ATK   
Sbjct  2    EGAVAQFVKIGIAEAKAKETVKNTQVTTTLLEIIKEAKCEGGCDKSIGMLFYQLATKLLK  61

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            + +  RP ++++I+  K+ T   ++A   ++  N    L        CGVGV V+ E
Sbjct  62   DKVSFRPQIIQWILEKKV-TNNNIDALITYV--NKHTDLTTETIISECGVGVVVTKE  115



>ref|NP_001012800.1| glutaminyl-tRNA synthetase [Gallus gallus]
 emb|CAH65364.1| hypothetical protein RCJMB04_22h1 [Gallus gallus]
Length=780

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 45/120 (38%), Positives = 64/120 (53%), Gaps = 12/120 (10%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATKFPAN  368
            LDLF  IGL E  A+ T+ N  ++A L   + +A  A+  G D+  G LLY  A +    
Sbjct  13   LDLFTGIGLTEAKARETLRNAALSAQLRQAVLQARAALGSGLDKATGALLYNAAAR----  68

Query  369  ALVHRPTLLKYIVS----SKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +  P  L ++V      +I+T  QL AA  +L ++  E L+  +FE ACGVGV VS E
Sbjct  69   --LRDPDRLAFVVGYIGRREIRTDQQLGAALQYLRSHPLEPLEPADFERACGVGVRVSPE  126



>gb|AAT68085.1| glutaminyl-tRNA synthetase [Danio rerio]
Length=774

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 44/115 (38%), Positives = 64/115 (56%), Gaps = 7/115 (6%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKFPANAL  374
            F+ IGL E+ AK T+ N  +++ L   I  A V  G    D+  G LLY++ T+      
Sbjct  8    FMSIGLSEQKAKETLKNETLSSTLKKAIDLAQVQLGSSAIDKITGTLLYSMVTRLKD---  64

Query  375  VHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +RP  L KYI+S KI T  QL AA  F+ ++    +  ++FE ACGVG+ V+ E
Sbjct  65   TNRPQFLTKYIISRKITTELQLSAALDFVKSHPQGDVDQHKFEVACGVGMVVTPE  119



>ref|XP_007431438.1| PREDICTED: glutamine--tRNA ligase [Python bivittatus]
Length=784

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 43/120 (36%), Positives = 65/120 (54%), Gaps = 4/120 (3%)
 Frame = +3

Query  183  GENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG--CDRTAGNLLYTVATK  356
            G +PL LF+ IGL E  A+ T+ N  +TA L   + +A    G   D+T G LLY VA++
Sbjct  12   GSDPLQLFVSIGLSESKARETLRNEALTALLREAVVQAQGILGPVIDKTVGTLLYNVASR  71

Query  357  FPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               +  +    L+ YI + KI T  QL AA  +L  +  + +   +F+  CG+GV V+ E
Sbjct  72   LKDSKRLG--DLVDYIATKKIVTDLQLNAALEYLKNHPVDPINTADFDRECGIGVVVTPE  129



>ref|XP_008186909.1| PREDICTED: probable glutamine--tRNA ligase isoform X2 [Acyrthosiphon 
pisum]
Length=760

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LF+ IGL E  AK T+ N  +T+NL   I E   TD      G LLY +A+K  +   
Sbjct  4    LELFVSIGLSEAKAKETLKNKNLTSNLKKVIDEFPKTDQPLTNYGTLLYHLASKLKSQDF  63

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +   +  YI   K+ T  +++ +  +L +  SE + + E ++ACGVG+ ++++
Sbjct  64   KYVSLIDSYIFEHKLDTTQRIDCSLEYLRSLISENIDLLELDKACGVGIVITLD  117



>ref|XP_008186908.1| PREDICTED: probable glutamine--tRNA ligase isoform X1 [Acyrthosiphon 
pisum]
Length=843

 Score = 69.7 bits (169),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 37/114 (32%), Positives = 63/114 (55%), Gaps = 0/114 (0%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L+LF+ IGL E  AK T+ N  +T+NL   I E   TD      G LLY +A+K  +   
Sbjct  87   LELFVSIGLSEAKAKETLKNKNLTSNLKKVIDEFPKTDQPLTNYGTLLYHLASKLKSQDF  146

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +   +  YI   K+ T  +++ +  +L +  SE + + E ++ACGVG+ ++++
Sbjct  147  KYVSLIDSYIFEHKLDTTQRIDCSLEYLRSLISENIDLLELDKACGVGIVITLD  200



>emb|CDJ85156.1| Glutaminyl-tRNA synthetase and Glutamyl glutaminyl-tRNA synthetase 
domain containing protein [Haemonchus contortus]
Length=585

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 43/114 (38%), Positives = 59/114 (52%), Gaps = 9/114 (8%)
 Frame = +3

Query  213  IGLDERTAKNTVANNKVTANLTAFIYEAA--------VTDGCDRTAGNLLYTVATKFPAN  368
            +GL E+    T  N  ++  L A I EAA         ++   +  G LLY + TK    
Sbjct  7    LGLSEQKVSETAKNVALSKQL-AVIIEAAEEALKNAGKSNVLGKQQGTLLYQLGTKIKPQ  65

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVS  530
               H P L+ YI+S  I+T AQL A+  +L ANA    ++ E E+ACGVGV VS
Sbjct  66   CAKHIPLLVNYIISDGIRTEAQLTASLDYLLANAVHDFEIAELEKACGVGVSVS  119



>ref|XP_003394481.1| PREDICTED: probable glutaminyl-tRNA synthetase-like [Bombus terrestris]
Length=776

