BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A10

Length=569
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009613603.1|  PREDICTED: microsomal glutathione S-transfer...    246   6e-80   Nicotiana tomentosiformis
ref|XP_009763425.1|  PREDICTED: microsomal glutathione S-transfer...    245   2e-79   Nicotiana sylvestris
ref|XP_006348192.1|  PREDICTED: microsomal glutathione S-transfer...    239   2e-77   Solanum tuberosum [potatoes]
ref|XP_004232661.1|  PREDICTED: microsomal glutathione S-transfer...    238   7e-77   Solanum lycopersicum
ref|XP_002305918.1|  microsomal glutathione s-transferase family ...    234   3e-75   Populus trichocarpa [western balsam poplar]
ref|XP_011048867.1|  PREDICTED: microsomal glutathione S-transfer...    234   6e-75   Populus euphratica
ref|XP_011096918.1|  PREDICTED: microsomal glutathione S-transfer...    233   7e-75   Sesamum indicum [beniseed]
ref|XP_010103455.1|  hypothetical protein L484_004949                   228   1e-72   Morus notabilis
gb|KFK33320.1|  hypothetical protein AALP_AA6G359700                    236   2e-72   Arabis alpina [alpine rockcress]
ref|XP_006405930.1|  hypothetical protein EUTSA_v10027981mg             224   3e-71   Eutrema salsugineum [saltwater cress]
ref|XP_006481935.1|  PREDICTED: microsomal glutathione S-transfer...    224   4e-71   Citrus sinensis [apfelsine]
gb|KDO57301.1|  hypothetical protein CISIN_1g045836mg                   223   9e-71   Citrus sinensis [apfelsine]
ref|XP_010511506.1|  PREDICTED: microsomal glutathione S-transfer...    222   2e-70   Camelina sativa [gold-of-pleasure]
ref|XP_010415129.1|  PREDICTED: microsomal glutathione S-transfer...    221   3e-70   Camelina sativa [gold-of-pleasure]
gb|KHG13232.1|  Microsomal glutathione S-transferase 3                  221   5e-70   Gossypium arboreum [tree cotton]
ref|XP_010528606.1|  PREDICTED: microsomal glutathione S-transfer...    221   6e-70   Tarenaya hassleriana [spider flower]
ref|XP_006430354.1|  hypothetical protein CICLE_v10013005mg             221   6e-70   Citrus clementina [clementine]
ref|XP_002886976.1|  hypothetical protein ARALYDRAFT_475688             220   1e-69   
gb|KJB22440.1|  hypothetical protein B456_004G047600                    219   2e-69   Gossypium raimondii
ref|XP_010435550.1|  PREDICTED: microsomal glutathione S-transfer...    219   3e-69   Camelina sativa [gold-of-pleasure]
ref|XP_002526194.1|  microsomal glutathione s-transferase, putative     219   4e-69   Ricinus communis
ref|XP_006300565.1|  hypothetical protein CARUB_v10021117mg             219   4e-69   Capsella rubella
ref|XP_010470456.1|  PREDICTED: microsomal glutathione S-transfer...    218   6e-69   
ref|XP_010450477.1|  PREDICTED: microsomal glutathione S-transfer...    218   8e-69   Camelina sativa [gold-of-pleasure]
ref|NP_176758.1|  putative glutathione S-transferase                    217   2e-68   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010675204.1|  PREDICTED: microsomal glutathione S-transfer...    216   6e-68   Beta vulgaris subsp. vulgaris [field beet]
gb|KFK41020.1|  hypothetical protein AALP_AA2G075000                    216   7e-68   Arabis alpina [alpine rockcress]
ref|XP_008460505.1|  PREDICTED: microsomal glutathione S-transfer...    215   1e-67   Cucumis melo [Oriental melon]
ref|XP_009127454.1|  PREDICTED: microsomal glutathione S-transfer...    214   2e-67   Brassica rapa
emb|CDY54440.1|  BnaC02g45560D                                          214   2e-67   Brassica napus [oilseed rape]
ref|XP_010440827.1|  PREDICTED: microsomal glutathione S-transfer...    214   2e-67   Camelina sativa [gold-of-pleasure]
ref|XP_009124156.1|  PREDICTED: microsomal glutathione S-transfer...    213   6e-67   Brassica rapa
ref|XP_006372463.1|  hypothetical protein POPTR_0017s01880g             213   1e-66   
ref|XP_009370540.1|  PREDICTED: microsomal glutathione S-transfer...    212   2e-66   Pyrus x bretschneideri [bai li]
ref|XP_011016135.1|  PREDICTED: microsomal glutathione S-transfer...    213   2e-66   Populus euphratica
ref|XP_011038344.1|  PREDICTED: microsomal glutathione S-transfer...    213   2e-66   Populus euphratica
ref|XP_008381362.1|  PREDICTED: microsomal glutathione S-transfer...    210   7e-66   Malus domestica [apple tree]
gb|KJB10498.1|  hypothetical protein B456_001G204400                    210   8e-66   Gossypium raimondii
ref|XP_010062340.1|  PREDICTED: microsomal glutathione S-transfer...    210   1e-65   Eucalyptus grandis [rose gum]
ref|XP_008371140.1|  PREDICTED: microsomal glutathione S-transfer...    210   1e-65   
ref|XP_004140310.1|  PREDICTED: microsomal glutathione S-transfer...    209   2e-65   Cucumis sativus [cucumbers]
ref|NP_001154451.1|  putative glutathione S-transferase                 207   3e-64   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010246009.1|  PREDICTED: microsomal glutathione S-transfer...    206   4e-64   Nelumbo nucifera [Indian lotus]
emb|CDP21734.1|  unnamed protein product                                205   7e-64   Coffea canephora [robusta coffee]
ref|XP_002273456.1|  PREDICTED: microsomal glutathione S-transfer...    205   8e-64   Vitis vinifera
ref|XP_011469515.1|  PREDICTED: microsomal glutathione S-transfer...    205   1e-63   Fragaria vesca subsp. vesca
gb|AFK34321.1|  unknown                                                 204   2e-63   Lotus japonicus
ref|XP_010243917.1|  PREDICTED: microsomal glutathione S-transfer...    203   5e-63   Nelumbo nucifera [Indian lotus]
ref|XP_004503076.1|  PREDICTED: microsomal glutathione S-transfer...    202   2e-62   Cicer arietinum [garbanzo]
gb|EPS73711.1|  hypothetical protein M569_01049                         200   1e-61   Genlisea aurea
gb|KHG14220.1|  Microsomal glutathione S-transferase 3                  199   1e-61   Gossypium arboreum [tree cotton]
ref|XP_006430355.1|  hypothetical protein CICLE_v10013005mg             199   2e-61   
ref|XP_006285985.1|  hypothetical protein CARUB_v10007513mg             198   3e-61   
gb|AAF23833.1|AC007234_5  F1E22.17                                      197   1e-60   Arabidopsis thaliana [mouse-ear cress]
gb|KDP36366.1|  hypothetical protein JCGZ_09781                         197   2e-60   Jatropha curcas
ref|XP_010246010.1|  PREDICTED: microsomal glutathione S-transfer...    196   2e-60   Nelumbo nucifera [Indian lotus]
ref|XP_004982015.1|  PREDICTED: microsomal glutathione S-transfer...    196   2e-60   Setaria italica
ref|NP_001154452.1|  putative glutathione S-transferase                 197   4e-60   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002464011.1|  hypothetical protein SORBIDRAFT_01g010540          196   4e-60   Sorghum bicolor [broomcorn]
ref|XP_003560791.1|  PREDICTED: microsomal glutathione S-transfer...    194   2e-59   Brachypodium distachyon [annual false brome]
ref|XP_009139711.1|  PREDICTED: microsomal glutathione S-transfer...    194   2e-59   Brassica rapa
ref|XP_009370066.1|  PREDICTED: microsomal glutathione S-transfer...    193   3e-59   Pyrus x bretschneideri [bai li]
ref|NP_001051042.1|  Os03g0709000                                       192   8e-59   
gb|EMS50381.1|  hypothetical protein TRIUR3_16899                       191   5e-58   Triticum urartu
ref|XP_006650477.1|  PREDICTED: microsomal glutathione S-transfer...    190   5e-58   Oryza brachyantha
ref|XP_007018793.1|  Microsomal glutathione S-transferase 3             197   1e-57   
gb|EMS52225.1|  hypothetical protein TRIUR3_05587                       188   3e-57   Triticum urartu
ref|XP_003616133.1|  Microsomal glutathione S-transferase               188   6e-57   Medicago truncatula
gb|ADP02228.1|  putative microsomal glutathione S-transferase 3         187   1e-56   Aegilops tauschii
ref|XP_010926150.1|  PREDICTED: microsomal glutathione S-transfer...    186   2e-56   Elaeis guineensis
ref|XP_008343115.1|  PREDICTED: microsomal glutathione S-transfer...    186   2e-56   
ref|XP_009390358.1|  PREDICTED: microsomal glutathione S-transfer...    186   5e-56   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004982016.1|  PREDICTED: microsomal glutathione S-transfer...    185   9e-56   Setaria italica
ref|XP_003616134.1|  Microsomal glutathione S-transferase               184   2e-55   Medicago truncatula
gb|ADP02227.1|  putative microsomal glutathione S-transferase 3         184   2e-55   Aegilops tauschii
ref|XP_008665261.1|  PREDICTED: uncharacterized protein LOC100216...    183   3e-55   Zea mays [maize]
ref|XP_008229352.1|  PREDICTED: microsomal glutathione S-transfer...    182   8e-55   Prunus mume [ume]
ref|XP_006828419.1|  hypothetical protein AMTR_s00060p00085140          182   8e-55   Amborella trichopoda
ref|XP_008781046.1|  PREDICTED: microsomal glutathione S-transfer...    180   7e-54   Phoenix dactylifera
ref|XP_010926151.1|  PREDICTED: microsomal glutathione S-transfer...    179   1e-53   Elaeis guineensis
ref|XP_008781035.1|  PREDICTED: microsomal glutathione S-transfer...    177   5e-53   Phoenix dactylifera
gb|AII01422.1|  microsomal glutathione S-transferase                    177   1e-52   Zostera marina
gb|ABK23493.1|  unknown                                                 175   4e-52   Picea sitchensis
gb|EYU25640.1|  hypothetical protein MIMGU_mgv1a014345mg                177   5e-52   Erythranthe guttata [common monkey flower]
ref|XP_008774995.1|  PREDICTED: microsomal glutathione S-transfer...    174   9e-52   Phoenix dactylifera
gb|ACG42477.1|  microsomal glutathione S-transferase 3                  173   2e-51   Zea mays [maize]
gb|ADP02229.1|  putative MAPEG family protein                           173   8e-51   Aegilops tauschii
gb|AAX95670.1|  MAPEG family, putative                                  173   1e-50   Oryza sativa Japonica Group [Japonica rice]
ref|XP_010916150.1|  PREDICTED: microsomal glutathione S-transfer...    171   3e-50   Elaeis guineensis
ref|XP_009380081.1|  PREDICTED: microsomal glutathione S-transfer...    170   5e-50   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50382.1|  hypothetical protein TRIUR3_16900                       171   6e-50   Triticum urartu
ref|NP_001136697.1|  uncharacterized protein LOC100216831               167   3e-49   Zea mays [maize]
ref|XP_002464012.1|  hypothetical protein SORBIDRAFT_01g010550          162   4e-47   Sorghum bicolor [broomcorn]
ref|XP_007215117.1|  hypothetical protein PRUPE_ppa012959mg             162   6e-47   Prunus persica
ref|XP_002970319.1|  hypothetical protein SELMODRAFT_147110             158   1e-45   Selaginella moellendorffii
ref|XP_002978482.1|  hypothetical protein SELMODRAFT_271320             158   2e-45   Selaginella moellendorffii
ref|XP_008353856.1|  PREDICTED: microsomal glutathione S-transfer...    155   6e-45   
ref|XP_001774813.1|  predicted protein                                  151   8e-43   
gb|EYU25641.1|  hypothetical protein MIMGU_mgv1a014345mg                147   1e-40   Erythranthe guttata [common monkey flower]
gb|ADU33211.1|  microsomal glutathione S-transferase 3                  142   3e-39   Pinctada imbricata
ref|XP_001784409.1|  predicted protein                                  141   7e-39   
gb|ACL54043.1|  unknown                                                 135   7e-37   Zea mays [maize]
gb|AET43969.1|  microsomal GST3                                         135   1e-36   Reishia clavigera
gb|ELU09634.1|  hypothetical protein CAPTEDRAFT_202245                  133   1e-35   Capitella teleta
ref|XP_011418120.1|  PREDICTED: microsomal glutathione S-transfer...    133   1e-35   Crassostrea gigas
ref|XP_011418119.1|  PREDICTED: microsomal glutathione S-transfer...    132   4e-35   Crassostrea gigas
ref|XP_001774848.1|  predicted protein                                  128   9e-34   
gb|KDO34209.1|  hypothetical protein SPRG_01432                         127   3e-33   Saprolegnia parasitica CBS 223.65
ref|XP_002112701.1|  expressed hypothetical protein                     125   7e-33   Trichoplax adhaerens
ref|XP_009862173.1|  PREDICTED: microsomal glutathione S-transfer...    126   4e-32   Ciona intestinalis [sea vase]
ref|XP_011449765.1|  PREDICTED: microsomal glutathione S-transfer...    124   5e-32   Crassostrea gigas
gb|EFX85348.1|  hypothetical protein DAPPUDRAFT_230545                  123   6e-32   Daphnia pulex
ref|XP_793267.2|  PREDICTED: microsomal glutathione S-transferase...    124   7e-32   Strongylocentrotus purpuratus [purple urchin]
ref|XP_010877546.1|  PREDICTED: microsomal glutathione S-transfer...    123   7e-32   Esox lucius
ref|XP_009053884.1|  hypothetical protein LOTGIDRAFT_232059             122   1e-31   Lottia gigantea
gb|ABD67515.1|  microsomal glutathione S-transferase 3                  121   4e-31   Cyprinus carpio [carp]
ref|XP_005649780.1|  glutathione S-transferase                          121   5e-31   Coccomyxa subellipsoidea C-169
ref|XP_001744478.1|  hypothetical protein                               121   6e-31   Monosiga brevicollis MX1
gb|KIY95910.1|  glutathione S-transferase                               124   7e-31   Monoraphidium neglectum
gb|ACI67512.1|  Microsomal glutathione S-transferase 3                  120   1e-30   Salmo salar
ref|NP_001039212.1|  microsomal glutathione S-transferase 3-like        120   1e-30   Xenopus tropicalis [western clawed frog]
gb|ACO07591.1|  Microsomal glutathione S-transferase 3                  120   1e-30   Oncorhynchus mykiss
ref|XP_005830329.1|  hypothetical protein GUITHDRAFT_110766             120   1e-30   Guillardia theta CCMP2712
ref|XP_005706127.1|  glutathione S-transferase                          120   2e-30   Galdieria sulphuraria
gb|ACO07847.1|  Microsomal glutathione S-transferase 3                  119   2e-30   Oncorhynchus mykiss
gb|ACO08774.1|  Microsomal glutathione S-transferase 3                  119   2e-30   Oncorhynchus mykiss
ref|NP_001006890.1|  microsomal glutathione S-transferase 3             119   2e-30   Xenopus tropicalis [western clawed frog]
gb|ACI68823.1|  Microsomal glutathione S-transferase 3                  119   2e-30   Salmo salar
gb|ELU09829.1|  hypothetical protein CAPTEDRAFT_172925                  120   2e-30   Capitella teleta
ref|XP_003468711.1|  PREDICTED: microsomal glutathione S-transfer...    119   2e-30   Cavia porcellus [guinea pig]
emb|CEP15667.1|  hypothetical protein                                   119   2e-30   Parasitella parasitica
ref|XP_007238632.1|  PREDICTED: microsomal glutathione S-transfer...    119   2e-30   Astyanax mexicanus [blind cave fish]
ref|XP_004994659.1|  microsomal glutathione S-transferase 3             119   3e-30   Salpingoeca rosetta
ref|NP_001091371.1|  uncharacterized protein LOC100037213               119   4e-30   Xenopus laevis [clawed frog]
ref|NP_001073503.1|  microsomal glutathione S-transferase-like          118   4e-30   Danio rerio [leopard danio]
gb|ADO28117.1|  microsomal glutathione S-transferase 3                  118   6e-30   Ictalurus furcatus
ref|XP_003446236.1|  PREDICTED: microsomal glutathione S-transfer...    117   9e-30   Oreochromis niloticus
ref|XP_005922361.1|  PREDICTED: microsomal glutathione S-transfer...    117   9e-30   Haplochromis burtoni
gb|AII16517.1|  microsomal glutathione S-transferase 3                  117   1e-29   Paracyclopina nana
ref|XP_007554970.1|  PREDICTED: microsomal glutathione S-transfer...    117   2e-29   Poecilia formosa
ref|XP_009022538.1|  hypothetical protein HELRODRAFT_67163              117   2e-29   Helobdella robusta
emb|CDS12800.1|  hypothetical protein LRAMOSA04984                      117   2e-29   Lichtheimia ramosa
ref|XP_004566633.1|  PREDICTED: microsomal glutathione S-transfer...    116   3e-29   Maylandia zebra
ref|XP_006631304.1|  PREDICTED: microsomal glutathione S-transfer...    116   3e-29   Lepisosteus oculatus
gb|ADY80023.1|  microsomal glutathione S-transferase 3                  116   3e-29   Oplegnathus fasciatus [striped knifejaw]
ref|XP_005319914.1|  PREDICTED: microsomal glutathione S-transfer...    116   4e-29   Ictidomys tridecemlineatus
gb|KFO29097.1|  Microsomal glutathione S-transferase 3                  117   4e-29   Fukomys damarensis [Damara mole rat]
ref|XP_009841585.1|  hypothetical protein, variant 1                    116   4e-29   Aphanomyces astaci
ref|XP_010729611.1|  PREDICTED: microsomal glutathione S-transfer...    116   4e-29   Larimichthys crocea [croceine croaker]
ref|NP_001086335.1|  microsomal glutathione S-transferase 3             116   4e-29   Xenopus laevis [clawed frog]
dbj|BAJ14113.1|  microsomal glutathione S-transferase                   116   4e-29   Danio rerio [leopard danio]
gb|AGN29624.1|  microsomal glutathione s-transferase                    115   5e-29   Acartia pacifica
gb|ELK16331.1|  Microsomal glutathione S-transferase 3                  118   5e-29   Pteropus alecto
ref|NP_998592.1|  microsomal glutathione S-transferase 3                116   5e-29   Danio rerio [leopard danio]
ref|XP_011399061.1|  Microsomal glutathione S-transferase 3             115   5e-29   Auxenochlorella protothecoides
ref|XP_005398303.1|  PREDICTED: LOW QUALITY PROTEIN: microsomal g...    116   6e-29   
ref|XP_006907897.1|  PREDICTED: microsomal glutathione S-transfer...    116   6e-29   Pteropus alecto
ref|XP_010632228.1|  PREDICTED: microsomal glutathione S-transfer...    115   6e-29   Fukomys damarensis [Damara mole rat]
dbj|BAB25726.1|  unnamed protein product                                115   7e-29   Mus musculus [mouse]
ref|XP_004878618.1|  PREDICTED: microsomal glutathione S-transfer...    116   7e-29   
ref|NP_079845.1|  microsomal glutathione S-transferase 3                115   7e-29   Mus musculus [mouse]
ref|XP_004613932.1|  PREDICTED: microsomal glutathione S-transfer...    115   7e-29   Sorex araneus [Eurasian shrew]
ref|XP_007259553.1|  PREDICTED: microsomal glutathione S-transfer...    115   9e-29   
gb|AEW46329.1|  microsomal glutathione S-transferase                    115   1e-28   Ruditapes philippinarum [Japanese littleneck]
ref|XP_006983299.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Peromyscus maniculatus bairdii
ref|XP_006635365.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Lepisosteus oculatus
ref|XP_004639931.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Octodon degus
ref|XP_003785795.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Otolemur garnettii
ref|XP_008846451.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Nannospalax galili
gb|AHC08054.1|  micorsomal glutathione S-transferase                    115   1e-28   Locusta migratoria
ref|XP_010795718.1|  PREDICTED: microsomal glutathione S-transfer...    115   1e-28   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_009529468.1|  hypothetical protein PHYSODRAFT_286365             114   1e-28   Phytophthora sojae
ref|XP_003962459.1|  PREDICTED: microsomal glutathione S-transfer...    114   2e-28   Takifugu rubripes [tiger puffer]
ref|NP_001075607.1|  microsomal glutathione S-transferase 3             114   2e-28   Oryctolagus cuniculus [domestic rabbit]
ref|XP_008576906.1|  PREDICTED: microsomal glutathione S-transfer...    114   2e-28   Galeopterus variegatus [Malayan flying lemur]
ref|XP_002760486.1|  PREDICTED: microsomal glutathione S-transfer...    114   2e-28   Callithrix jacchus [common marmoset]
ref|XP_005372113.1|  PREDICTED: microsomal glutathione S-transfer...    114   2e-28   Microtus ochrogaster [prairie voles]
ref|XP_004589200.1|  PREDICTED: microsomal glutathione S-transfer...    114   2e-28   Ochotona princeps [southern American pika]
ref|XP_008683924.1|  PREDICTED: microsomal glutathione S-transfer...    115   2e-28   Ursus maritimus [white bear]
emb|CDH60086.1|  microsomal glutathione s-transferase 3                 114   2e-28   Lichtheimia corymbifera JMRC:FSU:9682
ref|NP_001178523.1|  microsomal glutathione S-transferase 3             114   3e-28   Rattus norvegicus [brown rat]
gb|EFX85347.1|  hypothetical protein DAPPUDRAFT_230544                  114   3e-28   Daphnia pulex
ref|XP_004652006.1|  PREDICTED: microsomal glutathione S-transfer...    114   3e-28   Jaculus jaculus
ref|XP_003767426.1|  PREDICTED: microsomal glutathione S-transfer...    114   3e-28   Sarcophilus harrisii
ref|XP_008983355.1|  PREDICTED: microsomal glutathione S-transfer...    114   3e-28   
ref|NP_001088717.1|  uncharacterized protein LOC495981                  114   4e-28   Xenopus laevis [clawed frog]
gb|EFB24445.1|  hypothetical protein PANDA_002087                       114   4e-28   Ailuropoda melanoleuca
emb|CEG73141.1|  hypothetical protein RMATCC62417_08578                 113   5e-28   Rhizopus microsporus
gb|KFP84390.1|  Microsomal glutathione S-transferase 3                  113   5e-28   Apaloderma vittatum
gb|AAX61154.1|  microsomal glutathione S-transferase                    113   5e-28   Oreochromis mossambicus [Hawaiian perch]
ref|XP_009863060.1|  PREDICTED: microsomal glutathione S-transfer...    113   6e-28   Apaloderma vittatum
dbj|GAN09788.1|  conserved hypothetical protein                         113   6e-28   Mucor ambiguus
ref|XP_005071470.1|  PREDICTED: microsomal glutathione S-transfer...    113   7e-28   Mesocricetus auratus [Syrian golden hamster]
ref|XP_008290628.1|  PREDICTED: microsomal glutathione S-transfer...    113   7e-28   Stegastes partitus
ref|XP_003928123.1|  PREDICTED: microsomal glutathione S-transfer...    113   8e-28   Saimiri boliviensis boliviensis
ref|XP_004408401.1|  PREDICTED: microsomal glutathione S-transfer...    113   8e-28   Odobenus rosmarus divergens
gb|EPB91144.1|  hypothetical protein HMPREF1544_02024                   112   8e-28   Mucor circinelloides f. circinelloides 1006PhL
ref|XP_009841584.1|  hypothetical protein, variant 2                    112   8e-28   Aphanomyces astaci
gb|EPQ16607.1|  Microsomal glutathione S-transferase 3                  113   9e-28   Myotis brandtii
ref|XP_003415079.1|  PREDICTED: microsomal glutathione S-transfer...    112   9e-28   Loxodonta africana [African bush elephant]
ref|XP_004082441.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Oryzias latipes [Japanese rice fish]
ref|XP_008431445.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Poecilia reticulata
ref|XP_003453417.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Oreochromis niloticus
ref|XP_008683925.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Ursus maritimus [white bear]
ref|XP_002909151.1|  conserved hypothetical protein                     112   1e-27   Phytophthora infestans T30-4
ref|XP_006742057.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Leptonychotes weddellii
ref|XP_006142318.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Tupaia chinensis
ref|XP_002914220.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   
ref|XP_003505590.1|  PREDICTED: microsomal glutathione S-transfer...    112   1e-27   Cricetulus griseus [Chinese hamsters]
ref|XP_005880551.1|  PREDICTED: microsomal glutathione S-transfer...    112   2e-27   Myotis brandtii
ref|XP_004688473.1|  PREDICTED: microsomal glutathione S-transfer...    112   2e-27   Condylura cristata
ref|NP_001239339.1|  microsomal glutathione S-transferase 3             112   2e-27   Canis lupus familiaris [dogs]
gb|ABV24052.1|  gluthathione S-transferase mapeg                        111   2e-27   Takifugu obscurus [obscure pufferfish]
gb|ABW88889.1|  microsomal glutathione S-transferase                    111   2e-27   Kryptolebias marmoratus [matanzas rivulus]
ref|XP_009053885.1|  hypothetical protein LOTGIDRAFT_116903             111   2e-27   Lottia gigantea
ref|XP_010782182.1|  PREDICTED: microsomal glutathione S-transfer...    111   2e-27   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_007935935.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Orycteropus afer afer
gb|ACQ58742.1|  Microsomal glutathione S-transferase 3                  111   3e-27   Anoplopoma fimbria
ref|XP_003999582.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Felis catus [cat]
ref|XP_006104753.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Myotis lucifugus
ref|XP_004454726.1|  PREDICTED: microsomal glutathione S-transfer...    112   3e-27   
ref|NP_001038021.1|  microsomal glutathione S-transferase 3             111   3e-27   Sus scrofa [pigs]
ref|NP_001264462.1|  microsomal glutathione S-transferase 3             111   3e-27   Gallus gallus [bantam]
gb|EIE78695.1|  hypothetical protein RO3G_03399                         111   3e-27   Rhizopus delemar RA 99-880
ref|XP_006887439.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_001493558.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Equus caballus [domestic horse]
ref|XP_007538725.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Erinaceus europaeus [common hedgehog]
ref|XP_004706818.1|  PREDICTED: microsomal glutathione S-transfer...    111   3e-27   Echinops telfairi [lesser hedgehog tenrec]
gb|KFP33177.1|  Microsomal glutathione S-transferase 3                  110   4e-27   Colius striatus
ref|XP_002414188.1|  microsomal glutathione S-transferase, putative     111   4e-27   Ixodes scapularis [blacklegged tick]
ref|XP_002809897.1|  PREDICTED: microsomal glutathione S-transfer...    111   4e-27   
ref|XP_010203778.1|  PREDICTED: microsomal glutathione S-transfer...    110   4e-27   Colius striatus
ref|XP_006775051.1|  PREDICTED: microsomal glutathione S-transfer...    111   4e-27   Myotis davidii
ref|NP_001253710.1|  microsomal glutathione S-transferase 3             111   5e-27   Macaca mulatta [rhesus macaque]
ref|XP_009059955.1|  hypothetical protein LOTGIDRAFT_209813             110   5e-27   Lottia gigantea
ref|XP_005846439.1|  hypothetical protein CHLNCDRAFT_135580             112   5e-27   Chlorella variabilis
ref|NP_001272544.1|  microsomal glutathione S-transferase 3             110   5e-27   Capra hircus [domestic goat]
ref|XP_008932155.1|  PREDICTED: microsomal glutathione S-transfer...    110   6e-27   
gb|KFW76310.1|  Microsomal glutathione S-transferase 3                  110   6e-27   Manacus vitellinus
ref|XP_004282094.1|  PREDICTED: microsomal glutathione S-transfer...    110   6e-27   Orcinus orca [Orca]
gb|ACQ58232.1|  Microsomal glutathione S-transferase 3                  110   6e-27   Anoplopoma fimbria
ref|XP_007360611.1|  membrane-associated proteins in eicosanoid a...    110   6e-27   Dichomitus squalens LYAD-421 SS1
ref|XP_006175993.1|  PREDICTED: microsomal glutathione S-transfer...    110   6e-27   Camelus ferus
ref|XP_009671061.1|  PREDICTED: microsomal glutathione S-transfer...    110   6e-27   Struthio camelus australis
gb|KFV80109.1|  Microsomal glutathione S-transferase 3                  110   6e-27   Struthio camelus australis
ref|XP_005994840.1|  PREDICTED: microsomal glutathione S-transfer...    110   7e-27   Latimeria chalumnae
ref|XP_005984246.1|  PREDICTED: microsomal glutathione S-transfer...    110   7e-27   Pantholops hodgsonii [Tibetan antelope]
emb|CBJ28851.1|  microsomal Glutathione S-transferase                   110   8e-27   Ectocarpus siliculosus
gb|EHH15773.1|  hypothetical protein EGK_01909                          110   8e-27   Macaca mulatta [rhesus macaque]
ref|XP_005984245.1|  PREDICTED: microsomal glutathione S-transfer...    110   8e-27   Pantholops hodgsonii [Tibetan antelope]
ref|XP_009191152.1|  PREDICTED: microsomal glutathione S-transfer...    110   9e-27   Papio anubis [baboon]
ref|XP_009510846.1|  PREDICTED: microsomal glutathione S-transfer...    110   9e-27   Phalacrocorax carbo [common cormorant]
ref|XP_006209088.1|  PREDICTED: microsomal glutathione S-transfer...    110   9e-27   Vicugna pacos
ref|XP_001873985.1|  predicted protein                                  109   9e-27   Laccaria bicolor S238N-H82
ref|XP_007457455.1|  PREDICTED: microsomal glutathione S-transfer...    110   9e-27   Lipotes vexillifer [baiji]
ref|XP_007129022.1|  PREDICTED: microsomal glutathione S-transfer...    110   1e-26   Physeter catodon
ref|XP_006678097.1|  hypothetical protein BATDEDRAFT_87817              110   1e-26   Batrachochytrium dendrobatidis JAM81
ref|XP_005304317.1|  PREDICTED: microsomal glutathione S-transfer...    110   1e-26   Chrysemys picta bellii
ref|XP_003893541.1|  PREDICTED: microsomal glutathione S-transfer...    110   1e-26   Papio anubis [baboon]
emb|CEI94874.1|  hypothetical protein RMCBS344292_09078                 109   1e-26   Rhizopus microsporus
ref|XP_006040007.1|  PREDICTED: microsomal glutathione S-transfer...    110   1e-26   
gb|KFW64794.1|  Microsomal glutathione S-transferase 3                  109   1e-26   Pygoscelis adeliae
gb|ELR61546.1|  Microsomal glutathione S-transferase 3                  110   1e-26   Bos mutus
ref|NP_001030218.1|  microsomal glutathione S-transferase 3             110   1e-26   Bos taurus [bovine]
ref|XP_007191139.1|  PREDICTED: microsomal glutathione S-transfer...    110   1e-26   Balaenoptera acutorostrata scammoni
ref|XP_009318903.1|  PREDICTED: microsomal glutathione S-transfer...    109   1e-26   Pygoscelis adeliae
gb|ADY80022.1|  microsomal glutathione S-transferase 2                  110   1e-26   Oplegnathus fasciatus [striped knifejaw]
gb|ETS65230.1|  hypothetical protein PaG_00300                          117   1e-26   Moesziomyces aphidis DSM 70725
gb|EFX85346.1|  hypothetical protein DAPPUDRAFT_300290                  110   1e-26   Daphnia pulex
ref|NP_001188192.1|  microsomal glutathione S-transferase 3             109   1e-26   Ictalurus punctatus
ref|XP_010371669.1|  PREDICTED: microsomal glutathione S-transfer...    109   1e-26   Rhinopithecus roxellana
ref|XP_001363682.1|  PREDICTED: microsomal glutathione S-transfer...    109   1e-26   Monodelphis domestica
ref|XP_005539903.1|  PREDICTED: microsomal glutathione S-transfer...    111   2e-26   
ref|NP_001232611.1|  microsomal glutathione S-transferase 3             109   2e-26   Taeniopygia guttata
ref|XP_008151325.1|  PREDICTED: microsomal glutathione S-transfer...    109   2e-26   Eptesicus fuscus
gb|KDN53469.1|  MAPEG-domain-containing protein                         112   2e-26   Tilletiaria anomala UBC 951
ref|XP_008628387.1|  PREDICTED: microsomal glutathione S-transfer...    109   2e-26   Corvus brachyrhynchos
emb|CDH53416.1|  microsomal glutathione s-transferase 3-likeprotein     109   2e-26   Lichtheimia corymbifera JMRC:FSU:9682
gb|ACO09066.1|  Microsomal glutathione S-transferase 3                  109   2e-26   Osmerus mordax
gb|KFP35842.1|  Microsomal glutathione S-transferase 3                  108   2e-26   
emb|CAG09920.1|  unnamed protein product                                108   2e-26   
ref|XP_007767269.1|  membrane-associated proteins in eicosanoid a...    109   2e-26   
dbj|GAK67043.1|  membrane-associated proteins in eicosanoid and g...    110   2e-26   
ref|XP_003258845.1|  PREDICTED: microsomal glutathione S-transfer...    109   2e-26   
ref|XP_006057350.1|  PREDICTED: microsomal glutathione S-transfer...    109   2e-26   
ref|XP_010117286.1|  PREDICTED: microsomal glutathione S-transfer...    108   3e-26   
gb|ACO07904.1|  Microsomal glutathione S-transferase 3                  108   3e-26   
gb|KFM81199.1|  Microsomal glutathione S-transferase 3                  108   3e-26   
ref|XP_005815536.1|  PREDICTED: microsomal glutathione S-transfer...    109   3e-26   
ref|XP_004751495.1|  PREDICTED: microsomal glutathione S-transfer...    108   3e-26   
gb|KDQ08884.1|  hypothetical protein BOTBODRAFT_37580                   108   3e-26   
gb|ACO08322.1|  Microsomal glutathione S-transferase 3                  109   3e-26   
ref|XP_008069277.1|  PREDICTED: microsomal glutathione S-transfer...    108   4e-26   
ref|XP_004079030.1|  PREDICTED: microsomal glutathione S-transfer...    108   4e-26   
emb|CDS12228.1|  hypothetical protein LRAMOSA04423                      108   4e-26   
ref|XP_004385822.1|  PREDICTED: microsomal glutathione S-transfer...    108   4e-26   
gb|KFU93147.1|  Microsomal glutathione S-transferase 3                  108   5e-26   
ref|XP_002112699.1|  hypothetical protein TRIADDRAFT_56988              108   5e-26   
ref|XP_010000641.1|  PREDICTED: microsomal glutathione S-transfer...    108   5e-26   
dbj|BAD96732.1|  microsomal glutathione S-transferase 3 variant         108   6e-26   
ref|XP_010137649.1|  PREDICTED: microsomal glutathione S-transfer...    108   6e-26   
ref|XP_006876046.1|  PREDICTED: microsomal glutathione S-transfer...    108   6e-26   
ref|XP_004424904.1|  PREDICTED: microsomal glutathione S-transfer...    108   6e-26   
ref|XP_001174626.1|  PREDICTED: microsomal glutathione S-transfer...    108   6e-26   
ref|XP_010083547.1|  PREDICTED: microsomal glutathione S-transfer...    107   7e-26   
gb|KFV04216.1|  Microsomal glutathione S-transferase 3                  107   7e-26   
gb|KFO75378.1|  Microsomal glutathione S-transferase 3                  107   7e-26   
ref|XP_007061296.1|  PREDICTED: microsomal glutathione S-transfer...    107   8e-26   
gb|ACN10003.1|  Microsomal glutathione S-transferase 3                  107   8e-26   
ref|XP_009558145.1|  PREDICTED: microsomal glutathione S-transfer...    107   8e-26   
ref|NP_004519.1|  microsomal glutathione S-transferase 3                107   8e-26   
gb|KEP55337.1|  microsomal glutathione S-transferase                    107   8e-26   
ref|XP_009096684.1|  PREDICTED: microsomal glutathione S-transfer...    107   9e-26   
ref|XP_004483034.1|  PREDICTED: microsomal glutathione S-transfer...    107   9e-26   
ref|XP_007880983.1|  hypothetical protein PFL1_05265                    108   9e-26   
emb|CCG82295.1|  Putative uncharacterized protein                       107   1e-25   
ref|XP_010224296.1|  PREDICTED: microsomal glutathione S-transfer...    107   1e-25   
ref|XP_006017784.1|  PREDICTED: microsomal glutathione S-transfer...    107   1e-25   
gb|KGL85041.1|  Microsomal glutathione S-transferase 3                  107   1e-25   
dbj|GAC75605.1|  hypothetical protein PANT_16c00065                     108   1e-25   
ref|XP_009948161.1|  PREDICTED: microsomal glutathione S-transfer...    107   1e-25   
ref|XP_010186103.1|  PREDICTED: microsomal glutathione S-transfer...    107   1e-25   
gb|KFV13244.1|  Microsomal glutathione S-transferase 3                  107   1e-25   
ref|XP_009063466.1|  hypothetical protein LOTGIDRAFT_235705             106   1e-25   
gb|ACO08609.1|  Microsomal glutathione S-transferase 3                  107   1e-25   
ref|XP_008032343.1|  membrane-associated proteins in eicosanoid a...    107   1e-25   
ref|XP_005245231.1|  PREDICTED: microsomal glutathione S-transfer...    107   1e-25   
ref|XP_008976502.1|  PREDICTED: LOW QUALITY PROTEIN: microsomal g...    107   2e-25   
ref|XP_003976141.1|  PREDICTED: microsomal glutathione S-transfer...    107   2e-25   
gb|ACO08637.1|  Microsomal glutathione S-transferase 3                  107   2e-25   
ref|XP_001829108.1|  hypothetical protein CC1G_01788                    107   2e-25   
ref|XP_009577808.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
ref|XP_007574665.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
gb|KFW06415.1|  Microsomal glutathione S-transferase 3                  106   2e-25   
ref|XP_009979871.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
gb|AFM90107.1|  microsomal glutathione S-transferase 3-like protein     106   2e-25   
gb|AFK10927.1|  microsomal glutathione S-transferase 3-like protein     107   2e-25   
gb|AFM86679.1|  microsomal glutathione S-transferase 3-like protein     106   2e-25   
ref|XP_010714049.1|  PREDICTED: microsomal glutathione S-transfer...    107   2e-25   
ref|XP_009915332.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
ref|XP_009701176.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
gb|AFM87140.1|  microsomal glutathione S-transferase 3-like protein     106   2e-25   
gb|KFP96422.1|  Microsomal glutathione S-transferase 3                  106   2e-25   
ref|XP_005241294.1|  PREDICTED: microsomal glutathione S-transfer...    106   2e-25   
ref|XP_009271559.1|  PREDICTED: microsomal glutathione S-transfer...    106   3e-25   
ref|NP_001279031.1|  microsomal glutathione S-transferase 3             106   3e-25   
gb|KFM03465.1|  Microsomal glutathione S-transferase 3                  106   3e-25   
ref|XP_007433354.1|  PREDICTED: microsomal glutathione S-transfer...    106   3e-25   
gb|KIK07509.1|  hypothetical protein K443DRAFT_86971                    105   3e-25   
emb|CDQ69365.1|  unnamed protein product                                107   3e-25   
ref|XP_005147125.1|  PREDICTED: microsomal glutathione S-transfer...    106   3e-25   
ref|XP_010714048.1|  PREDICTED: microsomal glutathione S-transfer...    105   3e-25   
ref|XP_006017785.1|  PREDICTED: microsomal glutathione S-transfer...    106   3e-25   
ref|XP_007893829.1|  PREDICTED: microsomal glutathione S-transfer...    106   4e-25   
ref|NP_001290756.1|  microsomal glutathione S-transferase 3             106   4e-25   
gb|EUC66425.1|  microsomal glutathione S-transferase, putative          106   4e-25   
gb|KIM49638.1|  hypothetical protein M413DRAFT_113166                   106   4e-25   
gb|EMP34520.1|  Microsomal glutathione S-transferase 3                  108   4e-25   
ref|XP_006139434.1|  PREDICTED: microsomal glutathione S-transfer...    105   4e-25   
gb|AFM86067.1|  microsomal glutathione S-transferase 3-like protein     105   5e-25   
ref|XP_010888456.1|  PREDICTED: microsomal glutathione S-transfer...    105   5e-25   
gb|ACM09138.1|  Microsomal glutathione S-transferase 3                  105   6e-25   
ref|XP_009812831.1|  PREDICTED: microsomal glutathione S-transfer...    105   6e-25   
gb|ACI67127.1|  Microsomal glutathione S-transferase 3                  105   6e-25   
gb|KFO03444.1|  Microsomal glutathione S-transferase 3                  105   7e-25   
ref|XP_010714047.1|  PREDICTED: microsomal glutathione S-transfer...    105   7e-25   
ref|XP_008863334.1|  hypothetical protein H310_01806                    105   7e-25   
ref|XP_010310511.1|  PREDICTED: microsomal glutathione S-transfer...    105   7e-25   
gb|KFV55508.1|  Microsomal glutathione S-transferase 3                  105   7e-25   
ref|XP_009891133.1|  PREDICTED: microsomal glutathione S-transfer...    105   7e-25   
ref|XP_005430931.1|  PREDICTED: microsomal glutathione S-transfer...    105   7e-25   
gb|KGL99552.1|  Microsomal glutathione S-transferase 3                  105   7e-25   
ref|XP_002909152.1|  conserved hypothetical protein                     105   7e-25   
gb|AFM86574.1|  microsomal glutathione S-transferase 3-like protein     105   8e-25   
gb|KIZ01433.1|  hypothetical protein MNEG_6530                          105   8e-25   
ref|XP_011449764.1|  PREDICTED: microsomal glutathione S-transfer...    104   9e-25   
gb|AFM87167.1|  microsomal glutathione S-transferase 3-like protein     105   9e-25   
gb|KDQ08883.1|  hypothetical protein BOTBODRAFT_191497                  105   9e-25   
gb|AFM87126.1|  microsomal glutathione S-transferase 3-like protein     104   1e-24   
gb|ACO07454.1|  Microsomal glutathione S-transferase 3                  104   1e-24   
ref|XP_005492312.1|  PREDICTED: microsomal glutathione S-transfer...    104   1e-24   
gb|ACO07685.1|  Microsomal glutathione S-transferase 3                  103   1e-24   
ref|XP_009643594.1|  PREDICTED: microsomal glutathione S-transfer...    104   1e-24   
emb|CCF50363.1|  related to glutathione s-transferase 3                 105   1e-24   
gb|KFP21330.1|  Microsomal glutathione S-transferase 3                  104   1e-24   
gb|ACO08613.1|  Microsomal glutathione S-transferase 3                  105   1e-24   
gb|KDQ08886.1|  hypothetical protein BOTBODRAFT_59094                   104   1e-24   
emb|CCL98078.1|  predicted protein                                      104   2e-24   
emb|CCD79728.1|  Microsomal GST-3                                       104   2e-24   
ref|XP_005499016.1|  PREDICTED: microsomal glutathione S-transfer...    104   2e-24   
ref|XP_009483871.1|  PREDICTED: microsomal glutathione S-transfer...    103   2e-24   
gb|AIW65540.1|  microsomal glutathione S-transferase                    103   2e-24   
ref|XP_001636741.1|  predicted protein                                  103   2e-24   
emb|CCO31896.1|  hypothetical protein BN14_05947                        104   2e-24   
ref|XP_007902447.1|  PREDICTED: microsomal glutathione S-transfer...    104   2e-24   
gb|KFQ62579.1|  Microsomal glutathione S-transferase 3                  103   2e-24   
gb|KIM70367.1|  hypothetical protein SCLCIDRAFT_1207707                 103   2e-24   
ref|XP_010171085.1|  PREDICTED: microsomal glutathione S-transfer...    103   2e-24   
gb|KFZ62982.1|  Microsomal glutathione S-transferase 3                  103   2e-24   
ref|XP_009077554.1|  PREDICTED: microsomal glutathione S-transfer...    103   2e-24   
gb|KFP84996.1|  Microsomal glutathione S-transferase 3                  103   2e-24   
gb|KFQ22864.1|  Microsomal glutathione S-transferase 3                  103   3e-24   
gb|ESA00410.1|  hypothetical protein GLOINDRAFT_338554                  103   3e-24   
ref|XP_008944449.1|  PREDICTED: microsomal glutathione S-transfer...    103   3e-24   
ref|XP_005528740.1|  PREDICTED: microsomal glutathione S-transfer...    103   3e-24   
ref|XP_002156920.2|  PREDICTED: microsomal glutathione S-transfer...    102   3e-24   
ref|XP_002739172.1|  PREDICTED: microsomal glutathione S-transfer...    103   3e-24   
ref|XP_008901377.1|  hypothetical protein PPTG_08195                    103   4e-24   
gb|KFQ46378.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
gb|ACI69230.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
ref|XP_010294061.1|  PREDICTED: microsomal glutathione S-transfer...    103   4e-24   
gb|KFV44060.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
ref|XP_010008581.1|  PREDICTED: microsomal glutathione S-transfer...    103   4e-24   
ref|XP_003226766.2|  PREDICTED: microsomal glutathione S-transfer...    103   4e-24   
gb|EOA95246.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
ref|XP_009974081.1|  PREDICTED: microsomal glutathione S-transfer...    103   4e-24   
gb|KFQ69928.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
ref|XP_007860897.1|  membrane-associated proteins in eicosanoid a...    103   4e-24   
gb|KFP56426.1|  Microsomal glutathione S-transferase 3                  103   4e-24   
gb|KFV68462.1|  Microsomal glutathione S-transferase 3                  103   5e-24   
gb|EST08363.1|  hypothetical protein PSEUBRA_SCAF17g04369               103   5e-24   
ref|XP_007860457.1|  membrane-associated proteins in eicosanoid a...    103   5e-24   
ref|XP_009900308.1|  PREDICTED: microsomal glutathione S-transfer...    103   5e-24   
ref|XP_009460769.1|  PREDICTED: microsomal glutathione S-transfer...    102   5e-24   
ref|XP_008397828.1|  PREDICTED: microsomal glutathione S-transfer...    103   5e-24   
gb|KFQ94983.1|  Microsomal glutathione S-transferase 3                  102   6e-24   
gb|AFM87235.1|  microsomal glutathione S-transferase 3-like protein     102   9e-24   
gb|KDQ63337.1|  hypothetical protein JAAARDRAFT_29357                   102   9e-24   
gb|ACE81249.1|  microsomal glutathione S-transferase 3                  102   1e-23   
emb|CBJ28850.1|  microsomal Glutathione S-transferase                   102   1e-23   
ref|XP_009937586.1|  PREDICTED: microsomal glutathione S-transfer...    102   1e-23   
gb|ETI52771.1|  hypothetical protein F443_04171                         102   1e-23   
gb|KFR14448.1|  Microsomal glutathione S-transferase 3                  102   1e-23   
gb|KFH73615.1|  hypothetical protein MVEG_00830                         102   1e-23   
ref|XP_008335788.1|  PREDICTED: microsomal glutathione S-transfer...    102   1e-23   
gb|EWC47398.1|  hypothetical protein DRE_00366                          102   1e-23   
ref|XP_009270005.1|  Microsomal glutathione S-transferase 3             102   1e-23   
gb|KIJ56966.1|  hypothetical protein M422DRAFT_773698                   102   2e-23   
ref|XP_008901378.1|  hypothetical protein PPTG_08196                    101   2e-23   
gb|KIJ09631.1|  hypothetical protein PAXINDRAFT_172428                  101   2e-23   
gb|KDE04293.1|  hypothetical protein MVLG_05251                         101   2e-23   
ref|XP_005835605.1|  hypothetical protein GUITHDRAFT_136717             101   2e-23   
ref|XP_005028228.1|  PREDICTED: microsomal glutathione S-transfer...    102   2e-23   
gb|KFQ79697.1|  Microsomal glutathione S-transferase 3                  101   2e-23   
ref|XP_008498128.1|  PREDICTED: microsomal glutathione S-transfer...    101   2e-23   
gb|KFP05530.1|  Microsomal glutathione S-transferase 3                  100   2e-23   
ref|XP_009841587.1|  hypothetical protein H257_15255                    100   3e-23   
gb|EIE90138.1|  hypothetical protein RO3G_14849                         100   3e-23   
gb|KIK37117.1|  hypothetical protein CY34DRAFT_810652                   100   4e-23   
ref|XP_003226765.2|  PREDICTED: microsomal glutathione S-transfer...    102   4e-23   
ref|XP_010739802.1|  PREDICTED: microsomal glutathione S-transfer...    101   4e-23   
emb|CDI56027.1|  related to glutathione s-transferase 3                 101   5e-23   
ref|XP_001769728.1|  predicted protein                                  103   5e-23   
gb|KIK48405.1|  hypothetical protein CY34DRAFT_798220                 99.8    9e-23   
gb|EMD41838.1|  hypothetical protein CERSUDRAFT_110400                  101   1e-22   
ref|XP_005049864.1|  PREDICTED: microsomal glutathione S-transfer...  99.4    1e-22   
ref|XP_002508174.1|  predicted protein                                98.2    1e-22   
ref|XP_007852190.1|  glutathione s-transferase                        99.4    1e-22   
gb|AEI70681.1|  microsomal GST 3                                      98.6    1e-22   
ref|XP_002987507.1|  hypothetical protein SELMODRAFT_426325           99.8    2e-22   
ref|XP_001703138.1|  glutathione S-transferase                        99.0    2e-22   
ref|XP_002987749.1|  hypothetical protein SELMODRAFT_447093           99.4    2e-22   
ref|XP_008901376.1|  hypothetical protein PPTG_08194                  98.6    2e-22   
gb|KIJ56973.1|  hypothetical protein M422DRAFT_218818                 98.6    2e-22   
ref|XP_007313466.1|  hypothetical protein SERLADRAFT_365244           98.6    3e-22   
gb|ACF35503.1|  microsomal glutathione S-transferase                  98.2    3e-22   
ref|XP_011391963.1|  hypothetical protein UMAG_11795                  99.4    3e-22   
ref|XP_008901379.1|  hypothetical protein, variant                    97.4    4e-22   
ref|XP_005715962.1|  microsomal glutathione S-transferase             97.8    4e-22   
ref|XP_011119729.1|  hypothetical protein AOL_s00054g111              98.2    4e-22   
emb|CDS10284.1|  hypothetical protein LRAMOSA02960                    97.8    4e-22   
emb|CBQ69972.1|  related to glutathione s-transferase 3               99.0    4e-22   
ref|XP_009541026.1|  MAPEG family                                     97.8    5e-22   
ref|XP_007349972.1|  microsomal glutathione S-transferase 3           97.8    6e-22   
gb|KIK30349.1|  hypothetical protein PISMIDRAFT_26796                 97.4    7e-22   
emb|CCA66601.1|  related to microsomal glutathione S-transferase 3    97.1    9e-22   
gb|ACU45089.1|  glutathione S-transferase 3                           97.1    9e-22   
ref|XP_007852191.1|  hypothetical protein Moror_3213                  97.1    1e-21   
gb|ELW64022.1|  Microsomal glutathione S-transferase 3                95.9    1e-21   
gb|ABI14208.1|  MAPEG family protein                                  96.3    1e-21   
ref|XP_007378934.1|  membrane-associated proteins in eicosanoid a...  96.7    2e-21   
gb|KIJ21950.1|  hypothetical protein PAXINDRAFT_165282                95.9    2e-21   
gb|KGB33986.1|  Microsomal glutathione S-transferase 3                96.3    3e-21   
gb|KDQ63338.1|  hypothetical protein JAAARDRAFT_188921                95.9    3e-21   
ref|XP_003323438.2|  hypothetical protein PGTG_04975                  95.9    3e-21   
ref|XP_002612232.1|  hypothetical protein BRAFLDRAFT_269443           95.5    3e-21   
ref|XP_009857296.1|  hypothetical protein NEUTE1DRAFT_143468          95.5    3e-21   
gb|ABC61054.1|  microsomal glutathione transferase                    95.9    3e-21   
gb|AAW27035.1|  SJCHGC06285 protein                                   95.9    3e-21   
emb|CDH58439.1|  microsomal glutathione s-transferase 3-likeprotein   95.5    4e-21   
ref|XP_007673772.1|  hypothetical protein BAUCODRAFT_65848            95.5    4e-21   
ref|XP_003386237.1|  PREDICTED: microsomal glutathione S-transfer...  95.1    5e-21   
gb|AAP05968.1|  similar to GenBank Accession Number AY050567 micr...  95.9    5e-21   
ref|XP_008863332.1|  hypothetical protein H310_01804                  95.1    5e-21   
ref|XP_006957241.1|  membrane-associated proteins in eicosanoid a...  95.1    5e-21   
ref|XP_002949483.1|  hypothetical protein VOLCADRAFT_89757            94.4    7e-21   
ref|XP_002392655.1|  hypothetical protein MPER_07731                  94.7    7e-21   
gb|KIM29401.1|  hypothetical protein M408DRAFT_22772                  94.7    8e-21   
gb|KIM84294.1|  hypothetical protein PILCRDRAFT_818633                94.4    1e-20   
gb|KIO29469.1|  hypothetical protein M407DRAFT_242577                 94.4    1e-20   