 Score = 69.3 bits (168),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 66/118 (56%), Gaps = 2/118 (2%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            ++ + LF  IGL E+ AK T+ N +V+ NL   I EA          G LLY +A+K   
Sbjct  4    QDDVKLFQSIGLSEQKAKETLKNKQVSNNLKLAIIEANKYGIITSEIGILLYQLASKI-K  62

Query  366  NALVHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N + ++ + L KYI   K+ T  +L+A   +L  +  E + V++FE+ CG+G+ +S E
Sbjct  63   NQIANKLSFLAKYIAEKKLDTTQRLDAGLDYLLNHIEENVDVSDFEKECGIGIVISPE  120



>ref|XP_008479890.1| PREDICTED: probable glutamine--tRNA ligase [Diaphorina citri]
Length=775

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 38/112 (34%), Positives = 68/112 (61%), Gaps = 2/112 (2%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAA-VTDGCDRTAGNLLYTVATKFPANALVH  380
            FL +GL+E+ AK T+ N  ++  L   I EA+ ++    +  G+LLY +A+K  + + +H
Sbjct  12   FLSVGLNEKKAKETLKNETLSTYLKQAIEEASKISPHSLQDCGSLLYHLASKIKSQSSIH  71

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             P L+KYIVS  + +  +++AA  ++ ++ +  +   E E +CGVGV V+ E
Sbjct  72   LPLLVKYIVSKALDSTLRVDAALEYVLSHVN-AVNEKELEASCGVGVIVTSE  122



>ref|XP_004451967.1| PREDICTED: glutamine--tRNA ligase isoform 2 [Dasypus novemcinctus]
Length=774

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  A+    D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEHKARETLKNTTLSAQLREAATQAQQALGSTIDKATGTLLYGLASRLK  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +  P L+ Y+ S KI T AQL AA  ++ ++  + L   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--PFLVDYVASKKIHTEAQLSAALEYVRSHPLDPLDTVDFEQECGVGVMVTPE  120



>ref|XP_007953510.1| PREDICTED: glutamine--tRNA ligase isoform X2 [Orycteropus afer 
afer]
Length=775

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 65/118 (55%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A  T+ N+ ++A L     +A  T GC  D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKAHETLKNSSLSAQLREAATQAQQTLGCTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +  +  P L+ YI S KI T  QL AA  ++ ++  + + + +FE  CGV V V+ E
Sbjct  65   DSRRL--PFLVGYIASKKIHTEPQLSAALEYVKSHPLDPIDILDFERECGVDVVVTPE  120



>ref|XP_004070579.1| PREDICTED: glutamine--tRNA ligase [Oryzias latipes]
Length=774

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 42/117 (36%), Positives = 65/117 (56%), Gaps = 5/117 (4%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAV---TDGCDRTAGNLLYTVATKFPA  365
            L+LF  IGL E+ AK T+ N  +++ L   I +A     T G D+T G LLY++A++   
Sbjct  5    LELFTSIGLSEQKAKETLKNGALSSTLRDAIVQAQNVLGTSGVDKTIGTLLYSMASRLKD  64

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               +    L   I   KI +  QL AA  FL ++  + +  +EF+EACGVG+ ++ E
Sbjct  65   TKRLE--FLSINIAQRKISSELQLAAALEFLKSHPQDPISQSEFDEACGVGIVITPE  119



>ref|XP_004914154.1| PREDICTED: glutamine--tRNA ligase [Xenopus (Silurana) tropicalis]
Length=772

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG--CDRTAGNLLYTVATKFPAN  368
            L LF  IGL E+ A+ T+ N  ++  L   I +A  T G   D+  G LLY VAT+    
Sbjct  6    LSLFTAIGLSEQKARETLKNEALSLVLRDAIVQAQKTLGPSVDKVTGTLLYNVATRLKDT  65

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +    L++YI S KI T  QL AA  ++ A+  + +  + FE+ CGVGV V+ E
Sbjct  66   KRLG--FLVEYIASKKITTDLQLNAALDYVKAHPLDPINTSHFEKECGVGVTVTPE  119



>ref|XP_004283976.1| PREDICTED: glutamine--tRNA ligase isoform 2 [Orcinus orca]
Length=775

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            +PL LF  +GL E  A+ T+ N  ++A L     +A  T GC  D+  G LLY +A++  
Sbjct  5    DPLSLFTGLGLSEHKARETLKNTALSAQLREAATQAQQTLGCTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI + KI T  QL AA  ++ ++  + +    FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIANRKIHTETQLSAALEYVRSHPLDPINTMVFEQECGVGVVVTPE  120



>ref|XP_004319924.1| PREDICTED: LOW QUALITY PROTEIN: glutamine--tRNA ligase [Tursiops 
truncatus]
Length=777

 Score = 68.9 bits (167),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            +PL LF  +GL E  A+ T+ N  ++A L     +A  T GC  D+  G LLY +A++  
Sbjct  5    DPLSLFTGLGLSEHKARETLKNTALSAQLREAATQAQQTLGCTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI + KI T  QL AA  ++ ++  + +    FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIANRKIHTETQLSAALEYVRSHPLDPINTMVFEQECGVGVVVTPE  120



>gb|AAI10785.1| LOC734179 protein [Xenopus laevis]
Length=771

 Score = 68.6 bits (166),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFPAN  368
            L LF  IGL E+ A+ T+ N  ++  L   I +A  T G   D+  G LLY VAT+    
Sbjct  5    LSLFTAIGLSEQKARETLKNESLSLVLREAIVQAQKTLGSSVDKVTGTLLYNVATRLKDT  64