>ref|XP_009613603.1| PREDICTED: microsomal glutathione S-transferase 3 [Nicotiana 
tomentosiformis]
Length=145

 Score =   246 bits (629),  Expect = 6e-80, Method: Compositional matrix adjust.
 Identities = 114/145 (79%), Positives = 127/145 (88%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+LPKEYGYV++VLV YCFLN WM FQVG ARKKYKV YPTMYAIEAENK+AKLFN
Sbjct  1    MAGVELLPKEYGYVILVLVFYCFLNFWMSFQVGKARKKYKVSYPTMYAIEAENKNAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFMLMI+GGIRHPLI ASLGA+YIV R+ YFTGY+TGDP  R T+
Sbjct  61   CVQRGHQNSLEMMPMFFMLMIVGGIRHPLICASLGAVYIVCRFFYFTGYSTGDPQNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKY F+AI GL IC+ISC + LL S
Sbjct  121  GKYNFLAIMGLMICSISCGVNLLMS  145



>ref|XP_009763425.1| PREDICTED: microsomal glutathione S-transferase 3 [Nicotiana 
sylvestris]
Length=145

 Score =   245 bits (625),  Expect = 2e-79, Method: Compositional matrix adjust.
 Identities = 113/145 (78%), Positives = 126/145 (87%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+LPKEYGYV++VLV YCFLN WM FQVG ARKKYKV YPTMYAIEAENK+AKLFN
Sbjct  1    MAGVELLPKEYGYVILVLVFYCFLNFWMSFQVGKARKKYKVSYPTMYAIEAENKNAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFMLMI+GGIRHPLI  SLGA+YIV R+ YFTGY+TGDP  R T+
Sbjct  61   CVQRGHQNSLEMMPMFFMLMIVGGIRHPLICTSLGAVYIVCRFFYFTGYSTGDPQNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKY F+AI GL IC+ISC + LL S
Sbjct  121  GKYNFLAIMGLMICSISCGVNLLMS  145



>ref|XP_006348192.1| PREDICTED: microsomal glutathione S-transferase 3-like [Solanum 
tuberosum]
Length=145

 Score =   239 bits (611),  Expect = 2e-77, Method: Compositional matrix adjust.
 Identities = 112/145 (77%), Positives = 122/145 (84%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE LPKEYGYV++ L  YCFLN WM FQVG ARK+YKV YPTMYA EAENK+AK FN
Sbjct  1    MAGVEFLPKEYGYVILALAAYCFLNFWMSFQVGKARKQYKVSYPTMYATEAENKNAKSFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFMLMI+GGIRHPLI ASLGA+YIVSRY YFTGY+TGDP  R TL
Sbjct  61   CVQRGHQNSLEMMPMFFMLMIVGGIRHPLICASLGAVYIVSRYFYFTGYSTGDPQNRLTL  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKY F+AI GL ICAISC +  L S
Sbjct  121  GKYNFLAIMGLLICAISCGVNFLMS  145



>ref|XP_004232661.1| PREDICTED: microsomal glutathione S-transferase 3 [Solanum lycopersicum]
Length=145

 Score =   238 bits (608),  Expect = 7e-77, Method: Compositional matrix adjust.
 Identities = 110/145 (76%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE LPKEYGYV++ LV+YCF N WM FQVG ARK+YKVPYPTMYA EAENK+A  FN
Sbjct  1    MAGVEFLPKEYGYVILALVVYCFFNFWMSFQVGKARKQYKVPYPTMYATEAENKNANSFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP FFMLMI+GGIRHPLI ASLGA+YIVSRY YFTGY+TGDP  R TL
Sbjct  61   CVQRGHQNSLEMMPTFFMLMIVGGIRHPLICASLGAVYIVSRYFYFTGYSTGDPQNRLTL  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKY F+AI  L ICA SC +  L S
Sbjct  121  GKYNFLAIMALMICAASCGVNFLMS  145



>ref|XP_002305918.1| microsomal glutathione s-transferase family protein [Populus 
trichocarpa]
 gb|EEE86429.1| microsomal glutathione s-transferase family protein [Populus 
trichocarpa]
Length=145

 Score =   234 bits (597),  Expect = 3e-75, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+ PKEYGYVV VLV YCFLN WMGFQVG+ARKKYKVPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAGVEMFPKEYGYVVFVLVAYCFLNFWMGFQVGSARKKYKVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF+LM+LGGIRHP + A+LG++++V+RY YFTGYATGDP  R  +
Sbjct  61   CVQRGHQNSLEMMPVFFLLMVLGGIRHPCVCAALGSLFLVTRYFYFTGYATGDPKNRLNI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL  C IS  I LL
Sbjct  121  GKYGFLAVLGLVGCTISFGISLL  143



>ref|XP_011048867.1| PREDICTED: microsomal glutathione S-transferase 3 [Populus euphratica]
Length=145

 Score =   234 bits (596),  Expect = 6e-75, Method: Compositional matrix adjust.
 Identities = 108/143 (76%), Positives = 124/143 (87%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+ PKEYGYVV VLV YCFLN WMGFQVG+ARKKYKVPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAGVEMFPKEYGYVVFVLVAYCFLNFWMGFQVGSARKKYKVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF+LM+LGGIRHP + A+LG++++V+RY YFTGYATGDP  R  +
Sbjct  61   CVQRGHQNSLEMMPVFFLLMVLGGIRHPCVCAALGSLFLVTRYFYFTGYATGDPKNRLNI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL  C IS  I LL
Sbjct  121  GKYGFLALLGLIGCTISFGISLL  143



>ref|XP_011096918.1| PREDICTED: microsomal glutathione S-transferase 3 [Sesamum indicum]
Length=145

 Score =   233 bits (595),  Expect = 7e-75, Method: Compositional matrix adjust.
 Identities = 107/143 (75%), Positives = 123/143 (86%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+LPKEYGYVV+VLV YCFLN WM  QVG AR KYKV YPTMYA EAE+KDAKLFN
Sbjct  1    MAGVELLPKEYGYVVLVLVAYCFLNFWMASQVGRARNKYKVFYPTMYATEAESKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP FFMLMILGGIRHP+I+ASLGA+Y V+R+ YF GY+TGDP KR ++
Sbjct  61   CVQRGHQNSLEMMPTFFMLMILGGIRHPVIAASLGALYTVTRFFYFKGYSTGDPKKRLSI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL +C ISC + +L
Sbjct  121  GKYGFLAMLGLMVCTISCGVHML  143



>ref|XP_010103455.1| hypothetical protein L484_004949 [Morus notabilis]
 gb|EXB95900.1| hypothetical protein L484_004949 [Morus notabilis]
Length=145

 Score =   228 bits (580),  Expect = 1e-72, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 123/145 (85%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA ++ LP+EYGYV +VLV YCFLN WMGFQVG AR+KYKVPYPT+YA E+ENKDAKLFN
Sbjct  1    MADIDFLPREYGYVALVLVFYCFLNFWMGFQVGKARRKYKVPYPTLYASESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QRGHQNSLE MP+FF+LM+LGGIRHP I A LG++YIV+RY YF GY+TGDP KR ++
Sbjct  61   CIQRGHQNSLEYMPMFFVLMVLGGIRHPCICAGLGSLYIVTRYFYFEGYSTGDPQKRLSI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+A+ GL +C IS  + LL +
Sbjct  121  GKYGFLALMGLMVCTISFGVSLLRA  145



>gb|KFK33320.1| hypothetical protein AALP_AA6G359700 [Arabis alpina]
Length=388

 Score =   236 bits (601),  Expect = 2e-72, Method: Compositional matrix adjust.
 Identities = 109/149 (73%), Positives = 127/149 (85%), Gaps = 0/149 (0%)
 Frame = +2

Query  5    KKTAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDA  184
            K  +MA  E LPKEYGYVVIVLVLYCFLNLWMGFQVG ARK+YKVPYPT+YAIE+ENKDA
Sbjct  238  KVASMAVSEFLPKEYGYVVIVLVLYCFLNLWMGFQVGGARKRYKVPYPTLYAIESENKDA  297

Query  185  KLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTK  364
            KLFNCVQRGHQNSLE MP++F+LMILGG++HP IS  LG +Y +SR+ YF GY+TGDP K
Sbjct  298  KLFNCVQRGHQNSLEMMPMYFLLMILGGMKHPCISTGLGLLYNISRFFYFKGYSTGDPIK  357

Query  365  RYTLGKYGFIAIFGLQICAISCAIKLLTS  451
            R T+GKYGF+A+ GL +C IS AI L+ S
Sbjct  358  RLTIGKYGFLAMLGLAVCTISFAITLIRS  386



>ref|XP_006405930.1| hypothetical protein EUTSA_v10027981mg [Eutrema salsugineum]
 gb|ESQ47383.1| hypothetical protein EUTSA_v10027981mg [Eutrema salsugineum]
Length=145

 Score =   224 bits (571),  Expect = 3e-71, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 122/143 (85%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E+LP EYGYV+IV+V YCFLNLWMGFQVG ARK+YKVPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAIAEVLPNEYGYVIIVVVFYCFLNLWMGFQVGGARKRYKVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I   LG +Y VSR+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFLLMILGGMKHPCICTGLGLLYNVSRFFYFKGYSTGDPKKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+GF+A+ GL +C IS AI LL
Sbjct  121  GKFGFLAMLGLAVCTISFAISLL  143



>ref|XP_006481935.1| PREDICTED: microsomal glutathione S-transferase 3-like [Citrus 
sinensis]
Length=154

 Score =   224 bits (571),  Expect = 4e-71, Method: Compositional matrix adjust.
 Identities = 101/147 (69%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  5    KKTAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDA  184
              T     + LP EYGYV +VLV YCFLN WMGFQVG ARKKYKVPYPT+YA+E+ENKDA
Sbjct  6    DSTMADATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKDA  65

Query  185  KLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTK  364
            KLFNCVQRGHQNSLE MPVFFMLMI+GG++HP + A LG+++IV+R+ YF GYATGDP K
Sbjct  66   KLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFIVTRFFYFKGYATGDPQK  125

Query  365  RYTLGKYGFIAIFGLQICAISCAIKLL  445
            R T+GKYGF+A+ GL +C IS  I  L
Sbjct  126  RLTIGKYGFLALLGLMVCTISFGINQL  152



>gb|KDO57301.1| hypothetical protein CISIN_1g045836mg [Citrus sinensis]
Length=154

 Score =   223 bits (569),  Expect = 9e-71, Method: Compositional matrix adjust.
 Identities = 100/147 (68%), Positives = 119/147 (81%), Gaps = 0/147 (0%)
 Frame = +2

Query  5    KKTAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDA  184
              T  A  + LP EYGYV +VLV YCFLN WMGFQVG ARKKYKVPYPT+YA+E+ENK+A
Sbjct  6    DSTVAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEA  65

Query  185  KLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTK  364
            KLFNCVQRGHQNSLE MPVFFMLMI+GG++HP + A LG+++ V+R+ YF GYATGDP K
Sbjct  66   KLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQK  125

Query  365  RYTLGKYGFIAIFGLQICAISCAIKLL  445
            R T+GKYGF+A+ GL +C IS  I  L
Sbjct  126  RLTIGKYGFLALLGLMVCTISFGINQL  152



>ref|XP_010511506.1| PREDICTED: microsomal glutathione S-transferase 3 [Camelina sativa]
Length=145

 Score =   222 bits (565),  Expect = 2e-70, Method: Compositional matrix adjust.
 Identities = 104/145 (72%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + LPKEYGYVVI+LVLYCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAITDFLPKEYGYVVIILVLYCFLNLWMGGQVGKARKRYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GYATGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGMKHPSICAILGLVYNVSRFFYFKGYATGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+ + GL IC IS  + L+ S
Sbjct  121  GKYGFLGLLGLMICTISFGVTLIRS  145



>ref|XP_010415129.1| PREDICTED: microsomal glutathione S-transferase 3-like [Camelina 
sativa]
Length=145

 Score =   221 bits (564),  Expect = 3e-70, Method: Compositional matrix adjust.
 Identities = 103/145 (71%), Positives = 120/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + LPKEYGYVVI+LV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAITDFLPKEYGYVVIILVFYCFLNLWMGAQVGKARKRYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GYATGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGMKHPSICAVLGLVYNVSRFFYFKGYATGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+ + GL IC IS  + L+ S
Sbjct  121  GKYGFLGLLGLMICTISFGVTLIRS  145



>gb|KHG13232.1| Microsomal glutathione S-transferase 3 [Gossypium arboreum]
Length=142

 Score =   221 bits (562),  Expect = 5e-70, Method: Compositional matrix adjust.
 Identities = 103/140 (74%), Positives = 121/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E L KEYGYVV+V+V YCFL++WMG QVG ARKKYKV YPT+YA+E+ENKDAKLFNCVQ
Sbjct  1    MEFLAKEYGYVVLVVVAYCFLSIWMGIQVGMARKKYKVYYPTLYALESENKDAKLFNCVQ  60

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FF+LMILGG+ HP ISA+LG  Y V+RY YFTGY+TGDP KR T+GKY
Sbjct  61   RGHQNSLEMMPMFFVLMILGGMAHPCISAALGLFYTVTRYFYFTGYSTGDPQKRLTIGKY  120

Query  386  GFIAIFGLQICAISCAIKLL  445
            GF+A+ GL+IC IS AI LL
Sbjct  121  GFLALLGLKICTISLAINLL  140



>ref|XP_010528606.1| PREDICTED: microsomal glutathione S-transferase 3 [Tarenaya hassleriana]
Length=145

 Score =   221 bits (562),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 101/143 (71%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA VE LPKEYGYVV+ LV YCFLN WM  QVG AR++Y VPYPT+YAIE+ENKDAK FN
Sbjct  1    MAAVEFLPKEYGYVVLALVFYCFLNFWMAAQVGRARRRYNVPYPTLYAIESENKDAKRFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FF+LMILGG++HP ISA LG +Y V+R+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMFFILMILGGMKHPCISAGLGLLYSVTRFFYFRGYSTGDPQKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+FGL  C IS  I L+
Sbjct  121  GKYGFLAVFGLMFCTISFGISLI  143



>ref|XP_006430354.1| hypothetical protein CICLE_v10013005mg [Citrus clementina]
 gb|ESR43594.1| hypothetical protein CICLE_v10013005mg [Citrus clementina]
Length=154

 Score =   221 bits (563),  Expect = 6e-70, Method: Compositional matrix adjust.
 Identities = 99/147 (67%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  5    KKTAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDA  184
              T  A  + LP EYGYV +VLV YCFLN WMGFQVG ARKKYKVPYPT+YA+E+ENK+A
Sbjct  6    DSTVAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEA  65

Query  185  KLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTK  364
            KLFNCVQRGHQNSLE MPVFFMLMI+GG++HP + A LG+++ V+R+ YF GYATGDP K
Sbjct  66   KLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQK  125

Query  365  RYTLGKYGFIAIFGLQICAISCAIKLL  445
            R  +GKYGF+A+ GL +C IS  I  L
Sbjct  126  RLAIGKYGFLALLGLMVCTISFGINQL  152



>ref|XP_002886976.1| hypothetical protein ARALYDRAFT_475688 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63235.1| hypothetical protein ARALYDRAFT_475688 [Arabidopsis lyrata subsp. 
lyrata]
Length=146

 Score =   220 bits (561),  Expect = 1e-69, Method: Compositional matrix adjust.
 Identities = 102/144 (71%), Positives = 119/144 (83%), Gaps = 0/144 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A  E LPKEYGYVV+VLV YCFLNLWMGFQVG ARK+Y VPYPT+YAIE+ENKDAKLFNC
Sbjct  3    AITEFLPKEYGYVVLVLVFYCFLNLWMGFQVGGARKRYNVPYPTLYAIESENKDAKLFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP++F+LMILGG++HP IS  LG +Y V+RY YF GYATGDP KR T+G
Sbjct  63   VQRGHQNSLEYMPMYFILMILGGMKHPCISTGLGLLYSVTRYFYFKGYATGDPMKRLTIG  122

Query  380  KYGFIAIFGLQICAISCAIKLLTS  451
            KY F+ + GL IC IS  + L+ +
Sbjct  123  KYSFLGLIGLMICTISFGVTLIRA  146



>gb|KJB22440.1| hypothetical protein B456_004G047600 [Gossypium raimondii]
Length=142

 Score =   219 bits (559),  Expect = 2e-69, Method: Compositional matrix adjust.
 Identities = 102/140 (73%), Positives = 120/140 (86%), Gaps = 0/140 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E L KEYGYV +V+V YCFL++WMG QVG ARKKYKV YPT+YA+E+ENKDAKLFNCVQ
Sbjct  1    MEFLAKEYGYVALVVVAYCFLSIWMGIQVGMARKKYKVYYPTLYALESENKDAKLFNCVQ  60

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FF+LMILGG+ HP ISA+LG  Y V+RY YFTGY+TGDP KR T+GKY
Sbjct  61   RGHQNSLEMMPMFFVLMILGGMAHPCISAALGLFYTVTRYFYFTGYSTGDPQKRLTIGKY  120

Query  386  GFIAIFGLQICAISCAIKLL  445
            GF+A+ GL+IC IS AI LL
Sbjct  121  GFLALLGLKICTISLAINLL  140



>ref|XP_010435550.1| PREDICTED: microsomal glutathione S-transferase 3-like [Camelina 
sativa]
Length=147

 Score =   219 bits (558),  Expect = 3e-69, Method: Compositional matrix adjust.
 Identities = 103/143 (72%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LPKEYGYVVIV+VLYCFLN WM FQVG ARK+YKV YP++YAIE+ENKDAKLFN
Sbjct  1    MAITEFLPKEYGYVVIVVVLYCFLNFWMSFQVGGARKRYKVFYPSLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GY+TGDP  R T+
Sbjct  61   CVQRGHQNSLEMMPMYFLLMILGGMKHPCICACLGLLYNVSRFFYFKGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL +C IS AI LL
Sbjct  121  GKYGFLAMLGLAVCTISFAITLL  143



>ref|XP_002526194.1| microsomal glutathione s-transferase, putative [Ricinus communis]
 gb|EEF36198.1| microsomal glutathione s-transferase, putative [Ricinus communis]
Length=146

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/138 (72%), Positives = 118/138 (86%), Gaps = 0/138 (0%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            ++PKEYGYV +VLV YCFLNLWM  QVG ARKKYKV YPT+YA+E+ENKDAKLFNCVQRG
Sbjct  7    VVPKEYGYVALVLVAYCFLNLWMAGQVGKARKKYKVFYPTLYALESENKDAKLFNCVQRG  66

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQNSLE MP+FF+LMILGG RHP +SA LG +YI+SRY YFTGY+TGDP KR ++GKYGF
Sbjct  67   HQNSLEMMPMFFVLMILGGFRHPSVSAILGCLYIISRYFYFTGYSTGDPQKRLSIGKYGF  126

Query  392  IAIFGLQICAISCAIKLL  445
            +++ GL +C IS  I LL
Sbjct  127  LSLLGLMVCTISLGISLL  144



>ref|XP_006300565.1| hypothetical protein CARUB_v10021117mg [Capsella rubella]
 gb|EOA33463.1| hypothetical protein CARUB_v10021117mg [Capsella rubella]
Length=145

 Score =   219 bits (557),  Expect = 4e-69, Method: Compositional matrix adjust.
 Identities = 100/145 (69%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + LP EYGYVV++LVLYCF+NLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAITDFLPSEYGYVVLILVLYCFINLWMGAQVGGARKRYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP+I A LG +Y VSR+ YF GYATGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGMKHPIICAVLGLVYNVSRFFYFKGYATGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+ + GL IC IS  + L+ +
Sbjct  121  GKYGFLGLLGLMICTISFGVTLIRA  145



>ref|XP_010470456.1| PREDICTED: microsomal glutathione S-transferase 3-like [Camelina 
sativa]
Length=145

 Score =   218 bits (556),  Expect = 6e-69, Method: Compositional matrix adjust.
 Identities = 102/145 (70%), Positives = 119/145 (82%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + LPKEYGYVVI+LV YCFLNLWMG QVG ARK+Y V YPT+YAIE+ENKDAKLFN
Sbjct  1    MAITDFLPKEYGYVVIILVFYCFLNLWMGAQVGKARKRYNVQYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GYATGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGMKHPSICAVLGLVYNVSRFFYFKGYATGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+ + GL IC IS  + L+ S
Sbjct  121  GKYGFLGLLGLMICTISFGVTLIRS  145



>ref|XP_010450477.1| PREDICTED: microsomal glutathione S-transferase 3-like [Camelina 
sativa]
Length=147

 Score =   218 bits (555),  Expect = 8e-69, Method: Compositional matrix adjust.
 Identities = 102/143 (71%), Positives = 120/143 (84%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + LPKEYGYVVIV+VLYCFLN WM FQVG ARK+YKV YP++YAIE+ENKDAKLFN
Sbjct  1    MAITDFLPKEYGYVVIVVVLYCFLNFWMSFQVGGARKRYKVFYPSLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GY+TGDP  R T+
Sbjct  61   CVQRGHQNSLEMMPMYFLLMILGGMKHPCICACLGLLYNVSRFFYFKGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL +C IS AI LL
Sbjct  121  GKYGFLAMLGLAVCTISFAITLL  143



>ref|NP_176758.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AAN76990.1|AF461148_1 MAPEG-like protein [Arabidopsis thaliana]
 gb|AAK62622.1| At1g65820/F1E22_4 [Arabidopsis thaliana]
 gb|AAL47424.1| At1g65820/F1E22_4 [Arabidopsis thaliana]
 gb|AAM66941.1| glutathione-s-transferase, putative [Arabidopsis thaliana]
 gb|AEE34427.1| putative glutathione S-transferase [Arabidopsis thaliana]
Length=146

 Score =   217 bits (553),  Expect = 2e-68, Method: Compositional matrix adjust.
 Identities = 101/144 (70%), Positives = 118/144 (82%), Gaps = 0/144 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A  E LPKEYGYVV+VLV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFNC
Sbjct  3    AITEFLPKEYGYVVLVLVFYCFLNLWMGAQVGRARKRYNVPYPTLYAIESENKDAKLFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP++F+LMILGG++HP I   LG +Y VSR+ YF GYATGDP KR T+G
Sbjct  63   VQRGHQNSLEMMPMYFILMILGGMKHPCICTGLGLLYNVSRFFYFKGYATGDPMKRLTIG  122

Query  380  KYGFIAIFGLQICAISCAIKLLTS  451
            KYGF+ + GL IC IS  + L+ +
Sbjct  123  KYGFLGLLGLMICTISFGVTLILA  146



>ref|XP_010675204.1| PREDICTED: microsomal glutathione S-transferase 3 [Beta vulgaris 
subsp. vulgaris]
Length=146

 Score =   216 bits (549),  Expect = 6e-68, Method: Compositional matrix adjust.
 Identities = 101/139 (73%), Positives = 117/139 (84%), Gaps = 0/139 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLVLYC  NLWMGF+VGTARKKYKV YPT+YA E+ENKDAKLFNCVQRGH
Sbjct  8    LTKEYGYVVLVLVLYCIFNLWMGFKVGTARKKYKVFYPTLYASESENKDAKLFNCVQRGH  67

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MPV+F+LMILGG+RHP I   LG  YIV+RY YFTGY++GDP KR ++GKYGF+
Sbjct  68   QNSLEMMPVYFILMILGGMRHPCICTGLGLFYIVARYFYFTGYSSGDPQKRLSIGKYGFL  127

Query  395  AIFGLQICAISCAIKLLTS  451
            A+ GL IC IS  + LL +
Sbjct  128  ALMGLMICTISFGVNLLIA  146



>gb|KFK41020.1| hypothetical protein AALP_AA2G075000 [Arabis alpina]
Length=145

 Score =   216 bits (549),  Expect = 7e-68, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LP EYGYVV+VLV YCFLNLWMG QVG+ARK+Y VPYPT+YA+E+ENKDAKLFN
Sbjct  1    MAIAEFLPNEYGYVVLVLVFYCFLNLWMGAQVGSARKRYNVPYPTLYAVESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I  +LG +Y V+R+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGMQHPCICTALGLLYNVTRFFYFKGYSTGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+ + GL IC IS  + L+
Sbjct  121  GKYGFLGLLGLMICTISFGVTLI  143



>ref|XP_008460505.1| PREDICTED: microsomal glutathione S-transferase 3 [Cucumis melo]
Length=145

 Score =   215 bits (547),  Expect = 1e-67, Method: Compositional matrix adjust.
 Identities = 99/143 (69%), Positives = 118/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA +++LP EYGYVV+VLVLY FLN WM  QVG ARK+YKV YP +YA+E+ENKDAKLFN
Sbjct  1    MAAIQLLPSEYGYVVLVLVLYSFLNFWMAGQVGRARKRYKVFYPNLYALESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFMLMILGGI HP +SAS G +Y+VSR+ YF GYATG P KR T+
Sbjct  61   CVQRGHQNSLEMMPLFFMLMILGGIGHPCLSASFGILYVVSRFFYFKGYATGVPEKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+ F+A+ GL +C IS  +KLL
Sbjct  121  GKFSFLALLGLMVCTISLGVKLL  143



>ref|XP_009127454.1| PREDICTED: microsomal glutathione S-transferase 3 [Brassica rapa]
 emb|CDY16423.1| BnaA02g12270D [Brassica napus]
Length=145

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LP EYGYV +VLV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MALTEFLPNEYGYVALVLVFYCFLNLWMGAQVGMARKRYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y ++R+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFVLMILGGMKHPCICAGLGLLYNITRFFYFKGYSTGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+ + GL IC IS  + L+
Sbjct  121  GKYGFLGLLGLMICTISFGVSLI  143



>emb|CDY54440.1| BnaC02g45560D [Brassica napus]
Length=145

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LP EYGYV +VLV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MALTEFLPNEYGYVALVLVFYCFLNLWMGAQVGMARKRYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y ++R+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFVLMILGGMKHPCICACLGLLYNITRFFYFKGYSTGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+ + GL IC IS  + L+
Sbjct  121  GKYGFLGLLGLMICTISFGVSLI  143



>ref|XP_010440827.1| PREDICTED: microsomal glutathione S-transferase 3-like [Camelina 
sativa]
Length=147

 Score =   214 bits (546),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 100/143 (70%), Positives = 119/143 (83%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  + L KEYGYVVIV+VLYCFLN WM FQVG ARK+YKV YP++YAIE+ENKDAKLFN
Sbjct  1    MAITDFLSKEYGYVVIVVVLYCFLNFWMSFQVGGARKRYKVFYPSLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMI+GG++HP I A LG +Y VSR+ YF GY+TGDP  R T+
Sbjct  61   CVQRGHQNSLEMMPMYFLLMIIGGMKHPCICACLGLLYNVSRFFYFKGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL +C IS AI LL
Sbjct  121  GKYGFLAMLGLAVCTISFAITLL  143



>ref|XP_009124156.1| PREDICTED: microsomal glutathione S-transferase 3-like [Brassica 
rapa]
 ref|XP_009124157.1| PREDICTED: microsomal glutathione S-transferase 3-like [Brassica 
rapa]
 emb|CDY31629.1| BnaA06g20340D [Brassica napus]
Length=145

 Score =   213 bits (542),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LPKEYGYVV+VLV YCFLNLWMG QVG ARK+Y V +PT+YAIE+ENKDAKLFN
Sbjct  1    MAITEFLPKEYGYVVLVLVFYCFLNLWMGAQVGRARKRYNVQFPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I   LG +Y +SR+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFILMILGGLKHPCICTGLGLLYNISRFFYFKGYSTGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+ + GL IC IS  + L+
Sbjct  121  GKYGFLGLLGLMICTISFGVTLI  143



>ref|XP_006372463.1| hypothetical protein POPTR_0017s01880g [Populus trichocarpa]
 gb|ERP50260.1| hypothetical protein POPTR_0017s01880g [Populus trichocarpa]
Length=148

 Score =   213 bits (541),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+ P+ +G V  VLV YCFLN WMGFQVG ARKKY VPYPT+YAIE+ENKDA LFN
Sbjct  1    MAGVEMFPRGFGNVAFVLVAYCFLNFWMGFQVGKARKKYNVPYPTLYAIESENKDANLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QRGHQNSLE+MP+FF+LM+LGGIRHP    +LG+IY V+R+ YFTGY+TGDP  R T+
Sbjct  61   CIQRGHQNSLEHMPMFFLLMVLGGIRHPCACVALGSIYTVTRFFYFTGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYG + + GL  C IS  I LL
Sbjct  121  GKYGLLPLMGLIGCTISFGISLL  143



>ref|XP_009370540.1| PREDICTED: microsomal glutathione S-transferase 3-like [Pyrus 
x bretschneideri]
Length=147

 Score =   212 bits (540),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 118/142 (83%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            + VE+LPKEYGYVV+ +VLY  LN WM FQVG ARK+YKVPYPTMYA E+E+KDAK+FNC
Sbjct  3    SAVELLPKEYGYVVLAVVLYTLLNFWMTFQVGRARKRYKVPYPTMYASESESKDAKVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+FF+L++LGG++HP ISA+LG ++  +RY YF GYATGDP KR  +G
Sbjct  63   VQRGHQNSLEMMPMFFVLLVLGGLKHPCISAALGFLFTFTRYFYFKGYATGDPMKRLAIG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+AIFGL  C IS  + LL
Sbjct  123  KYGFLAIFGLIGCTISFGVSLL  144



>ref|XP_011016135.1| PREDICTED: microsomal glutathione S-transferase 3-like [Populus 
euphratica]
Length=165

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+ P+ +G V  VLV YCFLN WM FQVG ARKKY VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAGVEMFPRGFGNVAFVLVAYCFLNFWMAFQVGKARKKYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QRGHQNSLE MPVFF+LM+LGGIRHP    +LG+IY V+R+ YFTGY+TGDP  R T+
Sbjct  61   CIQRGHQNSLELMPVFFLLMVLGGIRHPCACVALGSIYTVTRFFYFTGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYG + + GL  C IS  I LL
Sbjct  121  GKYGLLPLIGLMGCTISFGISLL  143



>ref|XP_011038344.1| PREDICTED: microsomal glutathione S-transferase 3-like [Populus 
euphratica]
Length=165

 Score =   213 bits (541),  Expect = 2e-66, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 114/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAGVE+ P+ +G V  VLV YCFLN WM FQVG ARKKY VPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAGVEMFPRGFGNVAFVLVAYCFLNFWMAFQVGKARKKYNVPYPTLYAIESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QRGHQNSLE MPVFF+LM+LGGIRHP    +LG+IY V+R+ YFTGY+TGDP  R T+
Sbjct  61   CIQRGHQNSLELMPVFFLLMVLGGIRHPCACVALGSIYTVTRFFYFTGYSTGDPKNRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYG + + GL  C IS  I LL
Sbjct  121  GKYGLLPLIGLMGCTISFGISLL  143



>ref|XP_008381362.1| PREDICTED: microsomal glutathione S-transferase 3-like [Malus 
domestica]
Length=147

 Score =   210 bits (535),  Expect = 7e-66, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            + +E+LPKEYGYVV+ +VLY FLN WM  QVG ARK+YKVPYPTMYA E+ENKDAK+FNC
Sbjct  3    SAIELLPKEYGYVVLAVVLYTFLNFWMAAQVGRARKRYKVPYPTMYASESENKDAKVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+FF+L++LGG++HP ISA+LG  +  +RY YF GYATGDP  R  +G
Sbjct  63   VQRGHQNSLEMMPMFFVLLVLGGLKHPCISAALGFFFAFTRYFYFKGYATGDPMNRLAIG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+AIFGL  C IS  + LL
Sbjct  123  KYGFLAIFGLIGCTISFGVSLL  144



>gb|KJB10498.1| hypothetical protein B456_001G204400 [Gossypium raimondii]
Length=143

 Score =   210 bits (535),  Expect = 8e-66, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 118/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            I+ KEYGYV IV+V+YC LN+WMGFQV  ARKKYKV +P +YA+E+ENK+AK+FNCVQRG
Sbjct  4    IMGKEYGYVAIVVVVYCCLNMWMGFQVVKARKKYKVNFPNLYALESENKNAKIFNCVQRG  63

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQNSLE MPVFF+L++LGG+ HP +SA+LG  Y V+RY YFTGY+TGDP  R T+GKYGF
Sbjct  64   HQNSLEMMPVFFILIVLGGMGHPCVSAALGLFYTVTRYFYFTGYSTGDPQNRLTIGKYGF  123

Query  392  IAIFGLQICAISCAIKLLTS  451
            +A+FGL IC IS  IKLL S
Sbjct  124  LALFGLMICTISFGIKLLRS  143



>ref|XP_010062340.1| PREDICTED: microsomal glutathione S-transferase 3 [Eucalyptus 
grandis]
 gb|KCW69467.1| hypothetical protein EUGRSUZ_F02921 [Eucalyptus grandis]
Length=151

 Score =   210 bits (535),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/138 (70%), Positives = 114/138 (83%), Gaps = 0/138 (0%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +LP+EYGYV +VLV YCFLN WM  QVG ARKKYKV YPT+YA E+ENK+AKLFNCVQRG
Sbjct  5    LLPREYGYVALVLVFYCFLNFWMAAQVGMARKKYKVFYPTLYASESENKEAKLFNCVQRG  64

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQNSLE MP+FFMLMI+GG+RHP   A+LG +YIVSR+ YF GY+TGDP KR  +GKYGF
Sbjct  65   HQNSLEMMPMFFMLMIVGGLRHPCACAALGVLYIVSRFFYFKGYSTGDPQKRLKIGKYGF  124

Query  392  IAIFGLQICAISCAIKLL  445
            +AI GL +C IS  + LL
Sbjct  125  LAIMGLMVCTISFGVGLL  142



>ref|XP_008371140.1| PREDICTED: microsomal glutathione S-transferase 3-like [Malus 
domestica]
Length=147

 Score =   210 bits (534),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 97/142 (68%), Positives = 116/142 (82%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            + VE+LPKEYGYVV+ +VLY FLN WM  QVG ARK+YKVPYPTMYA E+ENKDAK+FNC
Sbjct  3    SAVELLPKEYGYVVLXVVLYTFLNFWMAAQVGRARKRYKVPYPTMYASESENKDAKVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+FF+L++LGG++HP ISA+LG  +  +RY YF GYATGDP  R  +G
Sbjct  63   VQRGHQNSLEMMPMFFVLLVLGGLKHPCISAALGFFFAFTRYFYFKGYATGDPMXRLAIG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+AIFGL  C IS  + LL
Sbjct  123  KYGFLAIFGLIGCTISFGVSLL  144



>ref|XP_004140310.1| PREDICTED: microsomal glutathione S-transferase 3-like [Cucumis 
sativus]
 ref|XP_004169611.1| PREDICTED: microsomal glutathione S-transferase 3-like [Cucumis 
sativus]
 gb|KGN51029.1| Microsomal glutathione s-transferase [Cucumis sativus]
Length=145

 Score =   209 bits (533),  Expect = 2e-65, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA +++LP +YGYVV+VLVLY FLN WM  QVG ARKKYKV YP +YA+E++NKDAKLFN
Sbjct  1    MAAIQLLPSQYGYVVLVLVLYTFLNFWMAGQVGRARKKYKVFYPNLYALESDNKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFMLMILGGI HP ++AS G +Y+V R+ YF GYATG P KR T+
Sbjct  61   CVQRGHQNSLEMMPLFFMLMILGGIGHPCLTASFGVLYVVCRFFYFKGYATGVPEKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+ F+A+ GL +C IS  +KLL
Sbjct  121  GKFSFLALLGLMVCTISFGVKLL  143



>ref|NP_001154451.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AEE34428.1| putative glutathione S-transferase [Arabidopsis thaliana]
Length=162

 Score =   207 bits (526),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 101/160 (63%), Positives = 117/160 (73%), Gaps = 16/160 (10%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKK----------------YKVPYPT  151
            A  E LPKEYGYVV+VLV YCFLNLWMG QVG ARK                 Y VPYPT
Sbjct  3    AITEFLPKEYGYVVLVLVFYCFLNLWMGAQVGRARKSSISSLLNLRFQSVVCLYNVPYPT  62

Query  152  MYAIEAENKDAKLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGY  331
            +YAIE+ENKDAKLFNCVQRGHQNSLE MP++F+LMILGG++HP I   LG +Y VSR+ Y
Sbjct  63   LYAIESENKDAKLFNCVQRGHQNSLEMMPMYFILMILGGMKHPCICTGLGLLYNVSRFFY  122

Query  332  FTGYATGDPTKRYTLGKYGFIAIFGLQICAISCAIKLLTS  451
            F GYATGDP KR T+GKYGF+ + GL IC IS  + L+ +
Sbjct  123  FKGYATGDPMKRLTIGKYGFLGLLGLMICTISFGVTLILA  162



>ref|XP_010246009.1| PREDICTED: microsomal glutathione S-transferase 3-like [Nelumbo 
nucifera]
Length=145

 Score =   206 bits (524),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 116/143 (81%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA VE+L +EYGYVV+VLVLY FLN WM FQV  ARK+YKV +P +YA+E+ENKDAKLFN
Sbjct  1    MAVVELLQREYGYVVLVLVLYTFLNFWMAFQVLKARKRYKVFFPNLYALESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FFML+ LGG++HPL S+ LG IY VSRY YFTGY+TG+P  R  +
Sbjct  61   CVQRGHQNSLEFMPLFFMLIALGGLKHPLFSSVLGLIYTVSRYFYFTGYSTGEPKNRLKI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G+ GF A+ GL IC +S AI LL
Sbjct  121  GRLGFPALGGLAICTVSLAINLL  143



>emb|CDP21734.1| unnamed protein product [Coffea canephora]
 emb|CDP05226.1| unnamed protein product [Coffea canephora]
Length=147

 Score =   205 bits (522),  Expect = 7e-64, Method: Compositional matrix adjust.
 Identities = 98/145 (68%), Positives = 118/145 (81%), Gaps = 1/145 (1%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
             GVE LPKEYGYV +V+VLY FLN +M  QVG ARKKYKVPYPT+YA EAENKDAKLFNC
Sbjct  3    GGVEFLPKEYGYVPLVIVLYIFLNFYMSAQVGLARKKYKVPYPTLYASEAENKDAKLFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY-TL  376
            +QRGHQNSLE+MP+FF+LM+LGGI+HP+ISA+LG +YIV+R+ YF GY+TG P  R   L
Sbjct  63   IQRGHQNSLESMPLFFVLMVLGGIKHPIISAALGILYIVTRFFYFKGYSTGIPDNRLGGL  122

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GK+  +AIFGL  C +S  + LL S
Sbjct  123  GKFWLLAIFGLVFCTVSFGVSLLLS  147



>ref|XP_002273456.1| PREDICTED: microsomal glutathione S-transferase 3 [Vitis vinifera]
 emb|CBI36503.3| unnamed protein product [Vitis vinifera]
Length=145

 Score =   205 bits (522),  Expect = 8e-64, Method: Compositional matrix adjust.
 Identities = 97/143 (68%), Positives = 117/143 (82%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  ++LP+EYGYVV+VLV YCFLN +M   VG ARKKYKV +P +YA+E+ENKDAKLFN
Sbjct  1    MAAEDLLPREYGYVVLVLVFYCFLNFFMAISVGKARKKYKVSFPNLYALESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF+LMILGGI +PL  A+LG++YIVSRY YFTGY+TG+P  R  +
Sbjct  61   CVQRGHQNSLEMMPVFFVLMILGGIGYPLTCAALGSLYIVSRYFYFTGYSTGNPENRLKI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+ F+AI GL IC I  AI L+
Sbjct  121  GKFSFLAIPGLMICNILFAINLV  143



>ref|XP_011469515.1| PREDICTED: microsomal glutathione S-transferase 3 [Fragaria vesca 
subsp. vesca]
Length=149

 Score =   205 bits (521),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/140 (67%), Positives = 117/140 (84%), Gaps = 0/140 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VE+LPK+YGYVV+V+VLY FLN +M  +VG ARKKYKV YPTMYA E++NKDAK+FNCVQ
Sbjct  7    VELLPKDYGYVVMVVVLYSFLNFFMAAKVGMARKKYKVFYPTMYASESDNKDAKVFNCVQ  66

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FF+ ++LGG+RHP I+A LG +Y VSRY YF GY+TGDP KR ++GKY
Sbjct  67   RGHQNSLEMMPLFFVFLVLGGLRHPCIAAVLGLLYTVSRYFYFKGYSTGDPQKRLSVGKY  126

Query  386  GFIAIFGLQICAISCAIKLL  445
            GF+A+ GL +C IS  + LL
Sbjct  127  GFLALVGLIVCTISFGVTLL  146



>gb|AFK34321.1| unknown [Lotus japonicus]
Length=150

 Score =   204 bits (519),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 112/142 (79%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E LPK YG+V IVLVLYCFLN +M FQVG ARKKYKV YPT+YA+E+ENKDAKLFNCVQ
Sbjct  5    MESLPKGYGFVAIVLVLYCFLNFFMSFQVGKARKKYKVFYPTLYALESENKDAKLFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE  P+FFMLMILGG++HP   A+LG +Y VSRY YFTGY+TG P  R  +GKY
Sbjct  65   RGHQNSLEMAPIFFMLMILGGLKHPSTCAALGLLYTVSRYFYFTGYSTGQPENRLKIGKY  124

Query  386  GFIAIFGLQICAISCAIKLLTS  451
             F+AI GL +C +S    LL  
Sbjct  125  NFVAILGLMLCTLSFGWTLLNQ  146



>ref|XP_010243917.1| PREDICTED: microsomal glutathione S-transferase 3-like [Nelumbo 
nucifera]
Length=146

 Score =   203 bits (517),  Expect = 5e-63, Method: Compositional matrix adjust.
 Identities = 98/143 (69%), Positives = 115/143 (80%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA VE+LP+EYGYVV+VLVLY FLN WM FQVG ARKKYKV YPT+YA+E+ENKDAKLFN
Sbjct  1    MAIVELLPREYGYVVLVLVLYGFLNAWMAFQVGKARKKYKVFYPTLYALESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FF+ ++LGG+++P ISA LG +YIV RY YFTGYATG P  R  +
Sbjct  61   CVQRGHQNSLEMMPMFFVSLLLGGLQYPKISAGLGLLYIVGRYFYFTGYATGVPDNRLKI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK  F+A+ GL I   S  I LL
Sbjct  121  GKLSFLAMMGLMISTASLGINLL  143