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +    L++YI S KI T  QL AA  ++ A+  + +    FE+ CGVGV V+ E
Sbjct  65   KRLG--FLVEYIASKKISTDLQLNAALDYVKAHPLDPIDTVHFEKECGVGVTVTPE  118



>ref|NP_001079979.1| glutaminyl-tRNA synthetase [Xenopus laevis]
 gb|AAH57752.1| MGC69128 protein [Xenopus laevis]
Length=772

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG--CDRTAGNLLYTVATKFPAN  368
            L LF  IGL E+ A+ T+ N  ++  L   I +A  T G   D+  G LLY VAT+    
Sbjct  6    LSLFTAIGLSEQKARETLKNEALSLLLRDAIVQAQKTLGPSVDKVTGTLLYNVATRLKDT  65

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +    L++YI S KI T  QL AA  ++ A+  + +    FE+ CGVGV V+ E
Sbjct  66   KRLG--FLVEYIASKKITTDLQLNAALDYVKAHPLDPIDTGHFEKDCGVGVTVTPE  119



>ref|XP_005931787.1| PREDICTED: glutamine--tRNA ligase-like [Haplochromis burtoni]
Length=777

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 65/119 (55%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N+ ++++L   I +A       G D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNDSLSSSLKEAITQAQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L + I   KI T  QL AA  F+ A+  + +   EF++ACGVGV ++ E
Sbjct  63   KDTKRL--AFLSESIAQRKICTELQLAAALDFVKAHPQDPINQKEFDDACGVGVVITPE  119



>ref|XP_008412209.1| PREDICTED: glutamine--tRNA ligase [Poecilia reticulata]
Length=776

 Score = 68.2 bits (165),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 44/120 (37%), Positives = 65/120 (54%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N  +++ L   I +A   +G    D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNEALSSALKEGIIQAQRVNGANGVDKAMGTLLYSMASRL  62

Query  360  PANA-LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              N  LV    L   I   KI T  QL AA  F+ ++  + +   EF+EACGVGV ++ E
Sbjct  63   KDNKRLVF---LSDCIAQRKICTELQLAAALDFVKSHPEDPISQKEFDEACGVGVVITPE  119



>gb|AAI61792.1| LOC100145804 protein [Xenopus (Silurana) tropicalis]
Length=771

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 44/116 (38%), Positives = 62/116 (53%), Gaps = 4/116 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG--CDRTAGNLLYTVATKFPAN  368
            L LF  IGL E+ A+ T+ N  ++  L   I +A  T G   D+  G LLY VAT     
Sbjct  5    LSLFTAIGLSEQKARETLKNEALSLVLRDAIVQAQKTLGPSVDKVTGTLLYNVATHLKDT  64

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +    L++YI S KI T  QL AA  ++ A+  + +  + FE+ CGVGV V+ E
Sbjct  65   KRLG--FLVEYIASKKITTDLQLNAALDYVKAHPLDPINTSHFEKECGVGVTVTPE  118



>ref|XP_006796475.1| PREDICTED: glutamine--tRNA ligase-like [Neolamprologus brichardi]
Length=776

 Score = 67.8 bits (164),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N+ ++++L   I +A       G D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNDSLSSSLKEAITQAQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L + I   KI T  QL AA  F+  +  + +   EF+EACGVGV ++ E
Sbjct  63   KDTKRL--AFLSESIAQRKICTELQLAAALDFVKGHPQDPINQKEFDEACGVGVVITPE  119



>ref|XP_002073864.1| GK14344 [Drosophila willistoni]
 gb|EDW84850.1| GK14344 [Drosophila willistoni]
Length=779

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 41/125 (33%), Positives = 68/125 (54%), Gaps = 10/125 (8%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYE---AAVTDGCDRTAGNLLYTVA  350
             GE+ +  F ++G+ E+ AK T+ N  VT NL   + E   AA+ DG     G L+Y +A
Sbjct  2    AGEDLIAKFQELGMSEQKAKETLKNANVTKNLQLALDEIKGAALADG----VGMLIYHMA  57

Query  351  TKFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASE---TLKVNEFEEACGVGV  521
            +K       H P L++YI+  K+    +++AA  ++  +  +   ++ V E E+ CGVGV
Sbjct  58   SKLKPQVAEHLPLLVRYILERKLDNTQRVDAALDYILKSGQKLKASINVEELEKECGVGV  117

Query  522  EVSIE  536
             V+ E
Sbjct  118  VVTPE  122



>ref|XP_005448788.1| PREDICTED: glutamine--tRNA ligase-like isoform X2 [Oreochromis 
niloticus]
Length=776

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N  ++++L   I +A       G D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNESLSSSLKEAITQAQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L + I   KI T  QL AA  F+ ++  + +   EF+EACGVGV ++ E
Sbjct  63   KDTKRL--AFLSESIAQRKICTELQLAAALDFVKSHPQDPINQKEFDEACGVGVVITPE  119



>ref|XP_003439051.1| PREDICTED: glutamine--tRNA ligase-like isoform X1 [Oreochromis 
niloticus]
Length=776

 Score = 67.8 bits (164),  Expect = 6e-10, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 64/119 (54%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N  ++++L   I +A       G D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNESLSSSLKEAITQAQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L + I   KI T  QL AA  F+ ++  + +   EF+EACGVGV ++ E
Sbjct  63   KDTKRL--AFLSESIAQRKICTELQLAAALDFVKSHPQDPINQKEFDEACGVGVVITPE  119



>ref|XP_006892985.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Elephantulus edwardii]
Length=775

 Score = 67.8 bits (164),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 44/119 (37%), Positives = 64/119 (54%), Gaps = 6/119 (5%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   DR  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDRATGTLLYGLASRLK  64

Query  363  -ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             A  L   P L+ YI S KI T  QL AA  ++ ++  + + V +FE  CGV V V+ E
Sbjct  65   DARRL---PFLVGYITSKKIHTETQLSAALEYVRSHPLDPVDVVDFERECGVNVVVTPE  120



>ref|XP_005969306.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Pantholops hodgsonii]
Length=775

 Score = 67.4 bits (163),  Expect = 8e-10, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+T G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKTTGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIASRKIHTETQLSAALEYVQSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|XP_003217895.1| PREDICTED: glutamine--tRNA ligase [Anolis carolinensis]
Length=781

 Score = 67.4 bits (163),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 41/118 (35%), Positives = 67/118 (57%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANL--TAFIYEAAVTDGCDRTAGNLLYTVATKFP  362
            + L LFL +GL E  A+ T+ N  ++A+L   A   ++ +    D+T G LLY+VA++  
Sbjct  10   DSLRLFLGLGLSESKARETLRNEALSASLRQAALQAQSLLGSAVDKTLGTLLYSVASRLK  69

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 H   L++YI + KI T  Q+ AA  ++ ++  ET+   +F+  CGVGV V+ E
Sbjct  70   DPK--HLGFLVEYIATKKIVTDLQVNAALEYIKSHPVETIDPTDFDRFCGVGVVVTPE  125



>gb|EPZ32575.1| Glutamyl/glutaminyl-tRNA synthetase, class Ib, catalytic domain-containing 
protein [Rozella allomycis CSF55]
Length=514

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 39/112 (35%), Positives = 57/112 (51%), Gaps = 2/112 (2%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF  IGLDE+ A     N K++  L   I  A V  GC ++ G LL+ +AT  P     H
Sbjct  9    LFTGIGLDEKKALELTKNAKLSTLLKTAIESAGVEGGCSKSKGGLLHLLATTVPRELSEH  68

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             P L ++I    +K+  Q+ +A  FL         V + ++A GVG+EV+ E
Sbjct  69   VPFLAEWIAKDMLKSEVQVSSAIAFLKQYRE--YDVEDLKKASGVGIEVTEE  118



>ref|XP_007129947.1| PREDICTED: LOW QUALITY PROTEIN: glutamine--tRNA ligase [Physeter 
catodon]
Length=793

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T GC  D+  G LLY +A++  
Sbjct  23   DSLSLFTGLGLSEHKARETLKNTALSAQLREAATQAQQTLGCTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI + KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DPRRL--SFLVSYIANRKIHTETQLSAALEYVRSHPLDPINTMDFEQECGVGVVVTPE  138



>ref|NP_596745.1| cytoplasmic glutaminyl-tRNA ligase Qrs1 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9Y7Y8.1|SYQ_SCHPO RecName: Full=Probable glutamine--tRNA ligase; AltName: Full=Glutaminyl-tRNA 
synthetase; Short=GlnRS [Schizosaccharomyces 
pombe 972h-]
 emb|CAB46772.1| cytoplasmic glutaminyl-tRNA ligase Qrs1 (predicted) [Schizosaccharomyces 
pombe]
Length=811

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 47/118 (40%), Positives = 69/118 (58%), Gaps = 11/118 (9%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAV-TDGCDRTAGNLLYTVA-----TKFP-  362
            F KIGL+E T K+T+ N K++++L   I E  V + GCDRT GNLL+T+A      K P 
Sbjct  12   FTKIGLNETTVKDTLKNKKLSSSLNKVIEETNVGSSGCDRTIGNLLFTLANASLKQKDPK  71

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            +NA  H   +   IVS  +KT  Q+ AA  +      +T+  +EF++  GVGV ++ E
Sbjct  72   SNA--HEAFIASKIVSGDLKTNLQVNAAITY--CKDKDTIDESEFDKETGVGVVLTPE  125



>gb|KHJ45111.1| glutamine--tRNA ligase [Trichuris suis]
Length=829

 Score = 67.0 bits (162),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 41/110 (37%), Positives = 59/110 (54%), Gaps = 2/110 (2%)
 Frame = +3

Query  213  IGLDERTAKNTVANNKVTANLTAFIYEA-AVTDGC-DRTAGNLLYTVATKFPANALVHRP  386
            +GL E+  + T+ N  ++  L + + EA  +T G    T G LLY VAT+     L +R 
Sbjct  13   LGLSEQKIQETLKNQPLSETLCSIVAEALKITGGTLSGTQGKLLYQVATRLKKQCLKYRT  72

Query  387  TLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             L+K I   +I T  QL AA  FL ++     +  +FE ACG+GV VS E
Sbjct  73   LLVKEICKDRIITDMQLTAALQFLLSHVMVDFEPAQFEAACGIGVRVSPE  122



>ref|XP_006171047.1| PREDICTED: glutamine--tRNA ligase [Tupaia chinensis]
 gb|ELV09653.1| Glutaminyl-tRNA synthetase [Tupaia chinensis]
Length=774

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/117 (34%), Positives = 64/117 (55%), Gaps = 3/117 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC-DRTAGNLLYTVATKFPA  365
            + L LF  +GL E  A+ T+ N+ ++A L     +A  T G  D+  G LLY +A++   
Sbjct  5    DSLSLFTGLGLSEHKARETLKNSALSAQLREAATQAQQTLGSIDKATGTLLYGLASRLRD  64

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               +    L+ Y+ S KI T  QL AA  ++ ++  + + V +FE+ CGVGV V+ E
Sbjct  65   TRRL--SFLVSYVASKKIHTEPQLSAALDYVRSHPLDPIDVVDFEQQCGVGVVVTPE  119