>ref|XP_004503076.1| PREDICTED: microsomal glutathione S-transferase 3-like [Cicer 
arietinum]
Length=150

 Score =   202 bits (513),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 111/142 (78%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E+LPKEYG+VVI+LVLYCFLN ++ F VG ARKKY V YPT+YA E+ENKDAKLFNCVQ
Sbjct  5    IELLPKEYGFVVIILVLYCFLNFYITFHVGKARKKYNVFYPTLYASESENKDAKLFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FFMLMILGG +HP I A LG +Y V+RY YFTGYATG+P  R  LG +
Sbjct  65   RGHQNSLETMPIFFMLMILGGFKHPSICAVLGIVYTVARYFYFTGYATGEPKNRIKLGGF  124

Query  386  GFIAIFGLQICAISCAIKLLTS  451
               A+ GL +C +SC   LL  
Sbjct  125  FMPALLGLMLCTLSCGWSLLNQ  146



>gb|EPS73711.1| hypothetical protein M569_01049, partial [Genlisea aurea]
Length=147

 Score =   200 bits (508),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/147 (61%), Positives = 118/147 (80%), Gaps = 0/147 (0%)
 Frame = +2

Query  11   TAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL  190
            + MAG+  LP EYGYV++VLV Y F+N WM  +VG AR+KYKV YP +YA E+ENKDAKL
Sbjct  1    STMAGLVTLPGEYGYVILVLVFYSFINFWMLLRVGQARRKYKVFYPALYANESENKDAKL  60

Query  191  FNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY  370
            FNC+QRGHQNS+E MP+FFMLMI+GG++HPL SAS G +Y ++R  YFTGY+TG P KR 
Sbjct  61   FNCIQRGHQNSVEFMPLFFMLMIVGGLKHPLTSASFGVVYCIARIFYFTGYSTGIPEKRA  120

Query  371  TLGKYGFIAIFGLQICAISCAIKLLTS  451
            T+GKY ++ + GL IC+IS A++++ +
Sbjct  121  TIGKYNYLGLLGLMICSISGAVRMIIA  147



>gb|KHG14220.1| Microsomal glutathione S-transferase 3 [Gossypium arboreum]
Length=143

 Score =   199 bits (507),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 97/140 (69%), Positives = 119/140 (85%), Gaps = 0/140 (0%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            I+ KEYGYVVIV+V+YC LN+WMG+QV  ARKKYKV +P +YA+E+ENK+AK+FNCVQRG
Sbjct  4    IMGKEYGYVVIVVVVYCCLNMWMGYQVVKARKKYKVNFPNLYALESENKNAKIFNCVQRG  63

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQNSLE MPVFF+L++LGG+ HP +SA+LG  Y V+RY YFTGY+TGDP  R T+GKYGF
Sbjct  64   HQNSLEMMPVFFILIVLGGMGHPCVSAALGLFYTVTRYFYFTGYSTGDPQNRLTIGKYGF  123

Query  392  IAIFGLQICAISCAIKLLTS  451
            +A+FGL IC IS  IKLL S
Sbjct  124  LALFGLMICTISFGIKLLRS  143



>ref|XP_006430355.1| hypothetical protein CICLE_v10013005mg [Citrus clementina]
 gb|ESR43595.1| hypothetical protein CICLE_v10013005mg [Citrus clementina]
Length=147

 Score =   199 bits (507),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 107/135 (79%), Gaps = 0/135 (0%)
 Frame = +2

Query  5    KKTAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDA  184
              T  A  + LP EYGYV +VLV YCFLN WMGFQVG ARKKYKVPYPT+YA+E+ENK+A
Sbjct  6    DSTVAAATQFLPTEYGYVALVLVFYCFLNFWMGFQVGAARKKYKVPYPTLYAVESENKEA  65

Query  185  KLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTK  364
            KLFNCVQRGHQNSLE MPVFFMLMI+GG++HP + A LG+++ V+R+ YF GYATGDP K
Sbjct  66   KLFNCVQRGHQNSLELMPVFFMLMIVGGLKHPCVCAVLGSLFTVTRFFYFKGYATGDPQK  125

Query  365  RYTLGKYGFIAIFGL  409
            R  +G   F  +F L
Sbjct  126  RLAIGFVTFPFLFRL  140



>ref|XP_006285985.1| hypothetical protein CARUB_v10007513mg [Capsella rubella]
 gb|EOA18883.1| hypothetical protein CARUB_v10007513mg [Capsella rubella]
Length=144

 Score =   198 bits (504),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 96/143 (67%), Positives = 114/143 (80%), Gaps = 3/143 (2%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  E LP EYGYVVIV+V YCFLNLWMGFQ   + +  +V YPT+YAIE+ENK AKLFN
Sbjct  1    MAITEFLPNEYGYVVIVVVFYCFLNLWMGFQ---SAELARVFYPTLYAIESENKGAKLFN  57

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I A LG +Y VSR+ YF GY+TGDP  R T+
Sbjct  58   CVQRGHQNSLEMMPMYFLLMILGGMKHPCICAGLGLLYNVSRFFYFKGYSTGDPKNRLTI  117

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GKYGF+A+ GL +C IS AI LL
Sbjct  118  GKYGFLAMLGLTVCTISFAITLL  140



>gb|AAF23833.1|AC007234_5 F1E22.17 [Arabidopsis thaliana]
Length=146

 Score =   197 bits (501),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 96/142 (68%), Positives = 113/142 (80%), Gaps = 4/142 (3%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A  E LPKEYGYVV+VLV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFNC
Sbjct  3    AITEFLPKEYGYVVLVLVFYCFLNLWMGAQVGRARKRYNVPYPTLYAIESENKDAKLFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP++F+LMILGG++HP I   LG +Y VSR+ YF GYATGDP KR T+ 
Sbjct  63   VQRGHQNSLEMMPMYFILMILGGMKHPCICTGLGLLYNVSRFFYFKGYATGDPMKRLTI-  121

Query  380  KYGFIAIFGLQICAISCAIKLL  445
              GF+ +   Q C++S  I L+
Sbjct  122  --GFVLLSSYQ-CSLSLLIDLV  140



>gb|KDP36366.1| hypothetical protein JCGZ_09781 [Jatropha curcas]
Length=155

 Score =   197 bits (500),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 103/122 (84%), Gaps = 1/122 (1%)
 Frame = +2

Query  17   MAGVE-ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            MAG+E I P+EYGYV +VLV YCFLN WM  QVG AR+KYKV YPT+YAIE+ENKDAKLF
Sbjct  1    MAGIEMIFPREYGYVALVLVAYCFLNFWMSIQVGKARRKYKVSYPTLYAIESENKDAKLF  60

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NCVQRGHQNSLE MP+FF +MILGG+RHP +  SLG +Y ++RY YFTGYATGDP KR T
Sbjct  61   NCVQRGHQNSLEMMPIFFTMMILGGLRHPCVCGSLGFLYTITRYFYFTGYATGDPQKRLT  120

Query  374  LG  379
            +G
Sbjct  121  IG  122



>ref|XP_010246010.1| PREDICTED: microsomal glutathione S-transferase 3-like [Nelumbo 
nucifera]
Length=149

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 97/145 (67%), Positives = 117/145 (81%), Gaps = 0/145 (0%)
 Frame = +2

Query  11   TAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL  190
             A+A VE+LP+EYGYVV+VLVLY FLN+WM  QV  ARKKY V YP +YA+E+ENKDAKL
Sbjct  3    VAVAVVELLPREYGYVVLVLVLYAFLNIWMSLQVVRARKKYNVQYPALYALESENKDAKL  62

Query  191  FNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY  370
            FNCVQRGHQNSLE MP FF L++LGG++HPLI+A LG +Y V+RY YFTGYATG P KR 
Sbjct  63   FNCVQRGHQNSLEMMPSFFALLLLGGLQHPLIAAGLGVVYTVARYFYFTGYATGIPEKRL  122

Query  371  TLGKYGFIAIFGLQICAISCAIKLL  445
            T+G++ F+A+ GL IC  S  I LL
Sbjct  123  TIGRFNFLAVLGLIICTGSLGINLL  147



>ref|XP_004982015.1| PREDICTED: microsomal glutathione S-transferase 3-like [Setaria 
italica]
Length=148

 Score =   196 bits (499),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLV Y FLN WM FQVG ARKKYKV YPTMYA+E+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLVLVAYAFLNFWMSFQVGKARKKYKVFYPTMYAVESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF++++LGG++HP I+A LG +Y V+R+ YF GYATG P  R  +G   F+
Sbjct  67   QNSLEMMPMFFVMLLLGGLQHPTIAAGLGVLYTVARFFYFKGYATGVPDNRLKIGGLNFL  126

Query  395  AIFGLQICAISCAIKLL  445
            A+FGL IC  S  I L+
Sbjct  127  AVFGLIICTASFGINLV  143



>ref|NP_001154452.1| putative glutathione S-transferase [Arabidopsis thaliana]
 gb|AEE34429.1| putative glutathione S-transferase [Arabidopsis thaliana]
Length=194

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 93/144 (65%), Positives = 114/144 (79%), Gaps = 4/144 (3%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A  E LPKEYGYVV+VLV YCFLNLWMG QVG ARK+Y VPYPT+YAIE+ENKDAKLFNC
Sbjct  3    AITEFLPKEYGYVVLVLVFYCFLNLWMGAQVGRARKRYNVPYPTLYAIESENKDAKLFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP++F+LMILGG++HP I   LG +Y VSR+ YF GYATGDP KR T+G
Sbjct  63   VQRGHQNSLEMMPMYFILMILGGMKHPCICTGLGLLYNVSRFFYFKGYATGDPMKRLTIG  122

Query  380  ----KYGFIAIFGLQICAISCAIK  439
                 + +  ++ L++C+ S ++ 
Sbjct  123  FSHSSFLYSVLYLLRLCSTSSSLN  146



>ref|XP_002464011.1| hypothetical protein SORBIDRAFT_01g010540 [Sorghum bicolor]
 gb|EER91009.1| hypothetical protein SORBIDRAFT_01g010540 [Sorghum bicolor]
Length=148

 Score =   196 bits (498),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 109/137 (80%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLV Y FLN WM FQVG ARKKYKV YPTMYAIE+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLVLVAYAFLNFWMSFQVGKARKKYKVFYPTMYAIESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF++++LGG++HP I+A LG +Y+V+R+ YF GYATG P  R  +G   F+
Sbjct  67   QNSLEMMPLFFVMLLLGGLQHPTIAAGLGVLYVVARFFYFKGYATGVPDNRLKIGGLNFL  126

Query  395  AIFGLQICAISCAIKLL  445
            A+ GL IC  S  I L+
Sbjct  127  AVIGLIICTASFGINLV  143



>ref|XP_003560791.1| PREDICTED: microsomal glutathione S-transferase 3 [Brachypodium 
distachyon]
Length=148

 Score =   194 bits (494),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYG+VV+V+V Y FLN WM FQVG AR+KYKV YPT+YA+E+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGFVVLVVVAYAFLNFWMAFQVGKARRKYKVAYPTLYAVESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF++++LGG++HP+++A LGA+Y V+R+ YF GYATG P  R  LG + F+
Sbjct  67   QNSLEMMPMFFVMVLLGGLQHPVVAAGLGALYTVARFFYFKGYATGVPDNRLKLGGFNFL  126

Query  395  AIFGLQICAISCAIKLL  445
            AI GL +C  S  I L+
Sbjct  127  AIIGLILCTASFGINLV  143



>ref|XP_009139711.1| PREDICTED: microsomal glutathione S-transferase 3-like [Brassica 
rapa]
 emb|CDX74592.1| BnaA04g07970D [Brassica napus]
Length=145

 Score =   194 bits (493),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 101/145 (70%), Positives = 121/145 (83%), Gaps = 0/145 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  ++LPKEYGYVVIV+VLYC LN WM FQVG ARK+YKV YPT+YA E+ENKDAKLFN
Sbjct  1    MAIGDVLPKEYGYVVIVVVLYCVLNFWMAFQVGGARKRYKVAYPTLYATESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP++F+LMILGG++HP I  +LG +Y VSR+ YF GY+TGDP KR T+
Sbjct  61   CVQRGHQNSLEMMPMYFLLMILGGMKHPCICTALGLLYNVSRFFYFKGYSTGDPMKRLTI  120

Query  377  GKYGFIAIFGLQICAISCAIKLLTS  451
            GKYGF+A+ GL +C IS AI LL +
Sbjct  121  GKYGFLAMLGLAVCTISFAITLLRA  145



>ref|XP_009370066.1| PREDICTED: microsomal glutathione S-transferase 3-like [Pyrus 
x bretschneideri]
Length=147

 Score =   193 bits (491),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 95/142 (67%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            + VE+LPKEYGYVV+ +VLY FLN WM  QVG ARK+YKVPYPTMYA E+ENKDA +FNC
Sbjct  3    SAVELLPKEYGYVVLAVVLYTFLNFWMAAQVGRARKRYKVPYPTMYASESENKDANVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+F +L++LGG++HP ISA+LG  +  +RY YF GYATGDP  R  +G
Sbjct  63   VQRGHQNSLEMMPMFLVLLVLGGLKHPCISAALGFFFAFTRYFYFKGYATGDPMNRLAIG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+AIFGL  C IS  + LL
Sbjct  123  KYGFLAIFGLIGCTISFGVSLL  144



>ref|NP_001051042.1| Os03g0709000 [Oryza sativa Japonica Group]
 gb|ABF98490.1| MAPEG family protein, expressed [Oryza sativa Japonica Group]
 dbj|BAF12956.1| Os03g0709000 [Oryza sativa Japonica Group]
 dbj|BAG88302.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC76045.1| hypothetical protein OsI_13225 [Oryza sativa Indica Group]
 gb|EEE59787.1| hypothetical protein OsJ_12298 [Oryza sativa Japonica Group]
Length=148

 Score =   192 bits (489),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 89/137 (65%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+ LV Y FLN WM FQVG AR+KYKV YPTMYA+E+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLALVAYAFLNFWMSFQVGKARRKYKVFYPTMYAVESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF+ +++GG++HPL++A LG  Y V+R+ YF GYATG P  R  +G   F+
Sbjct  67   QNSLEMMPLFFVTLLVGGLQHPLVAAGLGVFYAVARFFYFKGYATGIPDNRLKIGGLNFL  126

Query  395  AIFGLQICAISCAIKLL  445
            AIFGL IC  S  I L+
Sbjct  127  AIFGLIICTASFGINLV  143



>gb|EMS50381.1| hypothetical protein TRIUR3_16899 [Triticum urartu]
Length=148

 Score =   191 bits (484),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 106/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LPKEYGYVV+ +V Y FLN WM FQVG ARKKYKV YPTMYA E+ENKDAK FNCVQRGH
Sbjct  7    LPKEYGYVVLTVVAYAFLNFWMSFQVGAARKKYKVFYPTMYATESENKDAKPFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNS+E MP+FF  ++LGG++HP+++A+LG +Y V+R+ YF GYATG P  RY LG   F 
Sbjct  67   QNSIEMMPLFFATLLLGGLQHPVVAAALGLLYTVARFFYFKGYATGVPENRYKLGGLNFP  126

Query  395  AIFGLQICAISCAIKLL  445
            AI GL IC  S  + L+
Sbjct  127  AIMGLIICTASFGVNLI  143



>ref|XP_006650477.1| PREDICTED: microsomal glutathione S-transferase 3-like [Oryza 
brachyantha]
Length=148

 Score =   190 bits (483),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/137 (64%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+ LV Y FLN WM  QVG AR+KYKV YPTMYA+E+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLALVAYAFLNFWMSMQVGKARRKYKVFYPTMYAVESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF+ +++GG++HP+I+A+LGA Y V+R+ YF GY+TG P  R  +G   F 
Sbjct  67   QNSLEMMPLFFVTLLVGGLQHPVIAAALGAFYTVARFFYFKGYSTGIPENRLKIGGLNFF  126

Query  395  AIFGLQICAISCAIKLL  445
            A+FGL IC  S  I L+
Sbjct  127  AVFGLIICTASFGINLI  143



>ref|XP_007018793.1| Microsomal glutathione S-transferase 3 [Theobroma cacao]
 gb|EOY16018.1| Microsomal glutathione S-transferase 3 [Theobroma cacao]
Length=384

 Score =   197 bits (501),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 87/121 (72%), Positives = 104/121 (86%), Gaps = 0/121 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M GVE LP EYGYV++VLVLYCFLN WM  QVG ARK+YKV YPT+YA+E+ENKDAKLFN
Sbjct  3    MRGVEFLPNEYGYVILVLVLYCFLNFWMAGQVGKARKRYKVGYPTLYAVESENKDAKLFN  62

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FF+LM+LGG+ HP + ++LG +YIV+RY YFTGYATGDP  R ++
Sbjct  63   CVQRGHQNSLEMMPMFFLLMVLGGMGHPCVCSALGVVYIVTRYFYFTGYATGDPQNRLSI  122

Query  377  G  379
            G
Sbjct  123  G  123



>gb|EMS52225.1| hypothetical protein TRIUR3_05587 [Triticum urartu]
Length=148

 Score =   188 bits (478),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 89/143 (62%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA +  L KEYGYVV+ +V Y FLN WM FQVG ARKKYKV YPT+YAIE+ENKDAK FN
Sbjct  1    MAVLVELTKEYGYVVLTVVAYAFLNFWMSFQVGAARKKYKVFYPTLYAIESENKDAKRFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FF+ ++LGG++HP+++A+LG +Y V+R+ YF GYATG P  R  L
Sbjct  61   CVQRGHQNSLEMMPLFFVTVLLGGLQHPVVAAALGLLYTVARFFYFKGYATGVPDNRLKL  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G   F+AI GL +C  S  I L+
Sbjct  121  GGLNFLAIIGLILCTASFGINLV  143



>ref|XP_003616133.1| Microsomal glutathione S-transferase [Medicago truncatula]
 gb|ACJ83972.1| unknown [Medicago truncatula]
 gb|AES99091.1| microsomal glutathione S-transferase, putative [Medicago truncatula]
 gb|AFK41727.1| unknown [Medicago truncatula]
Length=150

 Score =   188 bits (477),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 89/142 (63%), Positives = 107/142 (75%), Gaps = 0/142 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E+LPKEYG+V IVLVLY FLN +M FQVG ARKKYKV YPT+YA E+ENKDA LFNCVQ
Sbjct  5    IELLPKEYGFVAIVLVLYTFLNFFMTFQVGKARKKYKVFYPTLYASESENKDALLFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FF LMILGG++HP I A LG +Y V+RY YF GYA+G+P  R  LG +
Sbjct  65   RGHQNSLETMPIFFTLMILGGLKHPTICAVLGVLYTVARYFYFVGYASGEPKNRLKLGGF  124

Query  386  GFIAIFGLQICAISCAIKLLTS  451
               A+ GL +  +S    L+  
Sbjct  125  FMPALLGLMVSTLSFGWSLVNQ  146



>gb|ADP02228.1| putative microsomal glutathione S-transferase 3 [Aegilops tauschii]
 gb|EMT29078.1| hypothetical protein F775_08629 [Aegilops tauschii]
Length=148

 Score =   187 bits (474),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 88/137 (64%), Positives = 105/137 (77%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+ +V Y FLN WM FQVG ARKKYKV YPTMYA EAENKDAK FNCVQRGH
Sbjct  7    LTKEYGYVVLTVVAYAFLNFWMSFQVGAARKKYKVFYPTMYATEAENKDAKAFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNS+E MP+FF  ++LGG++HP+I+A+LG +Y V+R+ YF GYATG    R+ LG   + 
Sbjct  67   QNSIEMMPLFFATLLLGGLQHPVIAAALGLLYTVARFFYFKGYATGVRESRHRLGSLNYP  126

Query  395  AIFGLQICAISCAIKLL  445
            AIFGL IC  S  I L+
Sbjct  127  AIFGLIICTASFGINLV  143



>ref|XP_010926150.1| PREDICTED: microsomal glutathione S-transferase 3-like [Elaeis 
guineensis]
Length=151

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 90/149 (60%), Positives = 114/149 (77%), Gaps = 7/149 (5%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MAG+E LP+EYGYVV+VLVLY FLN WM  +VG AR KYKVPYPT+YAIE+ENKDAKLFN
Sbjct  1    MAGME-LPREYGYVVLVLVLYTFLNSWMASKVGRARIKYKVPYPTLYAIESENKDAKLFN  59

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF +++LGG+RHPL++A  G  Y ++R+ YFTGY++G P  R  +
Sbjct  60   CVQRGHQNSLELMPVFFAMLLLGGLRHPLVAAGFGIDYTIARFFYFTGYSSGIPENRLKM  119

Query  377  ------GKYGFIAIFGLQICAISCAIKLL  445
                    +G +++ GL IC +S  I +L
Sbjct  120  LGLRIVPFFGLMSLSGLTICTVSFGINIL  148



>ref|XP_008343115.1| PREDICTED: microsomal glutathione S-transferase 3-like [Malus 
domestica]
 ref|XP_008362527.1| PREDICTED: microsomal glutathione S-transferase 3-like [Malus 
domestica]
Length=147

 Score =   186 bits (473),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 94/142 (66%), Positives = 115/142 (81%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            + VE+LPKEYGYVV+ +VLY FLN  M  +VG ARK+YKVPYPTMYA E+ENKDAK+FNC
Sbjct  3    SAVELLPKEYGYVVLAVVLYTFLNFCMAAKVGRARKRYKVPYPTMYASESENKDAKVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+ F+L++LGG++HP ISA+LG ++  +RY YF GYATGDP  R  +G
Sbjct  63   VQRGHQNSLEMMPMLFVLLVLGGLKHPCISAALGFLFTFTRYFYFKGYATGDPINRLAIG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+AIFGL  C IS  + LL
Sbjct  123  KYGFLAIFGLIGCTISFGVSLL  144



>ref|XP_009390358.1| PREDICTED: microsomal glutathione S-transferase 3-like [Musa 
acuminata subsp. malaccensis]
Length=154

 Score =   186 bits (471),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 87/143 (61%), Positives = 111/143 (78%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA    +PKEYGYVV+VL+ Y FLN WM FQVG ARKKY+V YPT+YAI++ENKDAKLFN
Sbjct  1    MAAALGIPKEYGYVVLVLLSYIFLNFWMSFQVGKARKKYQVFYPTLYAIKSENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF  +++GG++ P+I+A LGA+Y V+R+ YF GYA+G P  R  +
Sbjct  61   CVQRGHQNSLEMMPVFFATLLVGGLQLPVIAAGLGAVYTVARFFYFKGYASGVPENRLRI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G   F+A+FGL I   + A+ L+
Sbjct  121  GGINFLALFGLIILTAAFAMSLI  143



>ref|XP_004982016.1| PREDICTED: microsomal glutathione S-transferase 3-like [Setaria 
italica]
Length=148

 Score =   185 bits (469),  Expect = 9e-56, Method: Compositional matrix adjust.
 Identities = 86/141 (61%), Positives = 105/141 (74%), Gaps = 0/141 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LPKEYGYVV+VLV Y FLNLWM  QVG AR+KYKV YPT+YA+E+EN+DAKLFNCVQRGH
Sbjct  7    LPKEYGYVVLVLVAYAFLNLWMSLQVGKARRKYKVSYPTLYAVESENRDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MP+FF +++LGG+RHP   A LGA+Y V+R+ YF GYA G P  R +  +   +
Sbjct  67   QNSLEVMPLFFAMLLLGGLRHPAAGAGLGALYTVARFFYFKGYAAGAPRNRMSGVRLSMV  126

Query  395  AIFGLQICAISCAIKLLTS*T  457
            A  GL +C  S  I L+   T
Sbjct  127  AGAGLILCTASFGISLVVRET  147



>ref|XP_003616134.1| Microsomal glutathione S-transferase [Medicago truncatula]
 gb|AES99092.1| microsomal glutathione S-transferase, putative [Medicago truncatula]
Length=146

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 104/138 (75%), Gaps = 3/138 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E+LPKEYG+V IVLVLY FLN +M FQVG ARKKYKV YPT+YA E+ENKDA LFNCVQ
Sbjct  5    IELLPKEYGFVAIVLVLYTFLNFFMTFQVGKARKKYKVFYPTLYASESENKDALLFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY---TL  376
            RGHQNSLE MP+FF LMILGG++HP I A LG +Y V+RY YF GYA+G+P  R    T 
Sbjct  65   RGHQNSLETMPIFFTLMILGGLKHPTICAVLGVLYTVARYFYFVGYASGEPKNRLKLGTT  124

Query  377  GKYGFIAIFGLQICAISC  430
            G YG      ++ C  +C
Sbjct  125  GAYGVYTFIWMESCQSAC  142



>gb|ADP02227.1| putative microsomal glutathione S-transferase 3 [Aegilops tauschii]
 gb|EMT15298.1| hypothetical protein F775_08407 [Aegilops tauschii]
Length=148

 Score =   184 bits (467),  Expect = 2e-55, Method: Compositional matrix adjust.
 Identities = 91/137 (66%), Positives = 107/137 (78%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LPKEYGYVV+V+V Y FLN WM FQVG ARKKYKV YPTMYA EAENKDAK FNCVQRGH
Sbjct  7    LPKEYGYVVLVVVAYAFLNFWMSFQVGAARKKYKVFYPTMYATEAENKDAKPFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNS+E MP+FF  ++LGG++HP+++A+LG +Y V+R+ YF GYATG P  RY LG   F 
Sbjct  67   QNSIEMMPLFFATLLLGGLQHPVVAAALGLLYTVARFFYFKGYATGVPENRYKLGGLNFP  126

Query  395  AIFGLQICAISCAIKLL  445
            AI GL IC  S  I L+
Sbjct  127  AIMGLIICTASFGINLV  143



>ref|XP_008665261.1| PREDICTED: uncharacterized protein LOC100216831 isoform X1 [Zea 
mays]
 gb|ACF82966.1| unknown [Zea mays]
 gb|ACG31561.1| microsomal glutathione S-transferase 3 [Zea mays]
 tpg|DAA50952.1| TPA: microsomal glutathione S-transferase 3 [Zea mays]
Length=148

 Score =   183 bits (465),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 95/137 (69%), Positives = 111/137 (81%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLV Y FLNLWMGFQVG AR+KYKV YPTMYAIE+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLVLVAYVFLNLWMGFQVGKARRKYKVFYPTMYAIESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MPVFF++++LGG++HP I+A LG IYIV+R+ YF GYATG P  R  +G   ++
Sbjct  67   QNSLEWMPVFFVILLLGGLQHPTIAAGLGGIYIVARFFYFKGYATGVPDNRLKIGGLNYL  126

Query  395  AIFGLQICAISCAIKLL  445
            A+ GL IC  S  I LL
Sbjct  127  ALLGLIICTASFGINLL  143



>ref|XP_008229352.1| PREDICTED: microsomal glutathione S-transferase 3-like [Prunus 
mume]
 ref|XP_008244311.1| PREDICTED: microsomal glutathione S-transferase 3-like [Prunus 
mume]
Length=147

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 93/142 (65%), Positives = 114/142 (80%), Gaps = 0/142 (0%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
              VE+LP+EYGYVV+VLVLY FLN WM  +VG ARKKYKVPYPT+YA E++NKDAK+FNC
Sbjct  3    TAVELLPREYGYVVLVLVLYTFLNFWMAGKVGKARKKYKVPYPTLYASESDNKDAKVFNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+F +L++LGG++HP ISA LG  Y V+RY YF GY+TGDP  R  +G
Sbjct  63   VQRGHQNSLELMPLFLVLLLLGGLKHPCISAGLGLFYTVTRYFYFKGYSTGDPENRLAVG  122

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            KYGF+A+ G  +C IS  + LL
Sbjct  123  KYGFLALLGHIVCTISFGVTLL  144



>ref|XP_006828419.1| hypothetical protein AMTR_s00060p00085140 [Amborella trichopoda]
 gb|ERM95835.1| hypothetical protein AMTR_s00060p00085140 [Amborella trichopoda]
Length=143

 Score =   182 bits (462),  Expect = 8e-55, Method: Compositional matrix adjust.
 Identities = 88/138 (64%), Positives = 110/138 (80%), Gaps = 0/138 (0%)
 Frame = +2

Query  38   PKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQ  217
            PKEYG+VV+V + Y F NLWM FQVG ARK+YKV YPT+YA+E+ENKDAKLFNCVQRGHQ
Sbjct  6    PKEYGFVVLVFLFYVFCNLWMSFQVGKARKRYKVFYPTLYAVESENKDAKLFNCVQRGHQ  65

Query  218  NSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFIA  397
            NSLE MP+FF+L++LGG+RHPLI++ LG  Y V+RY YF GYATG P  R  +G++ + A
Sbjct  66   NSLEMMPIFFVLLLLGGLRHPLIASGLGLFYTVARYFYFKGYATGVPENRLKIGQFNYFA  125

Query  398  IFGLQICAISCAIKLLTS  451
            + GL  C +S A+ LL S
Sbjct  126  LLGLIGCNLSLALTLLRS  143



>ref|XP_008781046.1| PREDICTED: microsomal glutathione S-transferase 3-like [Phoenix 
dactylifera]
Length=148

 Score =   180 bits (456),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 91/140 (65%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VEI P+EYGYVV+V+VLY FLN WMGFQVG AR+KYKV YP +YAIE+ENKDAKLFNCVQ
Sbjct  5    VEI-PREYGYVVLVVVLYTFLNFWMGFQVGKARRKYKVFYPNLYAIESENKDAKLFNCVQ  63

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MPVFF+ +++GG +HP+I+A LG +Y V+R+ YF GY++G P  R  +G +
Sbjct  64   RGHQNSLEAMPVFFVTLLVGGFQHPIIAAGLGVLYTVARFFYFKGYSSGVPENRLKIGGF  123

Query  386  GFIAIFGLQICAISCAIKLL  445
             F+A+FGL IC  S  I LL
Sbjct  124  NFLALFGLIICTASFGIHLL  143



>ref|XP_010926151.1| PREDICTED: microsomal glutathione S-transferase 3-like [Elaeis 
guineensis]
Length=148

 Score =   179 bits (455),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 113/140 (81%), Gaps = 1/140 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VEI P+EYGYVV+V+VLY FLNLWM FQVG ARKKYKV YP +YAIE+ENKDAK FNCVQ
Sbjct  5    VEI-PREYGYVVLVVVLYTFLNLWMSFQVGKARKKYKVFYPNLYAIESENKDAKPFNCVQ  63

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MPVFF+ +++GG++HP+I+A LG +Y V+R+ YF GY+TG P  R  +G +
Sbjct  64   RGHQNSLEAMPVFFVTLLVGGVQHPIIAAGLGVLYTVARFFYFKGYSTGVPDNRLKIGGF  123

Query  386  GFIAIFGLQICAISCAIKLL  445
             F+A+FGL IC  S  I LL
Sbjct  124  NFLALFGLIICTASFGIHLL  143



>ref|XP_008781035.1| PREDICTED: microsomal glutathione S-transferase 3-like [Phoenix 
dactylifera]
Length=148

 Score =   177 bits (450),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 82/143 (57%), Positives = 108/143 (76%), Gaps = 6/143 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LP+EYGYVV+VL+LY FLN WM  +VG AR KYKV YPT+YAIE+ENKDAKLFNCVQRGH
Sbjct  3    LPREYGYVVLVLLLYTFLNSWMASKVGRARIKYKVSYPTLYAIESENKDAKLFNCVQRGH  62

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL------  376
            QNSLE MPVFF++++LGG+RHPL++A  G  Y ++R+ YF GY++G P  R  +      
Sbjct  63   QNSLELMPVFFVMLLLGGLRHPLVAAGFGIDYTIARFFYFKGYSSGIPENRLKMLGLRIV  122

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
              +G +++ GL IC +S  + +L
Sbjct  123  PFFGLMSLLGLTICTVSFGVNIL  145