>ref|XP_003800684.1| PREDICTED: glutamine--tRNA ligase [Otolemur garnettii]
Length=743

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T G   D+  G LLY++A++  
Sbjct  125  DSLSLFTGLGLSEHKARETLKNTALSAQLRKAATQAQQTLGSTIDKATGTLLYSLASRLR  184

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  185  DTRRL--SFLVNYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVTVTPE  240



>ref|XP_009492563.1| hypothetical protein H696_00435 [Fonticula alba]
 gb|KCV72862.1| hypothetical protein H696_00435 [Fonticula alba]
Length=782

 Score = 66.6 bits (161),  Expect = 1e-09, Method: Compositional matrix adjust.
 Identities = 38/111 (34%), Positives = 62/111 (56%), Gaps = 10/111 (9%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANALVH  380
            LF +IGLD+  A  T  N +++A L   I+         +  G L+Y  AT+   +   H
Sbjct  10   LFSRIGLDDTKALETTKNPQLSACLKDMIF---------KDLGKLIYKAATRVSKDLARH  60

Query  381  RPTLLKYIVSSKIKTPAQLEAAFGFLSANASE-TLKVNEFEEACGVGVEVS  530
            +   + YIV+ K+KT  QL+AAF F++  A +  + ++ F+ ACGVGV ++
Sbjct  61   QDLFVNYIVTGKLKTSQQLDAAFEFMATQAVDAVIDLDGFDLACGVGVVIT  111



>ref|XP_003936722.2| PREDICTED: glutamine--tRNA ligase [Saimiri boliviensis boliviensis]
Length=793

 Score = 66.6 bits (161),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTGLGLSEQKARETLKNQTLSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTADFEQECGVGVTVTPE  138



>dbj|BAG61988.1| unnamed protein product [Homo sapiens]
Length=147

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N+ ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE  CGVGV V+ E
Sbjct  65   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPE  120



>ref|XP_005740582.1| PREDICTED: glutamine--tRNA ligase-like [Pundamilia nyererei]
Length=776

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 41/120 (34%), Positives = 64/120 (53%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N+ ++++L   I +        G D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNDSLSSSLKEAITQVQRVHGASGVDKAMGTLLYSMASRL  62

Query  360  PANALVHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 + R   L + I   KI T  QL AA  F+  +  + +   EF+EACGVGV ++ E
Sbjct  63   KD---IKRLAFLSESIAQRKICTELQLAAALDFVKGHPQDPINQKEFDEACGVGVVITPE  119



>gb|EPX73219.1| cytoplasmic glutaminyl-tRNA ligase Qrs1 [Schizosaccharomyces 
octosporus yFS286]
Length=806

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 7/116 (6%)
 Frame = +3

Query  204  FLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTD-GCDRTAGNLLYTVATKF----PAN  368
            F+ IGL+E   K+T+ N K+++ L   I EA + + GCDR+ GNLL T+A +        
Sbjct  12   FMSIGLNETRVKDTLKNKKLSSALNRVIDEAKLKESGCDRSVGNLLMTLANESLKQKDTK  71

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               H P +   IV   IK+  Q+ AA G+     ++++   EF++  GVGV  + E
Sbjct  72   LQKHEPYICSKIVKGDIKSTLQVNAAIGY--CKNTDSINEEEFDKELGVGVTCTPE  125



>ref|XP_007562344.1| PREDICTED: glutamine--tRNA ligase isoform X2 [Poecilia formosa]
Length=766

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 7/118 (6%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKFPA  365
            L LF  IGL E+  K T+ N  +++ L   I +A   +G    D+  G LLY++A++   
Sbjct  5    LTLFTSIGLSEQKVKETLKNEALSSALKEGIIQAQRVNGANGVDKAMGTLLYSMASRLKD  64

Query  366  NA-LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N  LV    L   I   KI T  QL AA  F+ ++  + +   EF+EACGVGV ++ E
Sbjct  65   NKRLVF---LSDCIAQRKICTELQLAAALDFVKSHPEDPISQKEFDEACGVGVVITPE  119



>ref|XP_007562343.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Poecilia formosa]
Length=777

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 43/118 (36%), Positives = 63/118 (53%), Gaps = 7/118 (6%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKFPA  365
            L LF  IGL E+  K T+ N  +++ L   I +A   +G    D+  G LLY++A++   
Sbjct  5    LTLFTSIGLSEQKVKETLKNEALSSALKEGIIQAQRVNGANGVDKAMGTLLYSMASRLKD  64

Query  366  NA-LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
            N  LV    L   I   KI T  QL AA  F+ ++  + +   EF+EACGVGV ++ E
Sbjct  65   NKRLVF---LSDCIAQRKICTELQLAAALDFVKSHPEDPISQKEFDEACGVGVVITPE  119



>ref|XP_011307953.1| PREDICTED: probable glutamine--tRNA ligase isoform X1 [Fopius 
arisanus]
Length=795

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 42/118 (36%), Positives = 61/118 (52%), Gaps = 1/118 (1%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDG-CDRTAGNLLYTVATKFP  362
            E+ + L + IGL E+ A+ T+ N +VT NL   I EA  ++       G LLY +A+K  
Sbjct  2    EDDVQLLVSIGLSEQKAQETLKNAQVTKNLKTAIKEAKESNSEISPEIGILLYHLASKIK  61

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
               L     L  YI   K+ T  +++AA   L      T+ + EFE ACGVG+ V+ E
Sbjct  62   PQILDKLAFLSSYISQKKLDTIQRVDAALSHLLDTIHTTINIAEFEAACGVGIIVTPE  119



>ref|XP_001999390.1| GI24483 [Drosophila mojavensis]
 gb|EDW14851.1| GI24483 [Drosophila mojavensis]
Length=785