>gb|AII01422.1| microsomal glutathione S-transferase [Zostera marina]
Length=149

 Score =   177 bits (449),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 80/141 (57%), Positives = 106/141 (75%), Gaps = 1/141 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            V++LPKEYGYVV V ++Y  +N WM   VG ARKKY V YPTMYAIE+ENK+AK FNCVQ
Sbjct  5    VDMLPKEYGYVVAVFIVYMIMNFWMAISVGQARKKYNVMYPTMYAIESENKNAKPFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT-LGK  382
            RGHQNSLE MP FF  +++ GI HPLI+++LG++Y +SR+ YF  Y+ G+P+KR+  +G 
Sbjct  65   RGHQNSLEMMPTFFATLLVSGIHHPLIASTLGSLYTISRFFYFKNYSLGEPSKRFAGIGA  124

Query  383  YGFIAIFGLQICAISCAIKLL  445
              F ++ GL +C  S A+ LL
Sbjct  125  VSFPSLMGLIVCTGSFAVHLL  145



>gb|ABK23493.1| unknown [Picea sitchensis]
Length=148

 Score =   175 bits (444),  Expect = 4e-52, Method: Compositional matrix adjust.
 Identities = 80/137 (58%), Positives = 99/137 (72%), Gaps = 0/137 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LP  +G+VV+  V Y  LN+WM  QVG ARK+Y VPYP +YAIE+ENKDA LFNCVQRGH
Sbjct  5    LPPAFGWVVLTAVAYGVLNVWMSIQVGKARKRYNVPYPKLYAIESENKDANLFNCVQRGH  64

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN LE MPVFF+ +ILGG++HP+ S+  G +Y V R+ YFTGY+TG P  R T GKY  +
Sbjct  65   QNCLEVMPVFFLFLILGGLQHPIASSIFGVVYSVGRFFYFTGYSTGVPKNRLTYGKYNML  124

Query  395  AIFGLQICAISCAIKLL  445
             + GL  C +S A  LL
Sbjct  125  GLLGLMFCTLSLAWHLL  141



>gb|EYU25640.1| hypothetical protein MIMGU_mgv1a014345mg [Erythranthe guttata]
Length=192

 Score =   177 bits (448),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 96/148 (65%), Positives = 112/148 (76%), Gaps = 1/148 (1%)
 Frame = +2

Query  11   TAMAGVEIL-PKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAK  187
            + MAGVE+L PKEYGYVV+VLVLY  +N+WM  QVG AR+KYKV YP MYA   + KD  
Sbjct  45   SRMAGVELLLPKEYGYVVLVLVLYGLVNVWMALQVGKARRKYKVMYPIMYATADDTKDYN  104

Query  188  LFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            LFNCVQRGHQNSLE MP FF+L +LGGIRHPL+SASLG  Y  +R  YF GY+TG P  R
Sbjct  105  LFNCVQRGHQNSLEMMPTFFLLTVLGGIRHPLVSASLGLFYTFTRIFYFKGYSTGVPKNR  164

Query  368  YTLGKYGFIAIFGLQICAISCAIKLLTS  451
             ++GKY FIAIFGL IC IS  + LL +
Sbjct  165  LSIGKYNFIAIFGLMICTISLGVHLLRA  192



>ref|XP_008774995.1| PREDICTED: microsomal glutathione S-transferase 3-like [Phoenix 
dactylifera]
Length=148

 Score =   174 bits (442),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 108/140 (77%), Gaps = 1/140 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VEI P+EYGYVV+V+VLY FLN WMG QVG ARKKYKV YP +YAIE+ENKDAKLFNCVQ
Sbjct  5    VEI-PREYGYVVLVVVLYVFLNFWMGVQVGKARKKYKVFYPNLYAIESENKDAKLFNCVQ  63

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MPVFF  +++ G +HPLI+A LG  Y V+R+ YF GY+TG P  R  +G  
Sbjct  64   RGHQNSLEAMPVFFATLLVSGFQHPLIAAGLGVFYTVARFFYFKGYSTGVPENRLKIGGL  123

Query  386  GFIAIFGLQICAISCAIKLL  445
             F+A+FGL IC  S  I LL
Sbjct  124  NFVALFGLIICMASFGIHLL  143



>gb|ACG42477.1| microsomal glutathione S-transferase 3 [Zea mays]
Length=137

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 88/126 (70%), Positives = 106/126 (84%), Gaps = 0/126 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLV Y FLNLWMGFQVG AR+KYKV YPTMYAIE+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLVLVAYVFLNLWMGFQVGKARRKYKVFYPTMYAIESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QNSLE MPVFF++++LGG++HP I+A LG IYIV+R+ YF GYATG P  R  +G   ++
Sbjct  67   QNSLEWMPVFFVILLLGGLQHPTIAAGLGGIYIVARFFYFKGYATGVPDNRLKIGGLNYL  126

Query  395  AIFGLQ  412
            A+ G++
Sbjct  127  ALLGVE  132



>gb|ADP02229.1| putative MAPEG family protein [Aegilops tauschii]
 gb|EMT13060.1| hypothetical protein F775_31463 [Aegilops tauschii]
Length=180

 Score =   173 bits (439),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 79/121 (65%), Positives = 98/121 (81%), Gaps = 0/121 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA +  L KEYGYVV+ +V Y FLN WM FQVG ARKKYKV YPT+YA+E+ENKDAK FN
Sbjct  1    MAVLVELSKEYGYVVLTVVAYAFLNFWMSFQVGAARKKYKVFYPTLYAVESENKDAKRFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MP+FF+ ++LGG++HP+++A+LG +Y V+R+ YF GYATG P  R  L
Sbjct  61   CVQRGHQNSLEMMPLFFVTVLLGGLQHPVVAAALGVLYTVARFFYFKGYATGVPENRLKL  120

Query  377  G  379
            G
Sbjct  121  G  121



>gb|AAX95670.1| MAPEG family, putative [Oryza sativa Japonica Group]
Length=181

 Score =   173 bits (438),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 78/116 (67%), Positives = 94/116 (81%), Gaps = 0/116 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+ LV Y FLN WM FQVG AR+KYKV YPTMYA+E+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLALVAYAFLNFWMSFQVGKARRKYKVFYPTMYAVESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGK  382
            QNSLE MP+FF+ +++GG++HPL++A LG  Y V+R+ YF GYATG P  R  +G 
Sbjct  67   QNSLEMMPLFFVTLLVGGLQHPLVAAGLGVFYAVARFFYFKGYATGIPDNRLKIGS  122



>ref|XP_010916150.1| PREDICTED: microsomal glutathione S-transferase 3-like [Elaeis 
guineensis]
Length=148

 Score =   171 bits (432),  Expect = 3e-50, Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 111/140 (79%), Gaps = 1/140 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VEI P+EYG+VV+V+VLY FLN WM  QVG AR+KYKV YP +YAIE+ENKDAKLFNC+Q
Sbjct  5    VEI-PREYGFVVLVVVLYYFLNFWMAIQVGKARQKYKVSYPNLYAIESENKDAKLFNCIQ  63

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE+MPVFF+ +++GG++HP+I+A  G +Y ++R+ YF GY+TG P  R  +G  
Sbjct  64   RGHQNSLESMPVFFVTLLVGGVQHPVIAAGFGVLYTIARFFYFKGYSTGVPENRLKIGGL  123

Query  386  GFIAIFGLQICAISCAIKLL  445
             F+A+FGL IC  S  I LL
Sbjct  124  NFVALFGLVICTASFGIHLL  143



>ref|XP_009380081.1| PREDICTED: microsomal glutathione S-transferase 3-like [Musa 
acuminata subsp. malaccensis]
Length=148

 Score =   170 bits (430),  Expect = 5e-50, Method: Compositional matrix adjust.
 Identities = 88/143 (62%), Positives = 110/143 (77%), Gaps = 0/143 (0%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA    +P EYGYVV+VLVLY F NLWM FQVG ARKKYKV YP +YA+E+ENKDAKLFN
Sbjct  1    MAVTLDIPSEYGYVVVVLVLYMFFNLWMSFQVGKARKKYKVFYPALYAVESENKDAKLFN  60

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQNSLE MPVFF  +++GG+++PLI+A LGA Y V+R+ YF GY++G P  R  +
Sbjct  61   CVQRGHQNSLEMMPVFFATLLVGGLQYPLIAAGLGAFYTVARFFYFKGYSSGVPENRLKI  120

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G   F+A+FGL+I   +  I L+
Sbjct  121  GGLNFVALFGLKILTGAFGISLI  143



>gb|EMS50382.1| hypothetical protein TRIUR3_16900 [Triticum urartu]
Length=194

 Score =   171 bits (434),  Expect = 6e-50, Method: Compositional matrix adjust.
 Identities = 79/115 (69%), Positives = 94/115 (82%), Gaps = 0/115 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LPKEYGYVV+ +V Y FLN WM FQVG ARKKYKV YPTMYAIE+ENKDAK FNCVQRGH
Sbjct  7    LPKEYGYVVLTVVAYAFLNFWMSFQVGAARKKYKVFYPTMYAIESENKDAKPFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            QNS+E MP+FF  ++LGG++HP+I+A LG +Y V+R+ YF GYATG    R+ LG
Sbjct  67   QNSIEMMPLFFATLLLGGLQHPVIAAVLGLLYTVARFFYFKGYATGVRESRHKLG  121



>ref|NP_001136697.1| uncharacterized protein LOC100216831 [Zea mays]
 gb|ACF82424.1| unknown [Zea mays]
 tpg|DAA50951.1| TPA: hypothetical protein ZEAMMB73_520265 [Zea mays]
Length=121

 Score =   167 bits (423),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 86/115 (75%), Positives = 99/115 (86%), Gaps = 0/115 (0%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+VLV Y FLNLWMGFQVG AR+KYKV YPTMYAIE+ENKDAKLFNCVQRGH
Sbjct  7    LTKEYGYVVLVLVAYVFLNLWMGFQVGKARRKYKVFYPTMYAIESENKDAKLFNCVQRGH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            QNSLE MPVFF++++LGG++HP I+A LG IYIV+R+ YF GYATG P  R  +G
Sbjct  67   QNSLEWMPVFFVILLLGGLQHPTIAAGLGGIYIVARFFYFKGYATGVPDNRLKIG  121



>ref|XP_002464012.1| hypothetical protein SORBIDRAFT_01g010550 [Sorghum bicolor]
 gb|EER91010.1| hypothetical protein SORBIDRAFT_01g010550 [Sorghum bicolor]
Length=148

 Score =   162 bits (411),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 87/142 (61%), Positives = 109/142 (77%), Gaps = 1/142 (1%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A +E+   EYGYVV+VLV Y  LN WM FQVG AR+KYKV YPTMYA+E+ENKDAKLFNC
Sbjct  3    ASIEV-NNEYGYVVLVLVAYAVLNFWMSFQVGKARRKYKVFYPTMYAVESENKDAKLFNC  61

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            VQRGHQNSLE MP+FF++++LGG++HP+++A LGA+Y V+R+ YFTGYATG P  R  +G
Sbjct  62   VQRGHQNSLEMMPLFFVVLLLGGLQHPVVAAGLGALYTVARFFYFTGYATGVPANRTKIG  121

Query  380  KYGFIAIFGLQICAISCAIKLL  445
            +    A  GL IC     I L+
Sbjct  122  RLIIPAGGGLIICTALFGINLI  143



>ref|XP_007215117.1| hypothetical protein PRUPE_ppa012959mg [Prunus persica]
 gb|EMJ16316.1| hypothetical protein PRUPE_ppa012959mg [Prunus persica]
Length=147

 Score =   162 bits (410),  Expect = 6e-47, Method: Compositional matrix adjust.
 Identities = 92/140 (66%), Positives = 114/140 (81%), Gaps = 0/140 (0%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VE+LP+EYGYVV+VLVLY  LN WM  +VG ARKKYKVPYPT+YA E++NK+AK+FNCVQ
Sbjct  5    VELLPREYGYVVLVLVLYTLLNFWMAGKVGKARKKYKVPYPTLYASESDNKEAKVFNCVQ  64

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            RGHQNSLE MP+FF+L++LGG++HP ISA LG +Y V+RY YF GY+TGDP  R  +GKY
Sbjct  65   RGHQNSLELMPLFFVLLLLGGLKHPCISAGLGLLYTVTRYFYFKGYSTGDPENRLAVGKY  124

Query  386  GFIAIFGLQICAISCAIKLL  445
            GF+A+ G   C IS  + LL
Sbjct  125  GFLALLGHIACTISFGVTLL  144



>ref|XP_002970319.1| hypothetical protein SELMODRAFT_147110 [Selaginella moellendorffii]
 gb|EFJ28449.1| hypothetical protein SELMODRAFT_147110 [Selaginella moellendorffii]
Length=143

 Score =   158 bits (400),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA VE L   YG+VV+++V    LN+WM  QVG ARK+YKVPYPT+YA+E+ENK+AKLFN
Sbjct  1    MATVE-LSSSYGFVVLIVVAKFVLNVWMMLQVGKARKRYKVPYPTLYALESENKEAKLFN  59

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQN+LE MP+F  L++LGG+++P+++A  GA+YIV+RY YFTGY+TG P  R ++
Sbjct  60   CVQRGHQNTLELMPLFLTLLLLGGLKYPIVAALFGALYIVTRYFYFTGYSTGIPDNRLSI  119

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+ FI + GL +C     I LL
Sbjct  120  GKFSFIGLLGLLVCTFLFGIGLL  142



>ref|XP_002978482.1| hypothetical protein SELMODRAFT_271320 [Selaginella moellendorffii]
 gb|EFJ20468.1| hypothetical protein SELMODRAFT_271320 [Selaginella moellendorffii]
Length=143

 Score =   158 bits (400),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 83/143 (58%), Positives = 111/143 (78%), Gaps = 1/143 (1%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA VE L   YG+VV+++V    LN+WM  QVG ARK+YKVPYPT+YA+E+ENK+AKLFN
Sbjct  1    MATVE-LSSNYGFVVLIVVAKFVLNVWMMLQVGKARKRYKVPYPTLYALESENKEAKLFN  59

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQRGHQN+LE MP+F  L++LGG+++P+++A  GA+YIV+RY YFTGY+TG P  R ++
Sbjct  60   CVQRGHQNTLELMPLFLTLLLLGGLKYPIVAALFGALYIVTRYFYFTGYSTGIPDNRLSI  119

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            GK+ FI + GL +C     I LL
Sbjct  120  GKFSFIGLLGLLVCTFLFGIGLL  142



>ref|XP_008353856.1| PREDICTED: microsomal glutathione S-transferase 3-like [Malus 
domestica]
Length=109

 Score =   155 bits (393),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 71/105 (68%), Positives = 86/105 (82%), Gaps = 0/105 (0%)
 Frame = +2

Query  131  YKVPYPTMYAIEAENKDAKLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIY  310
            YKVPYPTMYA E+ENKDAK+FNCVQRGHQNSLE MP+FF+L++LGG++HP ISA+LG ++
Sbjct  2    YKVPYPTMYASESENKDAKVFNCVQRGHQNSLEMMPMFFVLLVLGGLKHPCISATLGFLF  61

Query  311  IVSRYGYFTGYATGDPTKRYTLGKYGFIAIFGLQICAISCAIKLL  445
              +RY YF GYATGDP  R  +GKYGF+AI GL  C IS  + LL
Sbjct  62   TFTRYFYFKGYATGDPMNRLAIGKYGFLAIIGLIGCTISFGVSLL  106



>ref|XP_001774813.1| predicted protein [Physcomitrella patens]
 gb|EDQ60354.1| predicted protein [Physcomitrella patens]
Length=143

 Score =   151 bits (382),  Expect = 8e-43, Method: Compositional matrix adjust.
 Identities = 69/125 (55%), Positives = 97/125 (78%), Gaps = 1/125 (1%)
 Frame = +2

Query  47   YGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQNSL  226
            YG+V++ L+   FL +WM  QVG ARKKYKV YP MYA+E+ENKDAK+FNCVQRGHQNSL
Sbjct  5    YGWVLVSLLANIFLMMWMAGQVGKARKKYKVYYPIMYALESENKDAKVFNCVQRGHQNSL  64

Query  227  ENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL-GKYGFIAIF  403
            E MP F ++++LGG+++P+++A  GA+Y V+R  YF GY+TG  + RY+  G + ++A+ 
Sbjct  65   EFMPTFMVMLLLGGLQYPIVAAIFGAVYTVARLQYFRGYSTGTASARYSSGGGFHWLALI  124

Query  404  GLQIC  418
            GL +C
Sbjct  125  GLLVC  129



>gb|EYU25641.1| hypothetical protein MIMGU_mgv1a014345mg [Erythranthe guttata]
Length=175

 Score =   147 bits (370),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 81/124 (65%), Positives = 95/124 (77%), Gaps = 1/124 (1%)
 Frame = +2

Query  11   TAMAGVEIL-PKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAK  187
            + MAGVE+L PKEYGYVV+VLVLY  +N+WM  QVG AR+KYKV YP MYA   + KD  
Sbjct  45   SRMAGVELLLPKEYGYVVLVLVLYGLVNVWMALQVGKARRKYKVMYPIMYATADDTKDYN  104

Query  188  LFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            LFNCVQRGHQNSLE MP FF+L +LGGIRHPL+SASLG  Y  +R  YF GY+TG P  R
Sbjct  105  LFNCVQRGHQNSLEMMPTFFLLTVLGGIRHPLVSASLGLFYTFTRIFYFKGYSTGVPKNR  164

Query  368  YTLG  379
             ++G
Sbjct  165  LSIG  168



>gb|ADU33211.1| microsomal glutathione S-transferase 3 [Pinctada martensii]
Length=146

 Score =   142 bits (358),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/140 (49%), Positives = 91/140 (65%), Gaps = 6/140 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
             EILPKEYG V+   +   F+N+WMG  V  ARKKY+VPYPTMY+      D+K FNC+Q
Sbjct  8    AEILPKEYGCVIFTGIATSFVNMWMGINVAKARKKYEVPYPTMYS-----ADSKEFNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F ML+ + G+ +P I+A  G++Y  SR  +  GY TGDP KR   G +
Sbjct  63   RAHQNTLERYPEFLMLLFVAGLEYPRIAAGAGSLYYASRIAFAMGYYTGDPEKR-RWGSF  121

Query  386  GFIAIFGLQICAISCAIKLL  445
            G+I +  L  C++  A+KLL
Sbjct  122  GYIGLLTLLGCSVGTALKLL  141



>ref|XP_001784409.1| predicted protein [Physcomitrella patens]
 gb|EDQ50761.1| predicted protein [Physcomitrella patens]
Length=147

 Score =   141 bits (356),  Expect = 7e-39, Method: Compositional matrix adjust.
 Identities = 67/114 (59%), Positives = 86/114 (75%), Gaps = 1/114 (1%)
 Frame = +2

Query  86   LNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQNSLENMPVFFMLMILG  265
            LN WMG  VG AR+++ VPYPTMYA E E+KDAK FNCVQR HQN+LE MP F +++ILG
Sbjct  22   LNQWMGIMVGKARRRFNVPYPTMYASEKEHKDAKAFNCVQRAHQNNLEFMPSFLVVLILG  81

Query  266  GIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT-LGKYGFIAIFGLQICAI  424
            G+++PL++ASLG IY ++R  YF GY++GD  KR++  G   F A FGL IC I
Sbjct  82   GLQYPLVAASLGTIYALARIQYFRGYSSGDAKKRFSGGGAVIFPAYFGLIICTI  135



>gb|ACL54043.1| unknown [Zea mays]
Length=103

 Score =   135 bits (339),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/98 (64%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +2

Query  152  MYAIEAENKDAKLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGY  331
            MYAIE+ENKDAKLFNCVQRGHQNSLE MPVFF++++LGG++HP I+A LG IYIV+R+ Y
Sbjct  1    MYAIESENKDAKLFNCVQRGHQNSLEWMPVFFVILLLGGLQHPTIAAGLGGIYIVARFFY  60

Query  332  FTGYATGDPTKRYTLGKYGFIAIFGLQICAISCAIKLL  445
            F GYATG P  R  +G   ++A+ GL IC  S  I LL
Sbjct  61   FKGYATGVPDNRLKIGGLNYLALLGLIICTASFGINLL  98



>gb|AET43969.1| microsomal GST3, partial [Reishia clavigera]
Length=138

 Score =   135 bits (340),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 67/137 (49%), Positives = 91/137 (66%), Gaps = 6/137 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            +  +YGYV++V+V    LN W+G QV  ARKKY V YPT+Y+     + +K FNCVQR H
Sbjct  5    IQNDYGYVLLVVVATWILNNWLGLQVMKARKKYDVQYPTLYS-----ETSKEFNCVQRAH  59

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LEN+P+F   ++L G++ P +SA  G IY+VSR  Y  GY TGDP+KR   G +G++
Sbjct  60   QNTLENIPMFLTFLLLAGLKFPRLSALFGVIYLVSRVVYAYGYYTGDPSKR-NRGAFGYV  118

Query  395  AIFGLQICAISCAIKLL  445
               GL +C I C I LL
Sbjct  119  GYIGLIVCTIICGIGLL  135



>gb|ELU09634.1| hypothetical protein CAPTEDRAFT_202245 [Capitella teleta]
Length=138

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 75/140 (54%), Positives = 97/140 (69%), Gaps = 7/140 (5%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +EILP E+GY V+V V   F+  WMG +VG AR+K+ V YPTMY+    +KD K FNCVQ
Sbjct  3    IEILP-EFGYCVLVAVGSVFIVQWMGIRVGMARRKFGVKYPTMYS----DKDDK-FNCVQ  56

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  PVF ML++LGGI HP ++A  GA+Y +SR  Y  GY TGDP+KR   G +
Sbjct  57   RAHQNTLEGYPVFLMLLLLGGIPHPTLAAGAGALYQLSRIVYALGYYTGDPSKR-NRGAF  115

Query  386  GFIAIFGLQICAISCAIKLL  445
            G++ +  L  CAIS  +KLL
Sbjct  116  GYLGLLTLLGCAISLGLKLL  135



>ref|XP_011418120.1| PREDICTED: microsomal glutathione S-transferase 3-like [Crassostrea 
gigas]
Length=146

 Score =   133 bits (334),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/140 (46%), Positives = 88/140 (63%), Gaps = 6/140 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            V+ LP  YG V+   +   F+NLWMG  V  ARK+Y VPYPTMY+      D K+FNC+Q
Sbjct  8    VDALPDHYGCVIFTGLTGTFINLWMGINVAKARKQYDVPYPTMYS-----SDNKMFNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LEN P+F ML+ +GG+++P  SA  G +Y +SR  Y  GY TGDP KR   G +
Sbjct  63   RTHQNTLENYPMFLMLLFIGGLQYPRTSACAGTLYNLSRIVYAKGYYTGDPEKR-GWGSF  121

Query  386  GFIAIFGLQICAISCAIKLL  445
              +A+  +  C +  A++ L
Sbjct  122  SLVALIAMLGCTVGVALRQL  141



>ref|XP_011418119.1| PREDICTED: microsomal glutathione S-transferase 3-like [Crassostrea 
gigas]
Length=146

 Score =   132 bits (331),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 89/140 (64%), Gaps = 6/140 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            V+ LP  YG V+   V   F+N+WMG  V  ARK+Y++PYPTMY+      D K+FNC+Q
Sbjct  8    VDALPDHYGCVIFTGVASTFVNMWMGINVAKARKQYEIPYPTMYS-----SDNKMFNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LEN P F ML+ +GG+++P  SA  G +Y +SR  +  GY TG+P KR   G +
Sbjct  63   RAHQNTLENYPQFLMLLFIGGLQYPRTSACAGTLYQLSRIFFAKGYYTGEPEKR-RWGSF  121

Query  386  GFIAIFGLQICAISCAIKLL  445
            G+I +  +  C +  A++ L
Sbjct  122  GYIGLITMLGCTVGVALRQL  141



>ref|XP_001774848.1| predicted protein [Physcomitrella patens]
 gb|EDQ60389.1| predicted protein [Physcomitrella patens]
Length=147

 Score =   128 bits (322),  Expect = 9e-34, Method: Compositional matrix adjust.
 Identities = 62/127 (49%), Positives = 88/127 (69%), Gaps = 1/127 (1%)
 Frame = +2

Query  47   YGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQNSL  226
            Y +V+ VL+    L  WM  +VG AR+K+KVPYP MYA E E+KDAK+FNCVQR HQN+L
Sbjct  9    YRWVLAVLIANVALVGWMAKKVGGARRKFKVPYPIMYADEKEHKDAKIFNCVQRAHQNTL  68

Query  227  ENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT-LGKYGFIAIF  403
            E +P F   +++GG+  P  +A+LGAI+ ++R  YF  Y+ GDP+KR+   G+  F A+ 
Sbjct  69   ELLPAFMAALLVGGLEFPRTAAALGAIHFLARIQYFKNYSVGDPSKRFAGGGRAVFPALS  128

Query  404  GLQICAI  424
            GL + +I
Sbjct  129  GLLLFSI  135



>gb|KDO34209.1| hypothetical protein SPRG_01432 [Saprolegnia parasitica CBS 223.65]
Length=144

 Score =   127 bits (318),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 65/140 (46%), Positives = 88/140 (63%), Gaps = 2/140 (1%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L  E+GYV++V++L  F+N W G +VG ARK+Y + YP MYA E  +K+   FNCVQR 
Sbjct  6    VLAPEHGYVILVVILTGFVNAWAGMKVGGARKRYNIKYPQMYA-EVSDKNFNAFNCVQRA  64

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN LEN+PVFF L+I   I  P  +A  G + ++    Y  GYATGDP KR   G +G+
Sbjct  65   HQNVLENLPVFFALLITSSIYRPGYAAIAGLVRVLGFIVYVQGYATGDPAKRMH-GGFGY  123

Query  392  IAIFGLQICAISCAIKLLTS  451
            + +F     +I  AI LL S
Sbjct  124  LGLFASLGLSIEAAITLLYS  143



>ref|XP_002112701.1| expressed hypothetical protein [Trichoplax adhaerens]
 gb|EDV24811.1| expressed hypothetical protein [Trichoplax adhaerens]
Length=139

 Score =   125 bits (315),  Expect = 7e-33, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 89/138 (64%), Gaps = 6/138 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LPK+YGY V++      + +++G +VG ARK++ V YP MY     + D  +FNC QR H
Sbjct  6    LPKDYGYCVLIAADSVLVLIYLGIRVGRARKQFGVEYPKMY-----DDDKPIFNCFQRAH  60

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LE+ P F  +M+LGG++HP +SA+ GA++++SR  Y  GY TGDP KR   G +G I
Sbjct  61   QNTLEHYPQFLSMMLLGGLQHPRLSAAFGAVWVLSRLFYAHGYYTGDPAKRMR-GAWGGI  119

Query  395  AIFGLQICAISCAIKLLT  448
               G+  CAIS  + LL 
Sbjct  120  GFLGVIGCAISFGLNLLE  137



>ref|XP_009862173.1| PREDICTED: microsomal glutathione S-transferase 3-like [Ciona 
intestinalis]
Length=222

 Score =   126 bits (316),  Expect = 4e-32, Method: Compositional matrix adjust.
 Identities = 62/131 (47%), Positives = 85/131 (65%), Gaps = 6/131 (5%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            +A +E LP EYGYV++ +    F+ + +G  VG ARKKY VPYP MY+ E EN    +FN
Sbjct  2    VAPIEFLPNEYGYVILCVFYAMFVTIHLGINVGKARKKYNVPYPNMYS-EKEN----IFN  56

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE +P F + +++ G+ +P  +A  GA+Y+ SRY Y  GY TGDP KR   
Sbjct  57   CIQRAHQNTLEQLPTFLVCLLMVGVAYPKYAAICGAVYVTSRYNYAWGYYTGDPKKRLN-  115

Query  377  GKYGFIAIFGL  409
            G+YG     GL
Sbjct  116  GEYGVAGFLGL  126



>ref|XP_011449765.1| PREDICTED: microsomal glutathione S-transferase 3-like [Crassostrea 
gigas]
 gb|EKC22868.1| Microsomal glutathione S-transferase 3 [Crassostrea gigas]
Length=142

 Score =   124 bits (310),  Expect = 5e-32, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 89/138 (64%), Gaps = 7/138 (5%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L  ++GYVV+V++   F+ +WMG +VG ARKKY+VPYP MY+ +        FNC QR 
Sbjct  7    VLSGDFGYVVLVMIFSVFMLMWMGGKVGGARKKYEVPYPKMYSEDDR------FNCYQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LEN PV+ +L +L G+  P ++A  GA++   R  Y  GY TGDP+KR   G + +
Sbjct  61   HQNTLENYPVYLLLQVLSGLYAPKLAALAGAVWCAGRIVYAIGYYTGDPSKR-IRGAFAY  119

Query  392  IAIFGLQICAISCAIKLL  445
            I +  + +C+I  A+ LL
Sbjct  120  IGLLTMLVCSIIFALNLL  137



>gb|EFX85348.1| hypothetical protein DAPPUDRAFT_230545 [Daphnia pulex]
Length=139

 Score =   123 bits (309),  Expect = 6e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 88/143 (62%), Gaps = 7/143 (5%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  YG V++V +   FL  W G QVG  RKK+K+ YPTMY+      D  LFN
Sbjct  1    MVVIELLP-HYGSVILVGIASAFLLTWQGIQVGKMRKKFKITYPTMYS-----NDNTLFN  54

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C QR HQN+LEN P F ML+ +GG+++PL++A  G ++I  +  Y  GY TGDP KR   
Sbjct  55   CYQRAHQNTLENYPQFLMLLFIGGLQYPLVTAVAGLVWIAGKVSYSLGYYTGDPAKRMR-  113

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G Y +I +  +   ++  A KLL
Sbjct  114  GGYSYIGLLTMLGTSLCFAFKLL  136



>ref|XP_793267.2| PREDICTED: microsomal glutathione S-transferase 3-like [Strongylocentrotus 
purpuratus]
Length=186

 Score =   124 bits (312),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 64/143 (45%), Positives = 84/143 (59%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +  LPKEYGYVV+V     F+  ++  QVG ARKKY V YPTMY+          FN
Sbjct  37   MTVLSTLPKEYGYVVLVGAASAFMVQFLAIQVGRARKKYGVEYPTMYS-----DTIPAFN  91

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            CVQR HQN+LEN P F ML+   G+  P  +A LG ++++SR  Y  GY +GDP KR   
Sbjct  92   CVQRAHQNTLENYPQFLMLLFFSGLERPRAAAGLGGLWVLSRITYAFGYYSGDPNKR-RR  150

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G +G+I   GL    +  A ++L
Sbjct  151  GAFGYIGTMGLMSLTVRSAFRML  173



>ref|XP_010877546.1| PREDICTED: microsomal glutathione S-transferase 3-like [Esox 
lucius]
Length=140

 Score =   123 bits (308),  Expect = 7e-32, Method: Compositional matrix adjust.
 Identities = 61/143 (43%), Positives = 92/143 (64%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV++  +   F+  ++GF+VG ARKKY V YPTMY+        ++FN
Sbjct  1    MDILELLPSSFGYVILTYLYSWFMLSYLGFKVGGARKKYDVKYPTMYS-----DTNQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P+ ++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEIYPQWLVFQTIAALVYPISASVLGAIWVTSRFSYAWGYYTGDPAKRMN-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I   G+ I +IS A++LL
Sbjct  115  GVYGYIGYLGVIILSISVALQLL  137



>ref|XP_009053884.1| hypothetical protein LOTGIDRAFT_232059 [Lottia gigantea]
 gb|ESO95374.1| hypothetical protein LOTGIDRAFT_232059 [Lottia gigantea]
Length=144

 Score =   122 bits (307),  Expect = 1e-31, Method: Compositional matrix adjust.
 Identities = 58/114 (51%), Positives = 76/114 (67%), Gaps = 5/114 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E LP EYGYV++V  L   +N+WM F+VG ARKKY V YP +Y+   +N D   FNC+Q
Sbjct  8    IEFLPNEYGYVILVGCLSVAVNMWMAFKVGAARKKYGVEYPKLYS---DNNDT--FNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            R HQN+LE  P F  L+ +GG+ +P+  A LG IY++ R  Y  GY TGDP KR
Sbjct  63   RAHQNTLEGYPQFLFLLFVGGLNNPIWVAGLGVIYLLGRIAYALGYHTGDPEKR  116



>gb|ABD67515.1| microsomal glutathione S-transferase 3 [Cyprinus carpio]
Length=140

 Score =   121 bits (303),  Expect = 4e-31, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 91/140 (65%), Gaps = 8/140 (6%)
 Frame = +2

Query  29   EILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
             +LP  +GY +    LY F+ L ++G QVG+ARKKY V YPTMY+        ++FNC+Q
Sbjct  5    NLLPANFGYAIFTY-LYSFVMLMYLGLQVGSARKKYGVKYPTMYS-----DKEQVFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P + +   +  + +P+ ++ LG I++ SR+ Y  GY++GDP KR   G Y
Sbjct  59   RAHQNTLEVYPQWLVFQTIAALEYPIAASVLGVIWVTSRFSYAWGYSSGDPAKRMR-GAY  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G+I +FG+ + +IS A+KLL
Sbjct  118  GYIGLFGVILLSISVALKLL  137



>ref|XP_005649780.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
 gb|EIE25236.1| glutathione S-transferase [Coccomyxa subellipsoidea C-169]
Length=142

 Score =   121 bits (303),  Expect = 5e-31, Method: Compositional matrix adjust.
 Identities = 66/137 (48%), Positives = 87/137 (64%), Gaps = 3/137 (2%)
 Frame = +2

Query  44   EYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQN  220
            E+GYVV+V+     ++  +M F V  ARKKY V YP +YA + ENKDA+LF+CVQRGHQN
Sbjct  6    EFGYVVLVVFASILVHHGYMAFSVVKARKKYNVKYPALYA-DKENKDAELFDCVQRGHQN  64

Query  221  SLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFIAI  400
            SLEN P F   +IL G+ +P+ SA  G IY++ R  YF GYATG P KR     + F  +
Sbjct  65   SLENYPQFLACLILAGLSYPVTSAITGVIYLIGRIVYFQGYATGVPGKRLRGAFFNFAML  124

Query  401  FGLQICAISCAIKLLTS  451
            F   +  +  AI +L S
Sbjct  125  FFYGLL-VKSAISMLQS  140



>ref|XP_001744478.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ90427.1| predicted protein [Monosiga brevicollis MX1]
Length=146

 Score =   121 bits (303),  Expect = 6e-31, Method: Compositional matrix adjust.
 Identities = 62/130 (48%), Positives = 83/130 (64%), Gaps = 7/130 (5%)
 Frame = +2

Query  47   YGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAE-----NKDAKLFNCVQRG  211
            +GYV +V + +  + L+  F+VG ARKK+K+ YPTMYA   +      KDA LFNCVQR 
Sbjct  8    FGYVGLVAIEHLIVCLYFSFRVGGARKKWKIGYPTMYARPGDGKCTTKKDADLFNCVQRA  67

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN LEN P F  L+ L  I++PL +A  G +Y+ SR+ Y  GY TGDP KR+  + G  
Sbjct  68   HQNLLENTPTFLTLLFLAAIKYPLYTAIGGQVYVASRFFYALGYCTGDPEKRHRGSFGYI  127

Query  386  GFIAIFGLQI  415
            G IA+ G+ I
Sbjct  128  GLIAMLGMAI  137



>gb|KIY95910.1| glutathione S-transferase [Monoraphidium neglectum]
Length=265

 Score =   124 bits (311),  Expect = 7e-31, Method: Compositional matrix adjust.
 Identities = 62/141 (44%), Positives = 89/141 (63%), Gaps = 8/141 (6%)
 Frame = +2

Query  2    RKKTAMAGVEILPKEYGYVV-IVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIE---A  169
            RKK  +  V   PKE+G V    +  +   +++M  +V  ARKKY+V YP +YA +    
Sbjct  114  RKKRQLLAV---PKEFGLVAGTAVASFVVHHIYMATKVVKARKKYEVKYPALYADKDNCP  170

Query  170  ENKDAKLFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYAT  349
               +   FNCVQRGHQNSLEN+P F  L+ + G++HPL +++ GA Y++ R  YF GY++
Sbjct  171  NEANRTAFNCVQRGHQNSLENLPTFLGLLTIAGLKHPLTASAFGAAYLLGRIAYFEGYSS  230

Query  350  GDPTKRYTLGKY-GFIAIFGL  409
            GDPTKR  +G   G+I +FGL
Sbjct  231  GDPTKRVNVGTLIGYIGLFGL  251



>gb|ACI67512.1| Microsomal glutathione S-transferase 3 [Salmo salar]
 gb|ACI69126.1| Microsomal glutathione S-transferase 3 [Salmo salar]
 gb|ADM16033.1| Microsomal glutathione S-transferase 3 [Salmo salar]
Length=140

 Score =   120 bits (301),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV+        +  ++G +VG ARKKY V YPTMY     +   ++FN
Sbjct  1    MEILELLPSSFGYVIFTYFYSWIMLTYLGVKVGAARKKYDVKYPTMY-----SDKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTYAAVLGAIWVTSRFSYAWGYYTGDPAKRMK-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ I +I+ A++LL
Sbjct  115  GAYGYIGYFGVIILSIAVALQLL  137



>ref|NP_001039212.1| microsomal glutathione S-transferase 3-like [Xenopus (Silurana) 
tropicalis]
 emb|CAJ82262.1| microsomal glutathione S-transferase 3-like [Xenopus (Silurana) 
tropicalis]
 gb|AAI67568.1| LOC734071 protein [Xenopus (Silurana) tropicalis]
Length=141

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 59/139 (42%), Positives = 89/139 (64%), Gaps = 7/139 (5%)
 Frame = +2

Query  29   EILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQR  208
            ++LP  + YV+   +   F+ +++  +V  ARKKY V YP MY     +KD ++FNCVQR
Sbjct  7    DVLPSNFAYVIFTYIYSVFMIMYLSMKVMGARKKYGVKYPEMY-----SKD-QMFNCVQR  60

Query  209  GHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYG  388
             HQN++E  PV+ +  ++ G+  PL +A LGAI++ SR+ Y  GY TGDP KR     YG
Sbjct  61   AHQNTMEVYPVWVIFQLIAGLAFPLAAAVLGAIWVTSRFSYAWGYYTGDPQKRMK-AAYG  119

Query  389  FIAIFGLQICAISCAIKLL  445
            +I  FGL + +I+ A++LL
Sbjct  120  YIGYFGLMLLSIAAALQLL  138



>gb|ACO07591.1| Microsomal glutathione S-transferase 3 [Oncorhynchus mykiss]
Length=140

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV+        +  ++G +VG ARKKY V YPTMY     +   ++FN
Sbjct  1    MEILELLPSSFGYVIFTYFYSWIMLSYLGVKVGAARKKYDVKYPTMY-----SDKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTSAAVLGAIWVTSRFSYAWGYYTGDPAKRME-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ I +I+ A++LL
Sbjct  115  GAYGYIGYFGVIILSIAVALQLL  137



>ref|XP_005830329.1| hypothetical protein GUITHDRAFT_110766 [Guillardia theta CCMP2712]
 gb|EKX43349.1| hypothetical protein GUITHDRAFT_110766 [Guillardia theta CCMP2712]
Length=148

 Score =   120 bits (300),  Expect = 1e-30, Method: Compositional matrix adjust.
 Identities = 60/142 (42%), Positives = 89/142 (63%), Gaps = 1/142 (1%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E+LP+EYGYV IV+VL   LN+++   V +ARKKY + YP +YA      +   FNC+Q
Sbjct  7    LEVLPREYGYVCIVVVLGFILNMYLTMNVVSARKKYGIKYPALYAPPGHKHEVA-FNCIQ  65

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE      + M+L G+++P+ SA LGA++++ R+ Y  GY+TGDP +R+  G  
Sbjct  66   RAHQNTLETFAFVMIRMLLCGVQYPIASAFLGALWVIGRFVYGYGYSTGDPNERFKGGII  125

Query  386  GFIAIFGLQICAISCAIKLLTS  451
             F+A   L +     A   LTS
Sbjct  126  SFLADMPLTLLTGKLAYDFLTS  147



>ref|XP_005706127.1| glutathione S-transferase [Galdieria sulphuraria]
 gb|EME29607.1| glutathione S-transferase [Galdieria sulphuraria]
Length=152

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 55/119 (46%), Positives = 78/119 (66%), Gaps = 4/119 (3%)
 Frame = +2

Query  11   TAMAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL  190
            +  +G  ++P+EYGYV++V+V + F+ +W   +VG ARK++ V YPTMY    ENK+   
Sbjct  10   SGKSGTLLVPREYGYVILVVVFFIFILVWKEIKVGQARKRFNVKYPTMY----ENKEDSH  65

Query  191  FNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            FNC QR HQN+LE  P F +LM+LGG+  P+ S+  G I+   R  Y  GY +GDP KR
Sbjct  66   FNCYQRAHQNTLEKTPTFLVLMLLGGLYAPIFSSISGLIWCFGRIQYALGYYSGDPKKR  124



>gb|ACO07847.1| Microsomal glutathione S-transferase 3 [Oncorhynchus mykiss]
 gb|ACO08265.1| Microsomal glutathione S-transferase 3 [Oncorhynchus mykiss]
 gb|ACO08360.1| Microsomal glutathione S-transferase 3 [Oncorhynchus mykiss]
 emb|CDQ78421.1| unnamed protein product [Oncorhynchus mykiss]
Length=140

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV+        +  ++G +VG ARKKY V YPTMY     +   ++FN
Sbjct  1    MEILELLPSSFGYVIFTYFYSWIMLSYLGVKVGAARKKYDVKYPTMY-----SDKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTSAAVLGAIWVTSRFSYAWGYYTGDPAKRMK-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ I +I+ A++LL
Sbjct  115  GAYGYIGYFGVIILSIAVALQLL  137



>gb|ACO08774.1| Microsomal glutathione S-transferase 3 [Oncorhynchus mykiss]
Length=140

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV+        +  ++G +VG ARKKY V YPTMY     +   ++FN
Sbjct  1    MEILELLPSSFGYVIFTYFYSWIMMSYLGVKVGAARKKYDVKYPTMY-----SDKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A LGA+++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTSAAVLGAVWVTSRFSYAWGYYTGDPAKRMK-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ I +I+ A++LL
Sbjct  115  GAYGYIGYFGVIILSIAVALQLL  137



>ref|NP_001006890.1| microsomal glutathione S-transferase 3 [Xenopus (Silurana) tropicalis]
 gb|AAH77689.1| microsomal glutathione S-transferase 3 [Xenopus (Silurana) tropicalis]
Length=147

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 87/141 (62%), Gaps = 7/141 (5%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+       +   +   VG ARK+YKV YP MY+ + EN +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGAASFIMVTHLAINVGKARKQYKVEYPKMYSDDPENGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE+ P F   + +GG+ HP  +++LG  +IV R  Y  GY+TGDP+KR    +G +
Sbjct  61   HQNTLESYPPFLFFLAVGGLTHPRATSALGVAWIVGRELYAHGYSTGDPSKRKRGAIGSF  120

Query  386  GFIAIFGLQICAISCAIKLLT  448
              + +FG  +C+   A K+L 
Sbjct  121  ALLGLFGATVCS---AFKILN  138



>gb|ACI68823.1| Microsomal glutathione S-transferase 3 [Salmo salar]
Length=143

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+LP  +GYV+        +  ++G +VG ARKKY V YPTMY     +   ++FN
Sbjct  1    MEILELLPSSFGYVIFTYFYSWIMLTYLGVKVGAARKKYDVKYPTMY-----SDKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A +GAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTYAAVMGAIWVTSRFSYAWGYYTGDPAKRMK-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ I +I+ A++LL
Sbjct  115  GAYGYIGYFGVIILSIAVALQLL  137



>gb|ELU09829.1| hypothetical protein CAPTEDRAFT_172925 [Capitella teleta]
Length=159

 Score =   120 bits (300),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 65/136 (48%), Positives = 82/136 (60%), Gaps = 5/136 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E++P  YGYVV   V   F N+WMG  VG ARK+  V YP MY+ E  N+    FNC+Q
Sbjct  8    LEVMPAGYGYVVFTAVGSIFTNMWMGINVGRARKRLGVKYPAMYS-ETSNE----FNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQNSLE  P F  L+I+GG+++P ISA LG +YI+ R  +  GY TG+P KR   G  
Sbjct  63   RAHQNSLEGHPSFLFLLIVGGLQYPKISAVLGHVYILGRIAFTLGYYTGEPDKRKCGGVI  122

Query  386  GFIAIFGLQICAISCA  433
              IA   L  C  S A
Sbjct  123  MHIAELLLLGCTTSFA  138



>ref|XP_003468711.1| PREDICTED: microsomal glutathione S-transferase 3 [Cavia porcellus]
Length=156

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVMLTGAASFVMVLHLAMNVGKARKKYKVEYPVMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KRY   +G
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRYRGAMG  118

Query  380  KYGFIAIFGLQICA  421
             +  +A+ G  +C+
Sbjct  119  SFALLALMGTTVCS  132



>emb|CEP15667.1| hypothetical protein [Parasitella parasitica]
Length=147

 Score =   119 bits (299),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 64/141 (45%), Positives = 90/141 (64%), Gaps = 5/141 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQV-GTARKKYKVPYPTMYAIEAE-NKDAK--LFNCV  202
            +P EYGYV+ V V       ++GF+V G AR+  KVPYP MYA ++E  KD K  +FNC 
Sbjct  6    IPSEYGYVLGVAVASALYTFYLGFKVVGGARRAAKVPYPYMYAEKSEAEKDPKKNIFNCA  65

Query  203  QRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGK  382
            QR HQN+LE +PV+  L+++GG+++P ISA+ G ++I+ R  Y  GY TGDP KR T G 
Sbjct  66   QRAHQNTLEMLPVYNTLLLVGGLKYPEISATAGVVFILGRIVYVKGYVTGDPAKR-TRGA  124

Query  383  YGFIAIFGLQICAISCAIKLL  445
            +G + +  L   A S    L+
Sbjct  125  FGVLGLITLLGTAASTVYSLV  145



>ref|XP_007238632.1| PREDICTED: microsomal glutathione S-transferase 3-like [Astyanax 
mexicanus]
Length=140

 Score =   119 bits (298),  Expect = 2e-30, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 92/143 (64%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  ++ILP  +GYV++  +    +  ++  +VG ARKKY + YPTMY+   + +D  +FN
Sbjct  1    MEIIDILPANFGYVILTYLYSWIMLTYLAVKVGGARKKYNIKYPTMYS---DKED--VFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P +++ LG I++ SR+ Y  GY TG+P KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTVASVLGVIWVTSRFSYAWGYYTGNPVKRMN-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I +FG+ I +IS A++LL
Sbjct  115  GSYGYIGLFGVMILSISVALQLL  137



>ref|XP_004994659.1| microsomal glutathione S-transferase 3 [Salpingoeca rosetta]
 gb|EGD72836.1| microsomal glutathione S-transferase 3 [Salpingoeca rosetta]
Length=144

 Score =   119 bits (298),  Expect = 3e-30, Method: Compositional matrix adjust.
 Identities = 63/140 (45%), Positives = 84/140 (60%), Gaps = 6/140 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAI--EAENKDAKL---FNC  199
            L KEY +V +V + Y  +  WM  +VG AR+K++V YPTMYA   +   KD K    +NC
Sbjct  3    LSKEYAFVGLVTIEYALVIAWMAHRVGKARRKFQVAYPTMYARIGDGNIKDEKALLEYNC  62

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
             QR HQNS+EN P F  L+ L  +  P  +A  G I+IV+R  YF GY TGDP KR   G
Sbjct  63   TQRAHQNSVENSPTFLSLLALASVSFPTYAAIAGQIWIVARIAYFGGYCTGDPKKRLR-G  121

Query  380  KYGFIAIFGLQICAISCAIK  439
             +G+I + GL   A++  IK
Sbjct  122  TFGYIGLIGLLGMALATCIK  141



>ref|NP_001091371.1| uncharacterized protein LOC100037213 [Xenopus laevis]
 gb|AAI29734.1| LOC100037213 protein [Xenopus laevis]
 gb|AAI33775.1| LOC100037213 protein [Xenopus laevis]
Length=141

 Score =   119 bits (297),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 87/139 (63%), Gaps = 7/139 (5%)
 Frame = +2

Query  29   EILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQR  208
            ++LP  + YV+   +   F+ +++  +V  ARKKY V YP MY+ E       LFNC QR
Sbjct  7    DVLPSHFAYVIFTYIYSVFMIMYLSMKVMGARKKYGVKYPDMYSKE------PLFNCFQR  60

Query  209  GHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYG  388
             HQN++E  P++ +  ++ G+  PL +A LGAI++ SR+ Y  GY TGDP KR   G YG
Sbjct  61   AHQNTMEVYPIWLVFQLIAGLAFPLSAAVLGAIWVTSRFSYAWGYYTGDPEKRMK-GMYG  119

Query  389  FIAIFGLQICAISCAIKLL  445
            +I  FGL + +I+ A++LL
Sbjct  120  YIGYFGLMLLSIATALQLL  138



>ref|NP_001073503.1| microsomal glutathione S-transferase-like [Danio rerio]
 gb|AAI28856.1| Zgc:158387 [Danio rerio]
Length=140

 Score =   118 bits (296),  Expect = 4e-30, Method: Compositional matrix adjust.
 Identities = 59/143 (41%), Positives = 92/143 (64%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA   +LP  +GY ++V V    + +++G +VG ARKK+ V YPTMY+    +KD ++FN
Sbjct  1    MAIESVLPANFGYAILVYVYSFVMLMYLGMKVGAARKKFGVKYPTMYS----DKD-QIFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  ++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLLFQTIAALHYPSAASVLGAIWVTSRFSYAWGYYTGDPAKR-MH  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I +FG+ + +I  A+ L+
Sbjct  115  GVYGYIGLFGVLLISIYVALNLI  137



>gb|ADO28117.1| microsomal glutathione S-transferase 3 [Ictalurus furcatus]
Length=140

 Score =   118 bits (295),  Expect = 6e-30, Method: Compositional matrix adjust.
 Identities = 60/143 (42%), Positives = 90/143 (63%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  ++ILP  +GYV++       +  ++G  VG ARKKY V YPTMY+    +KD  +FN
Sbjct  1    MEILDILPANFGYVILTYFYSWVMLTYLGVNVGRARKKYDVKYPTMYS----DKD-DVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +P  +A LG I++ SR+ Y  GY TG+P KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPTAAAVLGVIWVTSRFSYAWGYYTGNPAKRMN-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I +FG+ I ++S A++LL
Sbjct  115  GVYGYIGLFGVIILSLSVALQLL  137



>ref|XP_003446236.1| PREDICTED: microsomal glutathione S-transferase 3-like [Oreochromis 
niloticus]
Length=140

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 90/144 (63%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GYV+    LY ++ L ++  +VG ARKKY V YPTMY+        ++F
Sbjct  1    MDALTVLPSSFGYVIFTF-LYSWIMLGYLAVKVGGARKKYNVKYPTMYS-----DKEQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE  P + +   +  + +PL ++ LG I++ SR+ Y  GY TGDP KR  
Sbjct  55   NCIQRAHQNTLEVYPQWLVFQTIAALVYPLSASVLGVIWVTSRFSYAWGYYTGDPAKRMN  114

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+ I +IS A++LL
Sbjct  115  -GAYGYIGYFGVIILSISVALQLL  137



>ref|XP_005922361.1| PREDICTED: microsomal glutathione S-transferase 3-like [Haplochromis 
burtoni]
Length=140

 Score =   117 bits (294),  Expect = 9e-30, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 91/144 (63%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GYV++   LY ++ L ++  +VG ARKKY V YPTMY+        ++F
Sbjct  1    MDALTVLPSNFGYVILTY-LYSWIMLGYLAVKVGGARKKYNVKYPTMYS-----DKEQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE  P + +   +  + +PL ++ LG I++ SR+ Y  GY TGDP KR  
Sbjct  55   NCIQRAHQNTLEVYPQWLVFQTIAALVYPLSASVLGVIWVTSRFSYAWGYYTGDPAKRMN  114

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+ I +IS A++LL
Sbjct  115  -GAYGYIGYFGVIILSISVALQLL  137



>gb|AII16517.1| microsomal glutathione S-transferase 3, partial [Paracyclopina 
nana]
Length=141

 Score =   117 bits (293),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 58/141 (41%), Positives = 84/141 (60%), Gaps = 4/141 (3%)
 Frame = +2

Query  23   GVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCV  202
            GV I P E+GYVV       F+ ++    VG ARKKY + YP MY+   EN    +FNC+
Sbjct  2    GVSI-PSEFGYVVFTGTASAFVLMYKAINVGMARKKYGIKYPKMYS--EENGGDNMFNCI  58

Query  203  QRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGK  382
            QR HQNSLEN P F  ++  GG+ HP++++  G IY+  R  +  GY TG+P  R   G 
Sbjct  59   QRAHQNSLENYPQFLWVLFTGGLAHPVVASIAGWIYMAGRIAFAKGYYTGNPENR-RWGS  117

Query  383  YGFIAIFGLQICAISCAIKLL  445
            +G+I +F L  C++   +++L
Sbjct  118  FGYIGMFTLIGCSVHSGLRML  138



>ref|XP_007554970.1| PREDICTED: microsomal glutathione S-transferase 3 [Poecilia formosa]
Length=154

 Score =   117 bits (293),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 87/138 (63%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  V    +   + F+VG ARKKY V YP MY+ + E+    +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGVASMIMIGHLAFKVGKARKKYNVLYPKMYSDDPEH--GHIFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+  P +++ LGA++IVSR  Y  GY+TGDP KR   G +G 
Sbjct  61   HQNTLEVYPPFLFCLAIGGLHCPRLASGLGAVWIVSREVYAHGYSTGDPKKRMR-GAFGN  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ GL +  +S    LL
Sbjct  120  VALLGLMLTTLSYGGHLL  137



>ref|XP_009022538.1| hypothetical protein HELRODRAFT_67163 [Helobdella robusta]
 gb|ESN98716.1| hypothetical protein HELRODRAFT_67163 [Helobdella robusta]
Length=146

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 56/111 (50%), Positives = 76/111 (68%), Gaps = 5/111 (5%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            +P  YGYVV+  + + FLN W+  +V  ARKKYK+ YPTMY+  A+N+D   FNC+QR H
Sbjct  10   VPDGYGYVVLAGIGHVFLNTWLAMKVVNARKKYKIEYPTMYS--ADNQD---FNCIQRAH  64

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            QN+LEN P +  L+++GG+++P I A  GA YIV R  Y  GY TG+P  R
Sbjct  65   QNTLENYPTYLFLLLVGGLQYPKIVAGTGAFYIVCRIIYAKGYYTGEPKNR  115



>emb|CDS12800.1| hypothetical protein LRAMOSA04984 [Absidia idahoensis var. thermophila]
Length=149

 Score =   117 bits (292),  Expect = 2e-29, Method: Compositional matrix adjust.
 Identities = 61/124 (49%), Positives = 84/124 (68%), Gaps = 3/124 (2%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAI--EAENK-DAKLFNCVQ  205
            L +E+G+++ VL+L  F    M  +VG ARK   VPYP +YA   EAEN+ D  +FNCVQ
Sbjct  6    LSQEHGFILSVLLLSLFQLFAMTMRVGRARKVAGVPYPYVYAEKNEAENEFDKHVFNCVQ  65

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F +L++LGGI HPLI+A  G  Y+++R  Y  GY+TG+P+KR T  ++
Sbjct  66   RVHQNTLETYPSFAILLVLGGISHPLITAGAGFFYLITREVYARGYSTGEPSKRATGVRF  125

Query  386  GFIA  397
              IA
Sbjct  126  AAIA  129



>ref|XP_004566633.1| PREDICTED: microsomal glutathione S-transferase 3-like [Maylandia 
zebra]
Length=140

 Score =   116 bits (291),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 91/144 (63%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GYV++   LY ++ L ++  +VG ARKKY V YPTMY+        ++F
Sbjct  1    MDPLTVLPSNFGYVILTY-LYSWIMLGYLAVKVGGARKKYNVKYPTMYS-----DKEQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE  P + +   +  + +PL ++ LG I++ SR+ Y  GY TGDP KR  
Sbjct  55   NCIQRAHQNTLEVYPQWLVFQTIAALVYPLSASVLGDIWVTSRFSYAWGYYTGDPAKRMN  114

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+ I +IS A++LL
Sbjct  115  -GAYGYIGYFGVIILSISVALQLL  137



>ref|XP_006631304.1| PREDICTED: microsomal glutathione S-transferase 3-like [Lepisosteus 
oculatus]
Length=140

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA  ++LP  + YV++       +  ++  QV  ARKKY V YP MY     +   +LFN
Sbjct  1    MAIPDVLPASFAYVILTFFYSWIMLFYLSIQVVQARKKYGVKYPAMY-----SDKEQLFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   + G+ +P++++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVFPQWLIFQFISGLAYPVVASVLGAIWVTSRFSYAWGYYTGDPEKR-MR  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I  FG+ + +++ A+++L
Sbjct  115  GAYGYIGYFGVILLSLAAALQML  137



>gb|ADY80023.1| microsomal glutathione S-transferase 3 [Oplegnathus fasciatus]
Length=140

 Score =   116 bits (290),  Expect = 3e-29, Method: Compositional matrix adjust.
 Identities = 61/144 (42%), Positives = 90/144 (63%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GYV+    LY ++ L ++  +VG ARKKY V YPTMY     +   ++F
Sbjct  1    MDILTVLPSSFGYVIFTY-LYSWVMLGYLAVKVGAARKKYDVKYPTMY-----SDKEQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE  P + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP KR  
Sbjct  55   NCIQRAHQNTLEVYPQWLVFQTIAALVYPLSASVLGAIWVTSRFSYAWGYYTGDPAKRMN  114

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+   +IS A++LL
Sbjct  115  -GAYGYIGYFGVIFLSISVALQLL  137



>ref|XP_005319914.1| PREDICTED: microsomal glutathione S-transferase 3 [Ictidomys 
tridecemlineatus]
Length=152

 Score =   116 bits (291),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 83/134 (62%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP +++ LG ++I+ R  Y  GY TGDP+KR    +G
Sbjct  59   RAHQNTLEMYPPFLFFLAVGGVYHPRVASGLGLVWIIGRVLYAYGYYTGDPSKRNRGAVG  118

Query  380  KYGFIAIFGLQICA  421
             +  +A+ G  +C+
Sbjct  119  SFALLALMGTTVCS  132



>gb|KFO29097.1| Microsomal glutathione S-transferase 3 [Fukomys damarensis]
Length=182

 Score =   117 bits (293),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 63/142 (44%), Positives = 83/142 (58%), Gaps = 3/142 (2%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC
Sbjct  29   ANMAVLSKEYGFVILTGAASFVMVLHLAINVTKARKKYKVEYPVMYSTDPEN--GHLFNC  86

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            +QR HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP KRY  G
Sbjct  87   IQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGVAWIVGRVLYAYGYYTGDPRKRYR-G  145

Query  380  KYGFIAIFGLQICAISCAIKLL  445
              G IA+F L    +  A + L
Sbjct  146  SVGTIALFALMGTTVCSAFQHL  167



>ref|XP_009841585.1| hypothetical protein, variant 1 [Aphanomyces astaci]
 ref|XP_009841586.1| hypothetical protein H257_15254 [Aphanomyces astaci]
 gb|ETV68907.1| hypothetical protein H257_15254 [Aphanomyces astaci]
 gb|ETV68908.1| hypothetical protein, variant 1 [Aphanomyces astaci]
Length=144

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 57/139 (41%), Positives = 84/139 (60%), Gaps = 2/139 (1%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L  E+GY+++V+VL  F+NLW GF+VG AR+ Y + YP MYA E +++    FNCVQR H
Sbjct  8    LQPEHGYIILVVVLVAFVNLWAGFKVGAARRLYGIAYPQMYA-ETKDEHFLAFNCVQRAH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN LEN+P F  L+ +  +  PL +A  G + ++    Y   Y++GDP KR   G +G+I
Sbjct  67   QNVLENLPTFLSLLFVSSVYRPLWAAIAGLVRVIGFIVYIHFYSSGDPAKR-QYGAFGYI  125

Query  395  AIFGLQICAISCAIKLLTS  451
             +  L       A +L+T 
Sbjct  126  GLLTLVGLCFEAAFRLITE  144



>ref|XP_010729611.1| PREDICTED: microsomal glutathione S-transferase 3-like [Larimichthys 
crocea]
Length=140

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 87/143 (61%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  + +LP  +GYV+   +    +  ++  +VGTARKKY V YP MY+        ++FN
Sbjct  1    MDMLTVLPSNFGYVIFTYLYSWVMLAYLAVKVGTARKKYDVKYPDMYS-----DKEQVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEIYPQWLVFQTIAALVYPLSASVLGAIWVTSRFSYAWGYYTGDPAKR-MH  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I   G+ I +IS A++LL
Sbjct  115  GTYGYIGSLGVIILSISVALQLL  137



>ref|NP_001086335.1| microsomal glutathione S-transferase 3 [Xenopus laevis]
 gb|AAH75123.1| MGC81800 protein [Xenopus laevis]
Length=147

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 59/141 (42%), Positives = 85/141 (60%), Gaps = 7/141 (5%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYV++       +   +   V  ARK+YKV YP MY+ + EN +  +FNC+QR 
Sbjct  3    VLSKEYGYVILTGAASFVMVAHLTINVSRARKQYKVEYPKMYSDDPENGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE+ P F   + +GG+ HP  +++LG  +IV R  Y  GY+TGDP KR    +G +
Sbjct  61   HQNTLESYPPFLFFLAVGGLTHPRATSALGVAWIVGRELYAHGYSTGDPKKRMRGAIGSF  120

Query  386  GFIAIFGLQICAISCAIKLLT  448
              I +FG  IC+   A K+L 
Sbjct  121  ALIGLFGATICS---AFKILN  138



>dbj|BAJ14113.1| microsomal glutathione S-transferase [Danio rerio]
Length=140

 Score =   116 bits (290),  Expect = 4e-29, Method: Compositional matrix adjust.
 Identities = 58/143 (41%), Positives = 92/143 (64%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA   +LP  +GY ++V V    + +++G +VG ARKK+ V YPTMY+    +KD ++FN
Sbjct  1    MAIEGVLPANFGYAILVYVYSFVMLMYLGMKVGAARKKFGVKYPTMYS----DKD-QIFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQ++LE  P + +   +  + +P  ++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQDTLEVYPQWLLFQTIAALHYPSAASVLGAIWVTSRFSYAWGYYTGDPAKR-MH  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I +FG+ + +I  A+ L+
Sbjct  115  GVYGYIGLFGVLLISIYVALNLI  137



>gb|AGN29624.1| microsomal glutathione s-transferase [Acartia pacifica]
Length=138

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 87/137 (64%), Gaps = 6/137 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            LP++YGYV++  V   F+ +W G +VG ARK++KV YP MY+      D K+FNC+QR H
Sbjct  6    LPEDYGYVILTGVGAIFMAMWKGVKVGMARKEHKVEYPAMYS-----PDNKVFNCIQRSH  60

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LEN+  F  L+  GG  HP ++A+ G ++I  R  Y  GY+TG P KR   G +G++
Sbjct  61   QNTLENLSQFMFLLTTGGFSHPRLAAAAGRVWIAGRIVYGLGYSTGLPEKRVK-GAFGYL  119

Query  395  AIFGLQICAISCAIKLL  445
             +  L  C+I  AI+ +
Sbjct  120  GLLTLLGCSIHTAIQTI  136



>gb|ELK16331.1| Microsomal glutathione S-transferase 3 [Pteropus alecto]
Length=221