 Score = 66.2 bits (160),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 43/124 (35%), Positives = 64/124 (52%), Gaps = 9/124 (7%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAA--VTDGCDRTAGNLLYTVAT  353
             GE+ +  F ++G+ E+ AK T+ N  VT NL   + E    ++DG     G LLY +AT
Sbjct  2    AGEDLIIKFQELGMSEQKAKETLKNANVTRNLQLALAETKKPLSDG----VGMLLYHMAT  57

Query  354  KFPANALVHRPTLLKYIVSSKIKTPAQLEAAFGFL---SANASETLKVNEFEEACGVGVE  524
            K       H P L++YI   K+    +++AA  +L       + T+ V E +  CGVGV 
Sbjct  58   KLKPQIAAHLPLLVRYITERKLDNTQRVDAALEYLLKCGQKKNATVDVAELDRECGVGVV  117

Query  525  VSIE  536
            VS E
Sbjct  118  VSPE  121



>emb|CDW79726.1| glutamine-trna ligase [Stylonychia lemnae]
Length=773

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/122 (34%), Positives = 59/122 (48%), Gaps = 6/122 (5%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            +N  +LFL IGLD +   +   N KV+  L   +  A VT    +  GNLLY  +TK P 
Sbjct  5    KNYQELFLAIGLDPKVVDSITKNKKVSHRLAEVVEAAGVTTAT-KNIGNLLYQASTKMPE  63

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLS-----ANASETLKVNEFEEACGVGVEVS  530
            +   H   L+ +++S +I    QLE A  +LS       A   +   EF+   G+GV  S
Sbjct  64   SITHHTKYLVSFVISEQIVKSQQLEEAIKYLSNVVRQQGAEHAVDEAEFKRESGIGVVYS  123

Query  531  IE  536
             E
Sbjct  124  DE  125



>ref|XP_005053408.1| PREDICTED: glutamine--tRNA ligase, partial [Ficedula albicollis]
Length=776

 Score = 65.9 bits (159),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 43/119 (36%), Positives = 61/119 (51%), Gaps = 4/119 (3%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEA--AVTDGCDRTAGNLLYTVATKF  359
            E  L LF  IGL E  A+ T+ N  ++A L   + +A  A+    D+  G LLY  A + 
Sbjct  6    EEALGLFTGIGLSEAKARETLRNGALSALLRRAVLQARSALGPALDKATGTLLYNTAARL  65

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                  H   L+ YI   +I T  QL AA  ++ ++  E L V +FE ACGVGV ++ E
Sbjct  66   KDPK--HLGFLVGYIARREILTDLQLTAALEYVRSHPLEPLDVADFERACGVGVCITPE  122



>ref|XP_001632077.1| predicted protein [Nematostella vectensis]
 gb|EDO40014.1| predicted protein [Nematostella vectensis]
Length=776

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/116 (34%), Positives = 63/116 (54%), Gaps = 4/116 (3%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            L LF  IGL ++ AK T+ N  ++  L   + +A      D+ +G LLY +A+       
Sbjct  5    LSLFQSIGLSQQKAKETMKNEALSQKLEKIVTQAHSKGESDKQSGTLLYVLASSSLKEE-  63

Query  375  VHRPTLL-KYIVSSKIKTPAQLEAAFGFLSANAS-ETLKVNEFEEACGVGVEVSIE  536
              R +LL  YI S K+ + AQL AAF +L+  +    +   +FE+ CG+GVE++ E
Sbjct  64   -SRVSLLVDYICSKKVSSSAQLTAAFEYLTKTSPVGPIDACKFEQHCGIGVEITPE  118



>ref|XP_008066341.1| PREDICTED: glutamine--tRNA ligase [Tarsius syrichta]
Length=793

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 64/118 (54%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             +  +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DSRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVMVTPE  138



>ref|XP_008564001.1| PREDICTED: glutamine--tRNA ligase [Galeopterus variegatus]
Length=775

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T G   D+  G LLY++A++  
Sbjct  5    DSLSLFTGLGLSEHKARETLKNTALSAQLRKAATQAQQTLGSTIDKATGTLLYSLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ Y+ S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DTRRL--SFLVNYVASKKIHTEPQLSAALEYVHSHPLDPIDTVDFEQECGVGVMVTPE  120



>emb|CDW53172.1| Glutaminyl-tRNA synthetase [Trichuris trichiura]
Length=815

 Score = 65.5 bits (158),  Expect = 3e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 59/119 (50%), Gaps = 11/119 (9%)
 Frame = +3

Query  213  IGLDERTAKNTVANNKVTANLTAFIYEAA----------VTDGC-DRTAGNLLYTVATKF  359
            +GL E+  + T+ N  ++  L + + E +          +T G    T G LLY VAT+ 
Sbjct  13   LGLSEQKIQETLKNQPLSETLCSIVAEVSHEQRWFVAIKITGGTLSGTQGKLLYQVATRL  72

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                L HR  L+K I   +I T  QL AA  FL ++     +  +FE ACG+GV VS E
Sbjct  73   KKQCLKHRTLLVKEICKDRIVTDMQLTAALQFLLSHVMVDFEPAQFEAACGIGVSVSPE  131



>ref|XP_007982378.1| PREDICTED: glutamine--tRNA ligase isoform X2 [Chlorocebus sabaeus]
Length=769

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTSLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  138



>ref|XP_005696027.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Capra hircus]
Length=775

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIASRKIHTETQLSAALEYVQSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|XP_004018519.1| PREDICTED: glutamine--tRNA ligase isoform 1 [Ovis aries]
Length=775