 Score =   118 bits (295),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 62/143 (43%), Positives = 85/143 (59%), Gaps = 3/143 (2%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
             A + +L KEYG+VV+       +   + F V  ARKKYKV YPTMY+ + EN    LFN
Sbjct  67   QANMAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPEN--GHLFN  124

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TGDP+KR + 
Sbjct  125  CIQRAHQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKR-SR  183

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G  G +A+ GL    +  A + L
Sbjct  184  GALGSVALLGLLGTTVVSAFQHL  206



>ref|NP_998592.1| microsomal glutathione S-transferase 3 [Danio rerio]
 ref|XP_005160934.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Danio rerio]
 gb|AAH49037.1| Zgc:56518 [Danio rerio]
Length=150

 Score =   116 bits (290),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 85/138 (62%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYV +       L + +   V  ARKKY VPYPTMY+ + E    ++FNC+QR 
Sbjct  3    VLSKEYGYVALTGAASFLLMVHLAHGVVKARKKYNVPYPTMYSDDPET--GRIFNCIQRS  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN++E +  F   + +GGI+HP +++ LG I+IVSR  Y  GY+TG P KR+  G +G 
Sbjct  61   HQNTIEILSPFLFHLSVGGIQHPRLASVLGMIWIVSRVLYAQGYSTGKPQKRHR-GTFGM  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ GL  C +     +L
Sbjct  120  VALVGLFFCTVDTGRVML  137



>ref|XP_011399061.1| Microsomal glutathione S-transferase 3 [Auxenochlorella protothecoides]
 gb|KFM26165.1| Microsomal glutathione S-transferase 3 [Auxenochlorella protothecoides]
Length=143

 Score =   115 bits (289),  Expect = 5e-29, Method: Compositional matrix adjust.
 Identities = 60/128 (47%), Positives = 83/128 (65%), Gaps = 4/128 (3%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFL-NLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            L  ++GYV+  LV    + N+WM  QVG AR+KYKV YPTMYA E +  DAK FNCVQR 
Sbjct  5    LVPQHGYVLGTLVGGVLVQNVWMAIQVGMARRKYKVCYPTMYAKE-DTPDAKTFNCVQRA  63

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATG--DPTKRYTLGKY  385
            HQN+LE +  F  L+I+ G R+P+ ++  G +YIV R  +F GY+TG  D  +R     +
Sbjct  64   HQNTLEMISTFNTLLIVAGARYPIAASVAGLVYIVGRIVFFKGYSTGKADNRRRGAFNAF  123

Query  386  GFIAIFGL  409
            G +A+ G+
Sbjct  124  GLLALIGM  131



>ref|XP_005398303.1| PREDICTED: LOW QUALITY PROTEIN: microsomal glutathione S-transferase 
3 [Chinchilla lanigera]
Length=158

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVILTGAASFVMVLHLAINVNKARKKYKVEYPVMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP I++ LG  +IV R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLATGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRYR-GSV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+F L    +  A + L
Sbjct  118  GSIALFALMGTTVCSAFQHL  137



>ref|XP_006907897.1| PREDICTED: microsomal glutathione S-transferase 3 [Pteropus alecto]
Length=152

 Score =   116 bits (290),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   + F V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVGHLAFNVSKARKKYKVEYPTMYSADPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TGDP+KR + G  
Sbjct  59   RAHQNTLEAYPAFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G +A+ GL    +  A + L
Sbjct  118  GSVALLGLLGTTVVSAFQHL  137



>ref|XP_010632228.1| PREDICTED: microsomal glutathione S-transferase 3 [Fukomys damarensis]
 ref|XP_010632229.1| PREDICTED: microsomal glutathione S-transferase 3 [Fukomys damarensis]
Length=152

 Score =   115 bits (289),  Expect = 6e-29, Method: Compositional matrix adjust.
 Identities = 62/138 (45%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFVMVLHLAINVTKARKKYKVEYPVMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP KRY  G  G 
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIASGLGVAWIVGRVLYAYGYYTGDPRKRYR-GSVGT  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+F L    +  A + L
Sbjct  120  IALFALMGTTVCSAFQHL  137



>dbj|BAB25726.1| unnamed protein product [Mus musculus]
Length=153

 Score =   115 bits (289),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHMFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +I+ R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYR-GAV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G +A+F L    +  A + L
Sbjct  118  GSLALFALMGTTVCSAFQHL  137



>ref|XP_004878618.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Heterocephalus glaber]
 ref|XP_004878619.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Heterocephalus glaber]
 ref|XP_004865241.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Heterocephalus glaber]
 ref|XP_004865242.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Heterocephalus glaber]
 gb|EHA99141.1| Microsomal glutathione S-transferase 3 [Heterocephalus glaber]
Length=158

 Score =   116 bits (290),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVILTGAASFVMVLHLAINVNKARKKYKVEYPVMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGMAWIVGRVLYAYGYYTGDPRKRYR-GSV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+F L    +  A + L
Sbjct  118  GSIALFALMGTTVCSAFQHL  137



>ref|NP_079845.1| microsomal glutathione S-transferase 3 [Mus musculus]
 sp|Q9CPU4.1|MGST3_MOUSE RecName: Full=Microsomal glutathione S-transferase 3; Short=Microsomal 
GST-3; AltName: Full=Microsomal GST-III [Mus musculus]
 dbj|BAB22665.1| unnamed protein product [Mus musculus]
 dbj|BAB22706.1| unnamed protein product [Mus musculus]
 dbj|BAB22808.1| unnamed protein product [Mus musculus]
 dbj|BAB22819.1| unnamed protein product [Mus musculus]
 gb|AAH29669.1| Microsomal glutathione S-transferase 3 [Mus musculus]
 dbj|BAE22638.1| unnamed protein product [Mus musculus]
 gb|EDL39180.1| microsomal glutathione S-transferase 3 [Mus musculus]
Length=153

 Score =   115 bits (289),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHMFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +I+ R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIIGRVLYAYGYYTGDPSKRYR-GAV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G +A+F L    +  A + L
Sbjct  118  GSLALFALMGTTVCSAFQHL  137



>ref|XP_004613932.1| PREDICTED: microsomal glutathione S-transferase 3 [Sorex araneus]
Length=151

 Score =   115 bits (289),  Expect = 7e-29, Method: Compositional matrix adjust.
 Identities = 61/136 (45%), Positives = 81/136 (60%), Gaps = 5/136 (4%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       L L +   V  AR+KYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFVLVLHLAMNVSKARRKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P+KR    LG  
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAHGYYTGEPSKRSRGALGSI  120

Query  386  GFIAIFGLQICA-ISC  430
              + + G  +CA +SC
Sbjct  121  ALLGLMGTTVCAQVSC  136



>ref|XP_007259553.1| PREDICTED: microsomal glutathione S-transferase 3-like isoform 
X1 [Astyanax mexicanus]
 ref|XP_007259554.1| PREDICTED: microsomal glutathione S-transferase 3-like isoform 
X2 [Astyanax mexicanus]
Length=153

 Score =   115 bits (288),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +  KEYGYVV+       L + + + V  AR KY V YP MY+ + E     +FNC+Q
Sbjct  1    MAVFSKEYGYVVLTGAATFLLMVRLSYSVVKARVKYNVQYPKMYSDDPET--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+ E +P+F   +  GGI HP +++ LGAI+IVSR  Y  GY++GDP KR   G +
Sbjct  59   RAHQNTNEILPLFLFFLTAGGIHHPRLASGLGAIWIVSRLVYAHGYSSGDPAKR-KRGAF  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G +A+ GL  C +     +L
Sbjct  118  GDLALLGLVFCTVDSGRTML  137



>gb|AEW46329.1| microsomal glutathione S-transferase [Ruditapes philippinarum]
Length=149

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 85/140 (61%), Gaps = 5/140 (4%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            VE LP++YGYVV+  V   F+N+WM   VG ARK+Y+V YP +Y  E  +    +FNC+Q
Sbjct  8    VESLPEDYGYVVLTGVGSVFVNMWMAINVGRARKQYEVKYPQLYHPEPNH----VFNCIQ  63

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE    F  L++  G+++P  SA+ GA+ +V+R  Y  GY TGDP KR   G +
Sbjct  64   RAHQNTLEGSSTFMFLLLTSGLQYPKCSAAAGAVCLVARIAYAMGYYTGDPEKR-RWGGF  122

Query  386  GFIAIFGLQICAISCAIKLL  445
            G I+   L    +S A   L
Sbjct  123  GHISELVLLGGVVSLAFHQL  142



>ref|XP_006983299.1| PREDICTED: microsomal glutathione S-transferase 3-like [Peromyscus 
maniculatus bairdii]
Length=152

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGYVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG--  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIVGRILYAYGYYTGDPSKRYRGGVS  118

Query  380  KYGFIAIFGLQICA  421
                 A+ G  +C+
Sbjct  119  SLALFALMGTTVCS  132



>ref|XP_006635365.1| PREDICTED: microsomal glutathione S-transferase 3-like [Lepisosteus 
oculatus]
Length=145

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 56/126 (44%), Positives = 81/126 (64%), Gaps = 3/126 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYV++       +   +   VG ARKKYKV YP MY+ + EN +  +FNC+QR 
Sbjct  3    VLSKEYGYVLLTGAASFVMVAHLAINVGRARKKYKVEYPQMYSDDPENGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ +P ++++LG  +++SR  Y  GY+TGDP KR   G +G 
Sbjct  61   HQNTLEVYPAFLFFLAIGGLHNPRLASALGMTWVISREVYAHGYSTGDPKKR-ARGSFGS  119

Query  392  IAIFGL  409
            IA+ GL
Sbjct  120  IALLGL  125



>ref|XP_004639931.1| PREDICTED: microsomal glutathione S-transferase 3 [Octodon degus]
Length=152

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVNKARKKYKVEYPVMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP I++ LG  +IV R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLAAGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRYR-GAV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+F L    +  A + L
Sbjct  118  GSIALFALMGTTVCSAFQHL  137



>ref|XP_003785795.1| PREDICTED: microsomal glutathione S-transferase 3 [Otolemur garnettii]
Length=152

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 82/134 (61%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++  V    +  ++G  V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGVASFVMVGYLGVNVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TGDP+KR    LG
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRLASGLGLAWIVGRVLYAYGYYTGDPSKRRRGALG  118

Query  380  KYGFIAIFGLQICA  421
                I + G  +C+
Sbjct  119  SIALIGLMGTTLCS  132



>ref|XP_008846451.1| PREDICTED: microsomal glutathione S-transferase 3 [Nannospalax 
galili]
Length=162

 Score =   115 bits (288),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 79/132 (60%), Gaps = 4/132 (3%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            IL KEYG+VV+       + + +   V  ARKKYKV YP MY+ + EN    LFNC+QR 
Sbjct  3    ILSKEYGFVVLTGAASFVMVMHLALNVNKARKKYKVEYPVMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TGDP+KRY   +G  
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGDPSKRYRGAVGSL  120

Query  386  GFIAIFGLQICA  421
               A+ G  +C+
Sbjct  121  ALFALMGTTVCS  132



>gb|AHC08054.1| micorsomal glutathione S-transferase [Locusta migratoria]
Length=139

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 59/137 (43%), Positives = 89/137 (65%), Gaps = 6/137 (4%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            +P +YGY V+V V   F+ +W G +VG ARKK+ +PYPTMY+     KD   FNC+QR H
Sbjct  6    VPSQYGYCVLVAVGSIFVLMWKGIKVGVARKKFNIPYPTMYS-----KDNDQFNCIQRAH  60

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LEN P F  L++LGG+ HP++SA+ G +++  R  Y  GY TG+P KR   G + ++
Sbjct  61   QNTLENYPQFLTLLLLGGLEHPVVSAAAGCVWLAGRIAYAKGYYTGNPAKRMQ-GGFAYL  119

Query  395  AIFGLQICAISCAIKLL  445
             +  L   ++  +++LL
Sbjct  120  GLLVLLGTSVKFSLRLL  136



>ref|XP_010795718.1| PREDICTED: microsomal glutathione S-transferase 3 [Notothenia 
coriiceps]
Length=153

 Score =   115 bits (287),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 84/137 (61%), Gaps = 3/137 (2%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+  V    +   +  +VG ARKKYK+ YP MY+ + EN +  +FNC+QR H
Sbjct  4    LSKEYGYVVLTGVASIAMIGHLAIKVGKARKKYKIDYPQMYSDDPENGN--IFNCIQRAH  61

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LE  P F   + +GG+  P +++ LG ++I+SR  Y  GY+TGDP KR   G +G +
Sbjct  62   QNTLEIYPAFLFCLAIGGLHAPRLASGLGVVWIISREVYAHGYSTGDPKKRMR-GAFGNV  120

Query  395  AIFGLQICAISCAIKLL  445
            A  GL +  I     LL
Sbjct  121  AFLGLMLTTICHGRTLL  137



>ref|XP_009529468.1| hypothetical protein PHYSODRAFT_286365 [Phytophthora sojae]
 gb|EGZ15719.1| hypothetical protein PHYSODRAFT_286365 [Phytophthora sojae]
Length=147

 Score =   114 bits (286),  Expect = 1e-28, Method: Compositional matrix adjust.
 Identities = 55/137 (40%), Positives = 84/137 (61%), Gaps = 2/137 (1%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L   +GY+ +V++    +  W GF+VG ARK++ VPYP MYA E  +K+A  FNCVQR H
Sbjct  10   LQPAHGYIPLVVIGAGLVGTWAGFRVGVARKQFNVPYPQMYA-EKSDKNANEFNCVQRAH  68

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN LEN+P+F+ ++    I  P ++A+ G + I     Y  GY+TGDP KR   G +G++
Sbjct  69   QNVLENLPLFYAMLATSSIYRPKVAAAAGLVRIAGFVMYVKGYSTGDPGKRRK-GNFGYL  127

Query  395  AIFGLQICAISCAIKLL  445
                +   ++  A++LL
Sbjct  128  GTLVMLGLSLEAALRLL  144



>ref|XP_003962459.1| PREDICTED: microsomal glutathione S-transferase 3-like [Takifugu 
rubripes]
Length=140

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 89/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  + +LP ++GYV+   +    +  ++  +VG ARKKY V YPTMY+     KD ++FN
Sbjct  1    MGVLSVLPSDFGYVIFTYLYSWVMLAYLAIKVGLARKKYDVKYPTMYS----EKD-QMFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP+KR   
Sbjct  56   CIQRAHQNTLELYPQWLVFQTIAALVYPLTASVLGAIWVTSRFTYAWGYYTGDPSKRLN-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I   G+   ++  A++LL
Sbjct  115  GAYGYIGSLGVIALSVCVALQLL  137



>ref|NP_001075607.1| microsomal glutathione S-transferase 3 [Oryctolagus cuniculus]
 ref|XP_008262173.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Oryctolagus cuniculus]
 ref|XP_008262174.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Oryctolagus cuniculus]
 gb|AAL12230.1| microsomal glutathione S-transferase [Oryctolagus cuniculus]
Length=152

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/138 (44%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVLLTGAASFVMVLHLAINVNKARKKYKVEYPVMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP I + LG ++IV R  Y  GY TGDP+KRY  G    
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGWVWIVGRVLYAYGYYTGDPSKRYR-GAVSS  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+FGL    +  A + L
Sbjct  120  LALFGLMGTTVCSAFQHL  137



>ref|XP_008576906.1| PREDICTED: microsomal glutathione S-transferase 3 [Galeopterus 
variegatus]
Length=152

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 59/134 (44%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFVMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++SLG  +IV R  Y  GY TG+P+KR    LG
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASSLGLAWIVGRVLYAYGYYTGEPSKRNRGALG  118

Query  380  KYGFIAIFGLQICA  421
                I + G  +C+
Sbjct  119  SIALIGLMGTTVCS  132



>ref|XP_002760486.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Callithrix jacchus]
 ref|XP_008983356.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Callithrix jacchus]
 ref|XP_008983357.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Callithrix jacchus]
 ref|XP_008983358.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Callithrix jacchus]
Length=152

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MTVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCSAFQHL  137



>ref|XP_005372113.1| PREDICTED: microsomal glutathione S-transferase 3 [Microtus ochrogaster]
Length=152

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MTVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPAMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KR    +G
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRSRGAVG  118

Query  380  KYGFIAIFGLQICA  421
                +A+ G  +C+
Sbjct  119  SLALLALMGTTVCS  132



>ref|XP_004589200.1| PREDICTED: microsomal glutathione S-transferase 3 [Ochotona princeps]
Length=152

 Score =   114 bits (286),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MTVLSKEYGYVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSSDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG--  379
            R HQN+LE  P F   + +GG+ HP I + LG  +I+ R  Y  GY TGDP+KRY  G  
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIVSGLGCAWIIGRVLYAYGYYTGDPSKRYRGGVS  118

Query  380  KYGFIAIFGLQICA  421
                +A+ G  +C+
Sbjct  119  SLALLALMGTTVCS  132



>ref|XP_008683924.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Ursus maritimus]
Length=199

 Score =   115 bits (289),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 60/137 (44%), Positives = 81/137 (59%), Gaps = 4/137 (3%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFN
Sbjct  45   MASMAVLSKEYGFVVLTGAASFIMVAHLAVNVAKARKKYKVEYPTMYSTDPEN--GHLFN  102

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--  370
            C+QR HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR   
Sbjct  103  CIQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRNRG  162

Query  371  TLGKYGFIAIFGLQICA  421
             LG    I + G  +C+
Sbjct  163  ALGSVALIGLMGTTVCS  179



>emb|CDH60086.1| microsomal glutathione s-transferase 3 [Lichtheimia corymbifera 
JMRC:FSU:9682]
Length=149

 Score =   114 bits (285),  Expect = 2e-28, Method: Compositional matrix adjust.
 Identities = 62/114 (54%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAI--EAENK-DAKLFNCVQ  205
            L +E+G+V+ VLVL  F  L M  +VG ARK   VPYP +YA   EAEN+ D  +FNCVQ
Sbjct  6    LSQEHGFVLSVLVLSLFQLLAMSLRVGKARKVAGVPYPYVYAEKNEAENEFDKHVFNCVQ  65

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            R HQN+LE  P F +L++LGGI HPLI+A  G  Y+V+R  Y  GY+TG+P KR
Sbjct  66   RVHQNTLEMYPSFAVLLLLGGITHPLINAGAGFYYLVTREVYARGYSTGEPGKR  119



>ref|NP_001178523.1| microsomal glutathione S-transferase 3 [Rattus norvegicus]
 ref|XP_006250271.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Rattus norvegicus]
 gb|EDM09282.1| rCG46430 [Rattus norvegicus]
Length=152

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVGKARKKYKVEYPVMYSTDPEN--GHMFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +I+ R  Y  GY TGDP+KRY   + 
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGVAWIIGRVLYAYGYYTGDPSKRYRGAVS  118

Query  380  KYGFIAIFGLQICA  421
                 A+ G  +C+
Sbjct  119  SLALFALMGTTVCS  132



>gb|EFX85347.1| hypothetical protein DAPPUDRAFT_230544 [Daphnia pulex]
Length=157

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 58/133 (44%), Positives = 81/133 (61%), Gaps = 2/133 (2%)
 Frame = +2

Query  47   YGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQNSL  226
            YGYV++  V   FL  W  FQVG  R+K  + YP MY+ +    +  LFNC QR HQN+L
Sbjct  24   YGYVILTGVASGFLLTWQAFQVGKMRRKAGINYPIMYSSDTTG-NGHLFNCYQRVHQNTL  82

Query  227  ENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFIAIFG  406
            E  P+F ML+  GG++HP+ S+  G ++IV R  Y  GY TGDP KR   G +G ++I  
Sbjct  83   EGYPLFLMLLFTGGLQHPIPSSVAGVVWIVGRVIYSLGYYTGDPKKR-VRGAFGNLSILT  141

Query  407  LQICAISCAIKLL  445
            L   +I  A++L+
Sbjct  142  LATSSIMLAVRLI  154



>ref|XP_004652006.1| PREDICTED: microsomal glutathione S-transferase 3 [Jaculus jaculus]
Length=152

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 57/134 (43%), Positives = 80/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVNKARKKYKVEYPVMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KRY   +G
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRYRGAVG  118

Query  380  KYGFIAIFGLQICA  421
                 A+ G  +C+
Sbjct  119  SLALFALMGTTVCS  132



>ref|XP_003767426.1| PREDICTED: microsomal glutathione S-transferase 3 [Sarcophilus 
harrisii]
Length=152

 Score =   114 bits (284),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/148 (41%), Positives = 84/148 (57%), Gaps = 3/148 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       L   +   VG ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVILTGAASFMLVTHLAINVGKARKKYKVEYPNMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P +   + +GGI HP + + LG  +I+ R  Y  GY TGDP+KR + G  
Sbjct  59   RAHQNTLEVYPSYLFFLTIGGIYHPRLVSGLGLAWIIGRVLYAYGYYTGDPSKR-SRGMV  117

Query  386  GFIAIFGLQICAISCAIKLLTS*TRRCC  469
            G IA+ GL    +  A + L    R  C
Sbjct  118  GSIALLGLMGTVVYSAFQHLGWVNRGLC  145



>ref|XP_008983355.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Callithrix jacchus]
Length=165

 Score =   114 bits (285),  Expect = 3e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  14   MTVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  71

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KR + G  
Sbjct  72   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKR-SRGAL  130

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  131  GSIALLGLMGTTVCSAFQHL  150



>ref|NP_001088717.1| uncharacterized protein LOC495981 [Xenopus laevis]
 gb|AAH87365.1| LOC495981 protein [Xenopus laevis]
Length=147

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 58/139 (42%), Positives = 82/139 (59%), Gaps = 3/139 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+       +   +   V  ARK+Y V YP MY+ + EN   K+FNC+QR 
Sbjct  3    VLSKEYGYVVLTGAASFVMVTHLAINVSKARKQYNVEYPKMYSDDPEN--GKIFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE+ P F   + +GG+ HP  +++LG  +IV R  Y  GY+TG+P KR   G  G 
Sbjct  61   HQNTLESYPSFLFFLAVGGLTHPRATSALGVAWIVGRELYAHGYSTGEPKKR-QRGAIGS  119

Query  392  IAIFGLQICAISCAIKLLT  448
            +A+ GL    +  A K+L 
Sbjct  120  VALLGLFGATVCSAFKILN  138



>gb|EFB24445.1| hypothetical protein PANDA_002087 [Ailuropoda melanoleuca]
Length=155

 Score =   114 bits (284),  Expect = 4e-28, Method: Compositional matrix adjust.
 Identities = 61/142 (43%), Positives = 84/142 (59%), Gaps = 3/142 (2%)
 Frame = +2

Query  20   AGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNC  199
            A + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC
Sbjct  2    ASMAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNC  59

Query  200  VQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLG  379
            +QR HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G
Sbjct  60   IQRAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRG  118

Query  380  KYGFIAIFGLQICAISCAIKLL  445
              G +A+ GL    +  A + L
Sbjct  119  ALGSVALIGLMGTTVFSAFQHL  140



>emb|CEG73141.1| hypothetical protein RMATCC62417_08578 [Rhizopus microsporus]
Length=146

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 86/132 (65%), Gaps = 4/132 (3%)
 Frame = +2

Query  23   GVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAE-NKDA--KLF  193
            G  I+P EYGYV+ V        +++G +VG AR+  KVPYP  YA ++E  KD    +F
Sbjct  2    GALIVPSEYGYVLGVAAFSALHLMFLGAKVGKARRAAKVPYPYAYAEKSEAEKDPLKNIF  61

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC QR HQN+LE  PV+  L+++GG+++P ISA+ G ++ + R  Y +GY+TG+P KR T
Sbjct  62   NCAQRAHQNTLEVFPVYSTLLLIGGLKYPEISAAAGLVHCLGRQVYASGYSTGNPDKR-T  120

Query  374  LGKYGFIAIFGL  409
             G +GF+ +  L
Sbjct  121  RGAFGFLGLITL  132



>gb|KFP84390.1| Microsomal glutathione S-transferase 3, partial [Apaloderma vittatum]
Length=147

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L  ++  +VG ARKKY V YPTMY+ + E+   ++FNC+Q
Sbjct  1    MAVLSKEYGYVILTGAASFILVGYLAVKVGKARKKYNVEYPTMYSTDPEH--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP ++  LG  +I+ R  Y  GY TGDP KR + G +
Sbjct  59   RAHQNTLEVYPAFLFFLATGGLYHPRLATGLGITWILGRALYANGYYTGDPKKR-SRGAF  117

Query  386  GFIAIFGLQICAISCAIKLLTS*TRRCC  469
            G +A+ GL    +  A + L     R C
Sbjct  118  GSLALLGLVGTGVYSACQHLGWICERQC  145



>gb|AAX61154.1| microsomal glutathione S-transferase [Oreochromis mossambicus]
Length=154

 Score =   113 bits (283),  Expect = 5e-28, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  +    +   +   VG ARKKY V YP MY+ + E  +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGMASMVMVTHLAINVGKARKKYNVHYPQMYSDDPETGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE+ P F   + +GG   P + + LG ++I+SR  Y  GY+TGDP KR   G +G 
Sbjct  61   HQNTLESYPAFLFCLAVGGFHSPRLVSGLGVVWIISREVYAHGYSTGDPKKR-VRGAFGN  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ G+ +  ++    LL
Sbjct  120  LALLGMMLATLNFGSSLL  137



>ref|XP_009863060.1| PREDICTED: microsomal glutathione S-transferase 3 [Apaloderma 
vittatum]
Length=148

 Score =   113 bits (283),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 60/148 (41%), Positives = 86/148 (58%), Gaps = 3/148 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L  ++  +VG ARKKY V YPTMY+ + E+   ++FNC+Q
Sbjct  1    MAVLSKEYGYVILTGAASFILVGYLAVKVGKARKKYNVEYPTMYSTDPEH--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP ++  LG  +I+ R  Y  GY TGDP KR + G +
Sbjct  59   RAHQNTLEVYPAFLFFLATGGLYHPRLATGLGITWILGRALYANGYYTGDPKKR-SRGAF  117

Query  386  GFIAIFGLQICAISCAIKLLTS*TRRCC  469
            G +A+ GL    +  A + L     R C
Sbjct  118  GSLALLGLVGTGVYSACQHLGWICERQC  145



>dbj|GAN09788.1| conserved hypothetical protein [Mucor ambiguus]
Length=146

 Score =   113 bits (282),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 57/128 (45%), Positives = 85/128 (66%), Gaps = 4/128 (3%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAE-NKDAK--LFNCVQ  205
            +P EYGYV+ V V        +  +VG AR+  KVPYP +YA ++E  KD K  +FNC Q
Sbjct  6    IPSEYGYVLGVAVASALYVFSLAPKVGAARRAAKVPYPYVYAEKSEAEKDPKKNIFNCTQ  65

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE +PV+  L+++GG+++P ISA+ G ++I+ R  + +GY TGDP KR T G +
Sbjct  66   RAHQNTLEILPVYNTLLLVGGLKYPEISAAAGVVFILGRIVFTSGYVTGDPAKR-TRGAF  124

Query  386  GFIAIFGL  409
            G++ +  L
Sbjct  125  GYLGLITL  132



>ref|XP_005071470.1| PREDICTED: microsomal glutathione S-transferase 3 [Mesocricetus 
auratus]
Length=152

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MTVLSKEYGFVLLTGAASFVMVLHLALNVNKARKKYKVEYPAMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KR   ++G
Sbjct  59   RAHQNTLEMYPPFLFFLTVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRSRGSVG  118

Query  380  KYGFIAIFGLQICA  421
                +A+ G  +C+
Sbjct  119  SIALLALMGTTVCS  132



>ref|XP_008290628.1| PREDICTED: microsomal glutathione S-transferase 3 [Stegastes 
partitus]
 ref|XP_008290708.1| PREDICTED: microsomal glutathione S-transferase 3 [Stegastes 
partitus]
 ref|XP_008290783.1| PREDICTED: microsomal glutathione S-transferase 3 [Stegastes 
partitus]
Length=153

 Score =   113 bits (282),  Expect = 7e-28, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  V    +   +  +VG ARKKY V YP MY+ + E  +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGVASMIMVGHLAVRVGKARKKYNVRYPQMYSDDPETGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP +S+ LG ++I+ R  Y  GY+TGDP KR   G +G 
Sbjct  61   HQNTLEFYPAFLFCLAVGGLHHPRLSSGLGVVWILGREAYAHGYSTGDPKKRMR-GAFGS  119

Query  392  IAIFGLQICAISCAIKLL  445
             A+ G+ +  +     L+
Sbjct  120  WALIGMMLTTLRFGCHLV  137



>ref|XP_003928123.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Saimiri boliviensis boliviensis]
Length=152

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFIMVAHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TGDP+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGDPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCSAFQHL  137



>ref|XP_004408401.1| PREDICTED: microsomal glutathione S-transferase 3 [Odobenus rosmarus 
divergens]
Length=152

 Score =   113 bits (282),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 64/154 (42%), Positives = 87/154 (56%), Gaps = 9/154 (6%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCA------IKLLTS*TRRCC  469
            G IA+ GL    +  A      +K   S   +CC
Sbjct  118  GSIALIGLMGTTVCSAFQHLGWVKTGLSGGSKCC  151



>gb|EPB91144.1| hypothetical protein HMPREF1544_02024 [Mucor circinelloides f. 
circinelloides 1006PhL]
Length=146

 Score =   112 bits (281),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/114 (47%), Positives = 79/114 (69%), Gaps = 3/114 (3%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAE-NKDAK--LFNCVQ  205
            +P EYGYV+ V V        +G +VG AR+  KVPYP MYA ++E  KD+K  +FNC Q
Sbjct  6    IPSEYGYVLGVAVASALYVFSLGAKVGGARRAAKVPYPYMYAEKSEAEKDSKKNIFNCTQ  65

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
            R HQN+LE +PV+  L+++GG+++P ISA+ G ++++ R  + +GY TGDP KR
Sbjct  66   RAHQNTLEILPVYNTLLLVGGLKYPEISAAAGVVFLLGRIVFTSGYVTGDPAKR  119



>ref|XP_009841584.1| hypothetical protein, variant 2 [Aphanomyces astaci]
 gb|ETV68909.1| hypothetical protein, variant 2 [Aphanomyces astaci]
Length=130

 Score =   112 bits (280),  Expect = 8e-28, Method: Compositional matrix adjust.
 Identities = 54/125 (43%), Positives = 79/125 (63%), Gaps = 2/125 (2%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L  E+GY+++V+VL  F+NLW GF+VG AR+ Y + YP MYA E +++    FNCVQR H
Sbjct  8    LQPEHGYIILVVVLVAFVNLWAGFKVGAARRLYGIAYPQMYA-ETKDEHFLAFNCVQRAH  66

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN LEN+P F  L+ +  +  PL +A  G + ++    Y   Y++GDP KR   G +G+I
Sbjct  67   QNVLENLPTFLSLLFVSSVYRPLWAAIAGLVRVIGFIVYIHFYSSGDPAKR-QYGAFGYI  125

Query  395  AIFGL  409
             +  L
Sbjct  126  GLLTL  130



>gb|EPQ16607.1| Microsomal glutathione S-transferase 3 [Myotis brandtii]
Length=177

 Score =   113 bits (283),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 63/145 (43%), Positives = 86/145 (59%), Gaps = 5/145 (3%)
 Frame = +2

Query  17   MAGVE--ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL  190
            +AG E  +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+++ EN    L
Sbjct  21   LAGAEMAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSMDPEN--GHL  78

Query  191  FNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY  370
            FNC+QR HQN+LE  P F   + +GG+ HP + + LG  +IV R  Y  GY TG+P+KR 
Sbjct  79   FNCIQRAHQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPSKR-  137

Query  371  TLGKYGFIAIFGLQICAISCAIKLL  445
            + G  G IA+ GL    +  A + L
Sbjct  138  SRGALGSIALLGLMGTTVCSAFQHL  162