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIASRKIHTETQLSAALEYVQSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|XP_007982377.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Chlorocebus sabaeus]
Length=793

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTSLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  138



>ref|XP_003734890.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Callithrix jacchus]
Length=775

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 39/118 (33%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  +++ L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNQTLSSQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTADFEQECGVGVTVTPE  120



>ref|XP_005801766.1| PREDICTED: glutamine--tRNA ligase-like [Xiphophorus maculatus]
Length=776

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 43/120 (36%), Positives = 63/120 (53%), Gaps = 7/120 (6%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC---DRTAGNLLYTVATKF  359
            + L LF  IGL E+ AK T+ N  ++  L   I +A   +G    D+  G LLY++A++ 
Sbjct  3    DTLTLFTSIGLSEQKAKETLKNEALSLALKEGIIQAQRVNGASGVDKAMGTLLYSMASRL  62

Query  360  PANA-LVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              N  LV    L   I   KI T  QL AA  F+ ++  + +   EF+E CGVGV ++ E
Sbjct  63   KDNKRLVF---LSDCIAQRKICTELQLAAALDFVKSHPEDPISQKEFDETCGVGVVITPE  119



>dbj|BAH13826.1| unnamed protein product [Homo sapiens]
Length=282

 Score = 63.5 bits (153),  Expect = 4e-09, Method: Compositional matrix adjust.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N+ ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTSLGLSEQKARETLKNSALSAQLREAATQAQQTLGSTIDKATGILLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE  CGVGV V+ E
Sbjct  83   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFERECGVGVIVTPE  138



>emb|CEP15816.1| hypothetical protein [Parasitella parasitica]
Length=790

 Score = 65.5 bits (158),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 42/114 (37%), Positives = 57/114 (50%), Gaps = 10/114 (9%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPANAL  374
            + LF+KIGL E+ AK+T  N K+   L   I  A V DGCD+  G LLYT+A      + 
Sbjct  5    IPLFVKIGLSEQKAKDTAKNKKLAPKLETVINVANVGDGCDKDVGILLYTLAAGASKTSA  64

Query  375  VHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             H   + K I+   +KT  Q       +S N        EF+ A GVG+ V+ E
Sbjct  65   EHLSFITKKIMDGDLKTVDQ-------ISGNG---FNPEEFDAATGVGIVVTPE  108



>tpg|DAA16919.1| TPA: glutaminyl-tRNA synthetase [Bos taurus]
Length=716

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYITSRKIHTETQLSAALEYVRSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|XP_011505774.1| PREDICTED: LOW QUALITY PROTEIN: probable glutamine--tRNA ligase 
[Ceratosolen solmsi marchali]
Length=770

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 36/117 (31%), Positives = 58/117 (50%), Gaps = 0/117 (0%)
 Frame = +3

Query  186  ENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKFPA  365
            E  + L   IGL E+ AK T+ N +VT NL   I EA      +   G L+Y +A+    
Sbjct  2    EKDIQLLKSIGLSEQKAKETLKNLQVTNNLKEIINEAVKYGTINNVNGTLIYHLASNIKM  61

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
              +   P L + I+  K+ +  +L+ A  +L  N  + +  +EF  ACG G+ ++ E
Sbjct  62   QIINTIPLLTQCIIEKKLDSVQRLDCALNYLLHNLGKVVNFDEFSNACGFGIVITSE  118



>ref|XP_010850184.1| PREDICTED: glutamine--tRNA ligase [Bison bison bison]
Length=775

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYITSRKIHTETQLSAALEYVRSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|NP_001029640.1| glutamine--tRNA ligase [Bos taurus]
 sp|Q3MHH4.1|SYQ_BOVIN RecName: Full=Glutamine--tRNA ligase; AltName: Full=Glutaminyl-tRNA 
synthetase; Short=GlnRS [Bos taurus]
 gb|AAI05238.1| Glutamyl-prolyl-tRNA synthetase [Bos taurus]
 gb|ABF57443.1| glutaminyl-tRNA synthetase [Bos taurus]
Length=775

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYITSRKIHTETQLSAALEYVRSHPLDPINTEDFEQECGVGVVVTPE  120



>ref|XP_006631127.1| PREDICTED: glutamine--tRNA ligase-like [Lepisosteus oculatus]
Length=772

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 41/116 (35%), Positives = 64/116 (55%), Gaps = 7/116 (6%)
 Frame = +3

Query  201  LFLKIGLDERTAKNTVANNKVTANLTAFIYEA---AVTDGCDRTAGNLLYTVATKF-PAN  368
            LF +IGL E+ AK T+ N  +++ L   I  A   A   G DR  G LLY++A++   A 
Sbjct  7    LFTEIGLSEQKAKETLKNEALSSTLKEAITLARGVAGLAGVDRPTGTLLYSLASRLRDAR  66

Query  369  ALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
             L     L ++I   +I T  QL AA  ++ ++  + +   +F+EACGVGV ++ E
Sbjct  67   RLAF---LTEHIALRRISTELQLSAALEYVKSHPEDPIAAQDFQEACGVGVVITPE  119



>gb|EIF49537.1| glutaminyl-trna synthetase [Brettanomyces bruxellensis AWRI1499]
Length=797

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/119 (34%), Positives = 65/119 (55%), Gaps = 7/119 (6%)
 Frame = +3

Query  195  LDLFLKIGLDERTAKNTVANNKVTANLTAFI-YEAAVTDG--CDRTAGNLLYTVATKFPA  365
            ++LF K+G D++  K  ++N K++ +L   I    ++ +G   D++   LL+ VA     
Sbjct  13   VELFSKVGFDDKRIKEIMSNKKISQSLGELIELTGSIQNGEQLDKSKDALLHNVANMLKG  72

Query  366  NALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKV--NE--FEEACGVGVEVS  530
                H  TL+ YIVS K+ T  Q++ AF ++ A+  +  K   NE  FEE  GVG+ VS
Sbjct  73   KHFKHIDTLVXYIVSDKLTTNLQIKEAFKYIKAHQDQDAKAVFNETAFEEESGVGINVS  131



>ref|XP_006053296.1| PREDICTED: glutamine--tRNA ligase [Bubalus bubalis]
Length=775

 Score = 65.1 bits (157),  Expect = 4e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTVLSAQLREAATQAQQTLGSSIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIASRKIHTETQLSAALEYVRSHPLDPINTEDFEQECGVGVVVTPE  120



>emb|CDQ75073.1| unnamed protein product [Oncorhynchus mykiss]
Length=772

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 41/119 (34%), Positives = 61/119 (51%), Gaps = 5/119 (4%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVT---DGCDRTAGNLLYTVATKF  359
            +PL LF  IGL E+ AK T+ N+ + + L   I +A       G D+  G LLYT+ ++ 
Sbjct  3    DPLTLFTSIGLSEQKAKETLKNDALCSALKDAIAQAQRVLGAAGVDKATGTLLYTMTSRL  62

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                 +    L  +I   KI T  QL AA  F+ ++  + +   EFE  CGVGV ++ E
Sbjct  63   RDPKRLG--FLTDHIAQRKICTELQLAAALEFVKSHPQDPINQQEFESLCGVGVVITPE  119



>ref|XP_001953009.1| GF17431 [Drosophila ananassae]
 gb|EDV41592.1| GF17431 [Drosophila ananassae]
Length=780

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 36/122 (30%), Positives = 61/122 (50%), Gaps = 3/122 (2%)
 Frame = +3

Query  180  GGENPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGCDRTAGNLLYTVATKF  359
             GE+ +  F ++G+ E+ AK T+ N  VT NL   + E           G L+Y +A+K 
Sbjct  2    AGEDLIARFQELGMSEQKAKETLKNANVTKNLQLALAEVGAGTALGDGTGMLIYHLASKL  61

Query  360  PANALVHRPTLLKYIVSSKIKTPAQLEAAFGFL---SANASETLKVNEFEEACGVGVEVS  530
                  H P L++YIV  K+    +++AA  ++         ++ + E ++ CGVGV V+
Sbjct  62   KPQTAEHLPLLVRYIVERKLDNTQRVDAALEYVLKCGQKLKASIDLQELDKECGVGVVVT  121

Query  531  IE  536
             E
Sbjct  122  SE  123



>ref|XP_004581509.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Ochotona princeps]
Length=775

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSELKARETLKNAALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + + + +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVNYIASKKIHTELQLSAALEYVRSHPLDPIDIRDFEQECGVGVTVTPE  120



>ref|XP_002713459.2| PREDICTED: LOW QUALITY PROTEIN: glutamine--tRNA ligase [Oryctolagus 
cuniculus]
Length=793

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 41/118 (35%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T G   D+  G LLY VA++  
Sbjct  23   DSLSLFTGLGLSELKARETLKNTALSAQLREAAIQAQQTLGSTIDKATGTLLYGVASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DPRRL--SFLVSYIASKKIHTELQLSAALEYVRSHPLDPINTADFEQECGVGVVVTPE  138



>ref|XP_004419741.1| PREDICTED: glutamine--tRNA ligase isoform 1 [Ceratotherium simum 
simum]
Length=775

 Score = 65.1 bits (157),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 62/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E  A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEHKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLK  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI + KI T  QL AA  ++ ++  E +   +FE+ CGVGV V+ E
Sbjct  65   DPRRL--SFLVSYIANKKIHTETQLSAALEYVRSHPLEPINTVDFEQECGVGVVVTPE  120



>ref|XP_010368326.1| PREDICTED: glutamine--tRNA ligase isoform X2 [Rhinopithecus roxellana]
Length=764

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  120



>ref|XP_009199073.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Papio anubis]
Length=782

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  23   DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  82

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  83   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  138



>ref|XP_010368316.1| PREDICTED: glutamine--tRNA ligase isoform X1 [Rhinopithecus roxellana]
Length=775

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  120



>dbj|BAE87806.1| unnamed protein product [Macaca fascicularis]
 gb|EHH16376.1| hypothetical protein EGK_11648 [Macaca mulatta]
 gb|EHH51319.1| hypothetical protein EGM_10673 [Macaca fascicularis]
Length=775

 Score = 64.7 bits (156),  Expect = 5e-09, Method: Composition-based stats.
 Identities = 40/118 (34%), Positives = 63/118 (53%), Gaps = 4/118 (3%)
 Frame = +3

Query  189  NPLDLFLKIGLDERTAKNTVANNKVTANLTAFIYEAAVTDGC--DRTAGNLLYTVATKFP  362
            + L LF  +GL E+ A+ T+ N  ++A L     +A  T G   D+  G LLY +A++  
Sbjct  5    DSLSLFTGLGLSEQKARETLKNTALSAQLREAATQAQQTLGSTIDKATGTLLYGLASRLR  64

Query  363  ANALVHRPTLLKYIVSSKIKTPAQLEAAFGFLSANASETLKVNEFEEACGVGVEVSIE  536
                +    L+ YI S KI T  QL AA  ++ ++  + +   +FE+ CGVGV V+ E
Sbjct  65   DTRRL--SFLVSYIASKKIHTEPQLSAALEYVRSHPLDPIDTVDFEQECGVGVIVTPE  120



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 551443513800