>ref|XP_003415079.1| PREDICTED: microsomal glutathione S-transferase 3 [Loxodonta 
africana]
 ref|XP_010593231.1| PREDICTED: microsomal glutathione S-transferase 3 [Loxodonta 
africana]
Length=151

 Score =   112 bits (281),  Expect = 9e-28, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFIMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P KR   G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPRKR-NRGAV  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            GFIA+ GL    +  A + L
Sbjct  118  GFIALIGLMGTTVCSAFQHL  137



>ref|XP_004082441.1| PREDICTED: microsomal glutathione S-transferase 3-like [Oryzias 
latipes]
Length=140

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 57/143 (40%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            MA +  LP ++GYV+   +    +  ++  +VG ARKKY V YP MY+    +KD ++FN
Sbjct  1    MAVLAALPSDFGYVIFTYLYSWIMMAYLAVKVGAARKKYGVKYPAMYS----DKD-QVFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP KR   
Sbjct  56   CIQRAHQNTLEVYPQWLVFQTIAALVYPLTASVLGAIWVTSRFSYAWGYYTGDPEKRMK-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
            G YG+I   G+ + +I  A++ L
Sbjct  115  GAYGYIGYLGVIVLSIYIALQQL  137



>ref|XP_008431445.1| PREDICTED: microsomal glutathione S-transferase 3 [Poecilia reticulata]
Length=150

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 61/137 (45%), Positives = 85/137 (62%), Gaps = 3/137 (2%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L KEYGYVV+  V    +   +  +VG ARKKYKV YP MY+ + E+    +FNC+QR H
Sbjct  4    LSKEYGYVVLTGVASMIMIGHLAIKVGKARKKYKVLYPKMYSDDPEH--GHIFNCIQRAH  61

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LE    F   + +GG+  P +++ LGA++IVSR  Y  GY+TGDP KR   G +G +
Sbjct  62   QNTLEVYAPFLFCLAVGGLHCPRLASGLGAVWIVSRVVYAHGYSTGDPKKRMR-GAFGNV  120

Query  395  AIFGLQICAISCAIKLL  445
            A+ GL +  +S    LL
Sbjct  121  ALLGLMLTTLSYGGHLL  137



>ref|XP_003453417.1| PREDICTED: microsomal glutathione S-transferase 3-like [Oreochromis 
niloticus]
Length=154

 Score =   112 bits (281),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/138 (41%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  +    +   +   VG ARKKY V YP MY+ + E  +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGMASMVMVTHLAINVGKARKKYHVHYPQMYSDDPETGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE+ P F   + +GG   P + + LG ++I+SR  Y  GY+TGDP KR   G +G 
Sbjct  61   HQNTLESYPAFLFCLAVGGFHSPRLVSGLGVVWIISREVYAHGYSTGDPKKRMR-GAFGN  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ G+ +  ++    LL
Sbjct  120  LALLGMMLATLNFGGSLL  137



>ref|XP_008683925.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Ursus maritimus]
 ref|XP_008683926.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Ursus maritimus]
Length=152

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 79/134 (59%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAVNVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR    LG
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKRNRGALG  118

Query  380  KYGFIAIFGLQICA  421
                I + G  +C+
Sbjct  119  SVALIGLMGTTVCS  132



>ref|XP_002909151.1| conserved hypothetical protein [Phytophthora infestans T30-4]
 gb|EEY57965.1| conserved hypothetical protein [Phytophthora infestans T30-4]
Length=147

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 54/137 (39%), Positives = 82/137 (60%), Gaps = 2/137 (1%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            L   +GY+ +V++    +  W G +VG ARKKY VPYP MY +E + K+A  FNCVQR H
Sbjct  10   LQPAHGYIPLVVIGAGLVGTWAGIKVGAARKKYNVPYPQMY-VEKKEKNANEFNCVQRAH  68

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN LEN+P+ + ++    I  P ++A+ G + I     Y  GY+TGDP KR T G +G +
Sbjct  69   QNVLENLPLLYAMLATSSIYRPKVAAAAGVVRIAGFIMYVKGYSTGDPGKR-TKGSFGHL  127

Query  395  AIFGLQICAISCAIKLL  445
                +   ++  +++LL
Sbjct  128  GTLVMLGLSLEASLRLL  144



>ref|XP_006742057.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Leptonychotes weddellii]
 ref|XP_006742058.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Leptonychotes weddellii]
Length=152

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALIGLMGTTVCSAFQHL  137



>ref|XP_006142318.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Tupaia chinensis]
 ref|XP_006142319.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Tupaia chinensis]
 gb|ELW70988.1| Microsomal glutathione S-transferase 3 [Tupaia chinensis]
Length=151

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFVMVAHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP +++ LG  +I+ R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIIGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCSAFQHL  137



>ref|XP_002914220.1| PREDICTED: microsomal glutathione S-transferase 3 [Ailuropoda 
melanoleuca]
 ref|XP_002914221.1| PREDICTED: microsomal glutathione S-transferase 3 [Ailuropoda 
melanoleuca]
Length=152

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 82/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  G 
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGALGS  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ GL    +  A + L
Sbjct  120  VALIGLMGTTVFSAFQHL  137



>ref|XP_003505590.1| PREDICTED: microsomal glutathione S-transferase 3 [Cricetulus 
griseus]
 ref|XP_007618204.1| PREDICTED: microsomal glutathione S-transferase 3 [Cricetulus 
griseus]
 gb|EGV92924.1| Microsomal glutathione S-transferase 3 [Cricetulus griseus]
 gb|ERE72857.1| microsomal glutathione S-transferase 3-like protein [Cricetulus 
griseus]
Length=152

 Score =   112 bits (280),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 56/134 (42%), Positives = 81/134 (60%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       + L +   V  ARKKYKV YP MY+ + EN    +FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFVMVLHLAINVSKARKKYKVEYPVMYSTDPEN--GHIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TGDP+KR   ++G
Sbjct  59   RAHQNTLEVYPPFLFFLTVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGDPSKRNRGSVG  118

Query  380  KYGFIAIFGLQICA  421
                +A+ G  +C+
Sbjct  119  SIALLALMGTTVCS  132



>ref|XP_005880551.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Myotis brandtii]
 ref|XP_005880552.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Myotis brandtii]
Length=152

 Score =   112 bits (280),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+++ EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSMDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP + + LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCSAFQHL  137



>ref|XP_004688473.1| PREDICTED: microsomal glutathione S-transferase 3 [Condylura 
cristata]
Length=152

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P+KR    LG  
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVASGLGIAWIVGRVLYAYGYYTGEPSKRSRGVLGSI  120

Query  386  GFIAIFGLQICA  421
              I + G  +C+
Sbjct  121  ALIGLMGTTVCS  132



>ref|NP_001239339.1| microsomal glutathione S-transferase 3 [Canis lupus familiaris]
Length=152

 Score =   112 bits (279),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G +A+ GL    +  A + L
Sbjct  118  GSLALIGLMGTTVFSAFQHL  137



>gb|ABV24052.1| gluthathione S-transferase mapeg [Takifugu obscurus]
Length=140

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 55/143 (38%), Positives = 88/143 (62%), Gaps = 6/143 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  + +LP ++GYV+   +    +  ++  +VG ARKKY V YP MY+     KD ++FN
Sbjct  1    MGVLSVLPSDFGYVIFTYLYSWVMLAYLAIKVGLARKKYDVKYPAMYS----EKD-QIFN  55

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C+QR HQN+LE  P + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP+KR + 
Sbjct  56   CIQRAHQNTLELYPQWLVFQTIAALVYPLTASVLGAIWVTSRFTYARGYYTGDPSKRLS-  114

Query  377  GKYGFIAIFGLQICAISCAIKLL  445
              YG+I   G+   ++  A++LL
Sbjct  115  SAYGYIGSLGVIALSVCVALQLL  137



>gb|ABW88889.1| microsomal glutathione S-transferase [Kryptolebias marmoratus]
 gb|AEM65186.1| microsomal glutathione s-transferase [Kryptolebias marmoratus]
Length=140

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 86/138 (62%), Gaps = 8/138 (6%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            LP  +GYV+    LY ++ L ++   VG ARKKY V YPTMY     +   ++FNC+QR 
Sbjct  7    LPSSFGYVIFTY-LYSWVMLGYLAVMVGGARKKYDVKYPTMY-----SDKEQVFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P   +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP KR   G YG+
Sbjct  61   HQNTLEVYPQGLVFQTIAALVYPLSASVLGAIWVTSRFSYAWGYYTGDPAKRMN-GAYGY  119

Query  392  IAIFGLQICAISCAIKLL  445
            I  FG+ + +IS A++LL
Sbjct  120  IGYFGVILLSISVALQLL  137



>ref|XP_009053885.1| hypothetical protein LOTGIDRAFT_116903 [Lottia gigantea]
 gb|ESO95375.1| hypothetical protein LOTGIDRAFT_116903 [Lottia gigantea]
Length=127

 Score =   111 bits (277),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 51/109 (47%), Positives = 72/109 (66%), Gaps = 5/109 (5%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            +E LP EYGYV++V      +N+WM F+VG ARKKY V YP +Y+      D   FNC+Q
Sbjct  8    IEFLPNEYGYVILVGCGSVAVNMWMAFKVGAARKKYGVEYPKLYS-----DDNDTFNCIQ  62

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATG  352
            R HQN+LE  P F ML+ +GG+++P ++A LGA+ ++ R  Y  GY +G
Sbjct  63   RAHQNTLEGYPQFLMLLFVGGLQYPKVTAGLGAVCLLGRIAYALGYYSG  111



>ref|XP_010782182.1| PREDICTED: microsomal glutathione S-transferase 3-like [Notothenia 
coriiceps]
Length=140

 Score =   111 bits (278),  Expect = 2e-27, Method: Compositional matrix adjust.
 Identities = 59/144 (41%), Positives = 89/144 (62%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GY +    LY ++ L ++  +VG ARKK+ V YPTMY+        ++F
Sbjct  1    MDMLNVLPSNFGYAIFTY-LYSWIMLGYLAVKVGGARKKFDVKYPTMYS-----DTHQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE    + +   +  + +PL +A LGAI++ SR+ Y  GY TGDP+KR  
Sbjct  55   NCIQRAHQNTLEVYAQWLVFQTIAALVYPLSAAVLGAIWVTSRFSYAWGYYTGDPSKR-M  113

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+   +IS A++LL
Sbjct  114  YGAYGYIGYFGVIFLSISVALQLL  137



>ref|XP_007935935.1| PREDICTED: microsomal glutathione S-transferase 3 [Orycteropus 
afer afer]
Length=152

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFIMVAHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P+KR    +G  
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPSKRNRGAVGSI  120

Query  386  GFIAIFGLQICA  421
              IA+ G  +C+
Sbjct  121  ALIALMGTTVCS  132



>gb|ACQ58742.1| Microsomal glutathione S-transferase 3 [Anoplopoma fimbria]
 gb|ACQ58963.1| Microsomal glutathione S-transferase 3 [Anoplopoma fimbria]
Length=140

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/144 (40%), Positives = 89/144 (62%), Gaps = 8/144 (6%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNL-WMGFQVGTARKKYKVPYPTMYAIEAENKDAKLF  193
            M  + +LP  +GY +    LY ++ L ++  +VG+ARKKY V YPTMY     +   ++F
Sbjct  1    MDVLTVLPANFGYAIFTY-LYSWIMLGYLAVKVGSARKKYDVKYPTMY-----SDKEQVF  54

Query  194  NCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYT  373
            NC+QR HQN+LE    + +   +  + +PL ++ LGAI++ SR+ Y  GY TGDP KR  
Sbjct  55   NCIQRAHQNTLEVYAQWLVFQTIAALVYPLSASVLGAIWVTSRFSYAWGYYTGDPAKRMN  114

Query  374  LGKYGFIAIFGLQICAISCAIKLL  445
             G YG+I  FG+   +I+ A++LL
Sbjct  115  -GAYGYIGYFGVIFLSIAVALQLL  137



>ref|XP_003999582.1| PREDICTED: microsomal glutathione S-transferase 3 [Felis catus]
 ref|XP_006943046.1| PREDICTED: microsomal glutathione S-transferase 3 [Felis catus]
 ref|XP_007078171.1| PREDICTED: microsomal glutathione S-transferase 3 [Panthera tigris 
altaica]
Length=152

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAI  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLLGTTVCSAFQHL  137



>ref|XP_006104753.1| PREDICTED: microsomal glutathione S-transferase 3 [Myotis lucifugus]
Length=152

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP + + LG  +IV R  Y  GY TG+P+KR + G  G 
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPSKR-SRGALGS  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL    +  A + L
Sbjct  120  IALLGLMGTTVCSAFQHL  137



>ref|XP_004454726.1| PREDICTED: microsomal glutathione S-transferase 3-like [Dasypus 
novemcinctus]
Length=175

 Score =   112 bits (280),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + IL KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  24   MAILSKEYGFVVLTGAASFIMVAHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  81

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  82   RAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  140

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  141  GSIALMGLMGTTVCSAFQHL  160



>ref|NP_001038021.1| microsomal glutathione S-transferase 3 [Sus scrofa]
 ref|XP_005663204.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Sus scrofa]
 gb|ABD18455.1| microsomal glutathione S-transferase 3 [Sus scrofa]
 gb|ABM30152.1| microsomal glutathione S-transferase 3 [Sus scrofa]
Length=151

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MTVLSKEYGFVVLTGAASFIMVGHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GGI HP I + LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGIYHPRIVSGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALIGLMGTTVYSAFQHL  137



>ref|NP_001264462.1| microsomal glutathione S-transferase 3 [Gallus gallus]
 ref|NP_001264466.1| microsomal glutathione S-transferase 3 [Gallus gallus]
Length=143

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 62/140 (44%), Positives = 79/140 (56%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L   +   VG ARKKY V YPTMY+ +AEN   K+FNC+Q
Sbjct  1    MAVLSKEYGYVILTGAASFVLVTHLAVNVGKARKKYNVEYPTMYSTDAEN--GKIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GGI HP IS  LG  +I+ R  Y  GY TG+P  R   G  
Sbjct  59   RAHQNTLEVYPSFLFFLATGGIYHPRISTGLGIAWILGRLLYAHGYYTGEPKNR-RRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G  A+ GL    +  A + L
Sbjct  118  GSAALIGLVGTGVYSAFQHL  137



>gb|EIE78695.1| hypothetical protein RO3G_03399 [Rhizopus delemar RA 99-880]
Length=146

 Score =   111 bits (277),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/130 (44%), Positives = 84/130 (65%), Gaps = 5/130 (4%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL---FNCV  202
            I+P EYGYV+ V  L  F  + +G +VG ARK  ++PYP +YA +AE +   L   FNCV
Sbjct  5    IVPSEYGYVLGVAGLGAFHLVSLGMKVGKARKAAQIPYPYVYAEKAEAEKDPLKHVFNCV  64

Query  203  QRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TL  376
            QR HQN+LE  PV+   +++GG+++P ISA  G +Y++ R  Y +GY++G P KR    +
Sbjct  65   QRAHQNTLEMFPVYTTFLLIGGLKYPEISAGAGVVYLLGRVLYASGYSSGSPEKRTRGAI  124

Query  377  GKYGFIAIFG  406
            G  GF+ + G
Sbjct  125  GYLGFLTLIG  134



>ref|XP_006887439.1| PREDICTED: microsomal glutathione S-transferase 3 [Elephantulus 
edwardii]
 ref|XP_006892724.1| PREDICTED: microsomal glutathione S-transferase 3-like [Elephantulus 
edwardii]
Length=151

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG VV+  V    +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGLVVLTGVASFMMVGHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I + LG  +I+ R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGMAWIIGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCSAFQHL  137



>ref|XP_001493558.1| PREDICTED: microsomal glutathione S-transferase 3 [Equus caballus]
 ref|XP_008512708.1| PREDICTED: microsomal glutathione S-transferase 3 [Equus przewalskii]
 ref|XP_008512709.1| PREDICTED: microsomal glutathione S-transferase 3 [Equus przewalskii]
Length=155

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 57/132 (43%), Positives = 78/132 (59%), Gaps = 4/132 (3%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFIMVAHLAVNVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR    LG  
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIASGLGWAWIVGRVLYAYGYYTGEPSKRNRGALGSI  120

Query  386  GFIAIFGLQICA  421
              I + G  +C+
Sbjct  121  ALIGLMGTTVCS  132



>ref|XP_007538725.1| PREDICTED: microsomal glutathione S-transferase 3 [Erinaceus 
europaeus]
Length=152

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 61/140 (44%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+++ EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVAKARKKYKVEYPTMYSMDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPRKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLMGTTVCAAFQHL  137



>ref|XP_004706818.1| PREDICTED: microsomal glutathione S-transferase 3 [Echinops telfairi]
Length=152

 Score =   111 bits (278),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 58/134 (43%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVVLTGAASFIMVAHLAINVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLG  379
            R HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P+KR    LG
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPSKRNRGALG  118

Query  380  KYGFIAIFGLQICA  421
                I + G  +C+
Sbjct  119  SIALIGLMGTTVCS  132



>gb|KFP33177.1| Microsomal glutathione S-transferase 3, partial [Colius striatus]
Length=140

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L + +   VG ARKKY V YPTMY+ + E+   ++FNC+Q
Sbjct  1    MAVLSKEYGYVILTGAASFILVMHLAINVGRARKKYNVEYPTMYSTDPEH--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP     LG  +I+ R  Y  GY TGDP +R + G +
Sbjct  59   RAHQNTLEVYPSFLFFLATGGLYHPRAVTGLGITWILGRILYAYGYYTGDPKQR-SRGGF  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL   ++  A + L
Sbjct  118  GSIALLGLAGTSVCSACRHL  137



>ref|XP_002414188.1| microsomal glutathione S-transferase, putative [Ixodes scapularis]
 gb|EEC17496.1| microsomal glutathione S-transferase, putative [Ixodes scapularis]
Length=158

 Score =   111 bits (278),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 53/113 (47%), Positives = 74/113 (65%), Gaps = 7/113 (6%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKL-FNCVQR  208
            ++PKEYGYVV+V V    +N+W+  +VG AR+ Y V YP MY+      D  + FNC+QR
Sbjct  23   VVPKEYGYVVLVGVGSTLVNMWLSIRVGKARRLYDVKYPAMYS------DTNIVFNCIQR  76

Query  209  GHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
             HQN LE  P F M++ LGGI +P ++A+ G +++  R  Y  GY+TGDP KR
Sbjct  77   SHQNFLEYYPQFLMVLFLGGIEYPRLAAASGVVFLAGRIVYALGYSTGDPAKR  129



>ref|XP_002809897.1| PREDICTED: microsomal glutathione S-transferase 3 [Pongo abelii]
Length=152

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 59/140 (42%), Positives = 84/140 (60%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN   ++FNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLVGTTVCSAFQHL  137



>ref|XP_010203778.1| PREDICTED: microsomal glutathione S-transferase 3 [Colius striatus]
Length=143

 Score =   110 bits (276),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 58/140 (41%), Positives = 82/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L + +   VG ARKKY V YPTMY+ + E+   ++FNC+Q
Sbjct  1    MAVLSKEYGYVILTGAASFILVMHLAINVGRARKKYNVEYPTMYSTDPEH--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   +  GG+ HP     LG  +I+ R  Y  GY TGDP +R + G +
Sbjct  59   RAHQNTLEVYPSFLFFLATGGLYHPRAVTGLGITWILGRILYAYGYYTGDPKQR-SRGGF  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL   ++  A + L
Sbjct  118  GSIALLGLAGTSVCSACRHL  137



>ref|XP_006775051.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Myotis davidii]
 ref|XP_006775052.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Myotis davidii]
Length=152

 Score =   111 bits (277),  Expect = 4e-27, Method: Compositional matrix adjust.
 Identities = 60/138 (43%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+VV+       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVVLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSSDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP + + LG  +IV R  Y  GY TG+P+KR + G  G 
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPSKR-SRGALGS  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL    +  A + L
Sbjct  120  IALLGLMGTTVCSAFQHL  137



>ref|NP_001253710.1| microsomal glutathione S-transferase 3 [Macaca mulatta]
 ref|XP_005539904.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Macaca fascicularis]
 ref|XP_007987887.1| PREDICTED: microsomal glutathione S-transferase 3 [Chlorocebus 
sabaeus]
 dbj|BAE87844.1| unnamed protein product [Macaca fascicularis]
 dbj|BAE91086.1| unnamed protein product [Macaca fascicularis]
 gb|AHH29319.1| microsomal glutathione S-transferase 3 [Macaca fascicularis]
 gb|AHH29320.1| microsomal glutathione S-transferase 3 [Macaca mulatta]
Length=152

 Score =   111 bits (277),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  1    MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  59   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  117

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  118  GSIALLGLVGTTVCSAFQHL  137



>ref|XP_009059955.1| hypothetical protein LOTGIDRAFT_209813 [Lottia gigantea]
 gb|ESO88900.1| hypothetical protein LOTGIDRAFT_209813 [Lottia gigantea]
Length=137

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 57/137 (42%), Positives = 83/137 (61%), Gaps = 7/137 (5%)
 Frame = +2

Query  35   LPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGH  214
            +P EYGYV++VL     +   +   V  ARKKYKV YP +Y+    N +   FNCVQR H
Sbjct  5    IPSEYGYVILVLPATWIVLTILAMNVMKARKKYKVEYPNLYS---NNHN---FNCVQRAH  58

Query  215  QNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGFI  394
            QN+LEN+  F M ++ GG++ P + A+ G +Y++SR  Y  GY TGDP KR   G +G+I
Sbjct  59   QNTLENLTFFIMFLLAGGLQFPKLCAASGVLYLISRLVYAYGYYTGDPAKR-NYGAFGYI  117

Query  395  AIFGLQICAISCAIKLL  445
             +  L +C +   + +L
Sbjct  118  GLMTLIVCTVITGLNML  134



>ref|XP_005846439.1| hypothetical protein CHLNCDRAFT_135580 [Chlorella variabilis]
 gb|EFN54337.1| hypothetical protein CHLNCDRAFT_135580 [Chlorella variabilis]
Length=205

 Score =   112 bits (280),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 60/120 (50%), Positives = 79/120 (66%), Gaps = 12/120 (10%)
 Frame = +2

Query  89   NLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRGHQNSLENMPVFFMLMILGG  268
            N+WMG +VG ARKKY + YPT+YA    +KD K FNCVQR HQNSLEN+P F+ L++  G
Sbjct  74   NIWMGMKVGQARKKYGITYPTLYAPPG-HKDEKAFNCVQRAHQNSLENLPSFYALLLTAG  132

Query  269  IRHP--------LISASL-GAIYIVSRYGYFTGYATGDPTKRYTLG--KYGFIAIFGLQI  415
            I+          LISAS+ GA+ +V R  +F GY+TGDP  RY  G   +G +A+ G+ I
Sbjct  133  IKASGPRLAHSYLISASIAGAVALVGRIFFFNGYSTGDPKARYRGGFTHFGTLALLGMVI  192



>ref|NP_001272544.1| microsomal glutathione S-transferase 3 [Capra hircus]
 ref|XP_004002770.1| PREDICTED: microsomal glutathione S-transferase 3 isoform 1 [Ovis 
aries]
 ref|XP_004002771.1| PREDICTED: microsomal glutathione S-transferase 3 isoform 2 [Ovis 
aries]
 gb|ABL96621.1| microsomal glutathione S-transferase 3 [Capra hircus]
Length=152

 Score =   110 bits (276),  Expect = 5e-27, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    +FNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHIFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P KR   G   F
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPRKR-QRGALSF  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL    +  A + L
Sbjct  120  IALIGLMGTTVCSAFQHL  137



>ref|XP_008932155.1| PREDICTED: microsomal glutathione S-transferase 3 [Manacus vitellinus]
Length=149

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L + +  +VG ARKKY V YPTMY+ + EN   ++FNC+Q
Sbjct  1    MAVLSKEYGYVMLTGAASFVLVMHLAVKVGKARKKYNVDYPTMYSTDPEN--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPT--KRYTLG  379
            R HQN+LE  P F   +  GGI HP  +  LG  +I+ R  Y  GY TGDP   +R  +G
Sbjct  59   RAHQNTLEVYPAFLFFLATGGIYHPRAATGLGIAWIIGRILYAHGYYTGDPKNRRRGAIG  118

Query  380  KYGFIAIFGLQICA  421
                + + G  +C+
Sbjct  119  SVALLGLLGTGVCS  132



>gb|KFW76310.1| Microsomal glutathione S-transferase 3, partial [Manacus vitellinus]
Length=146

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 55/134 (41%), Positives = 78/134 (58%), Gaps = 4/134 (3%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYGYV++       L + +  +VG ARKKY V YPTMY+ + EN   ++FNC+Q
Sbjct  1    MAVLSKEYGYVMLTGAASFVLVMHLAVKVGKARKKYNVDYPTMYSTDPEN--GRIFNCIQ  58

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPT--KRYTLG  379
            R HQN+LE  P F   +  GGI HP  +  LG  +I+ R  Y  GY TGDP   +R  +G
Sbjct  59   RAHQNTLEVYPAFLFFLATGGIYHPRAATGLGIAWIIGRILYAHGYYTGDPKNRRRGAIG  118

Query  380  KYGFIAIFGLQICA  421
                + + G  +C+
Sbjct  119  SVALLGLLGTGVCS  132



>ref|XP_004282094.1| PREDICTED: microsomal glutathione S-transferase 3 [Orcinus orca]
 ref|XP_004326057.1| PREDICTED: microsomal glutathione S-transferase 3-like [Tursiops 
truncatus]
Length=152

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP + + LG  +IV R  Y  GY TG+P KR   G   F
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVVSGLGLAWIVGRVLYAYGYYTGEPRKR-KRGALSF  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL   ++  A + L
Sbjct  120  IALIGLMGTSVCSAFQHL  137



>gb|ACQ58232.1| Microsomal glutathione S-transferase 3 [Anoplopoma fimbria]
Length=153

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/138 (41%), Positives = 83/138 (60%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  V    +   +  +V  ARKKY V YP MY+   E  +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGVASMVMIGHLAMKVVKARKKYNVQYPQMYSDNPETGN--IFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE+ P F   + +GG+  P +S+ LGA +I+SR  Y  GY++GDP KR   G +G 
Sbjct  61   HQNTLESYPAFLFCLAVGGLHSPRLSSGLGAAWIISREVYAHGYSSGDPKKRMR-GAFGN  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ G+ +  +     LL
Sbjct  120  VALLGMMLSTVCFGRTLL  137



>ref|XP_007360611.1| membrane-associated proteins in eicosanoid and glutathione metabolism 
[Dichomitus squalens LYAD-421 SS1]
 gb|EJF67198.1| membrane-associated proteins in eicosanoid and glutathione metabolism 
[Dichomitus squalens LYAD-421 SS1]
Length=153

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 57/145 (39%), Positives = 89/145 (61%), Gaps = 6/145 (4%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAE---NKDAK  187
            M+G+ +L KE+ Y V   V   +L  W   +VG ARK  K+ YP +YA +AE   N+ A+
Sbjct  1    MSGI-VLHKEFAYPVAAAVSTFWLLTWQTIRVGAARKLAKIDYPQVYAEKAEAAVNQAAQ  59

Query  188  LFNCVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKR  367
             FNC QR HQN+LE +PV     ++ G++HP+ +++L   ++++R  Y  GY+TGDP KR
Sbjct  60   KFNCAQRAHQNTLEVLPVILTGTLVTGLKHPIAASALCGTWVLARVFYTIGYSTGDPKKR  119

Query  368  YTL--GKYGFIAIFGLQICAISCAI  436
              L     G +A+FGL + + + A+
Sbjct  120  NMLKSSTIGGLALFGLVLTSTASAV  144



>ref|XP_006175993.1| PREDICTED: microsomal glutathione S-transferase 3 [Camelus ferus]
 ref|XP_010952098.1| PREDICTED: microsomal glutathione S-transferase 3 [Camelus bactrianus]
 ref|XP_010982740.1| PREDICTED: microsomal glutathione S-transferase 3 [Camelus dromedarius]
Length=152

 Score =   110 bits (276),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 77/132 (58%), Gaps = 4/132 (3%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       L   +   V  ARKKYKV YPTMY+ + EN    LFNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFILVGHLAVNVAKARKKYKVEYPTMYSTDPEN--GHLFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRY--TLGKY  385
            HQN+LE  P F   + +GG+ HP I + LG  +IV R  Y  GY TG+P+KR    LG  
Sbjct  61   HQNTLEMYPPFLFFLAVGGVYHPRIVSGLGLAWIVGRVLYAYGYYTGEPSKRNRGALGSI  120

Query  386  GFIAIFGLQICA  421
              I + G  +C+
Sbjct  121  ALIGLMGTTVCS  132



>ref|XP_009671061.1| PREDICTED: microsomal glutathione S-transferase 3 [Struthio camelus 
australis]
Length=143

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYV++       L   +  +V  ARKKY V YPTMY+ +AEN   ++FNC+QR 
Sbjct  3    VLSKEYGYVILTGAASFVLVTHLAVKVSKARKKYNVEYPTMYSTDAEN--GRMFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   +  GG+ HP I+  LG  +I+ R  Y  GY TGDP KR   G +  
Sbjct  61   HQNTLEVYPPFLFFLATGGVYHPRIATGLGIAWILGRILYAYGYYTGDPRKR-MRGAFSS  119

Query  392  IAIFGLQICAISCAIKLL  445
             A+ GL    +  A + L
Sbjct  120  AALIGLMGTGVYSAFQHL  137



>gb|KFV80109.1| Microsomal glutathione S-transferase 3, partial [Struthio camelus 
australis]
Length=142

 Score =   110 bits (275),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 59/138 (43%), Positives = 79/138 (57%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYV++       L   +  +V  ARKKY V YPTMY+ +AEN   ++FNC+QR 
Sbjct  3    VLSKEYGYVILTGAASFVLVTHLAVKVSKARKKYNVEYPTMYSTDAEN--GRMFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   +  GG+ HP I+  LG  +I+ R  Y  GY TGDP KR   G +  
Sbjct  61   HQNTLEVYPPFLFFLATGGVYHPRIATGLGIAWILGRILYAYGYYTGDPRKR-MRGAFSS  119

Query  392  IAIFGLQICAISCAIKLL  445
             A+ GL    +  A + L
Sbjct  120  AALIGLMGTGVYSAFQHL  137



>ref|XP_005994840.1| PREDICTED: microsomal glutathione S-transferase 3 [Latimeria 
chalumnae]
Length=146

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 81/138 (59%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYGYVV+  V    +   +   VG ARKKY V YP MY+ + +N +  +FNC+QR 
Sbjct  3    VLSKEYGYVVLTGVASFIMVGHLAMNVGKARKKYNVEYPQMYSEDTDNGN--MFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE    F   + +GG+ HP ++++LG  +I+ R  Y  GY TGDP KR   G +  
Sbjct  61   HQNTLETYAPFLFFLTVGGLHHPRLASALGVTWIIGREFYAYGYYTGDPKKR-MRGAFSS  119

Query  392  IAIFGLQICAISCAIKLL  445
            +A+ GL   A S A   L
Sbjct  120  LALLGLMGTAASFAFHHL  137



>ref|XP_005984246.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X2 
[Pantholops hodgsonii]
 ref|XP_005984247.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X3 
[Pantholops hodgsonii]
Length=152

 Score =   110 bits (275),  Expect = 7e-27, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    +FNC+QR 
Sbjct  3    VLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHIFNCIQRA  60

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P KR   G   F
Sbjct  61   HQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPRKR-QRGALSF  119

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL    +  A + L
Sbjct  120  IALIGLMGTTVCSAFQHL  137



>emb|CBJ28851.1| microsomal Glutathione S-transferase [Ectocarpus siliculosus]
Length=141

 Score =   110 bits (274),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 56/142 (39%), Positives = 80/142 (56%), Gaps = 3/142 (2%)
 Frame = +2

Query  17   MAGVEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFN  196
            M  +E+ P  +G+ + V +   F+  W G  VG ARKKY + YP MYA +  + +  +FN
Sbjct  1    MVTIELTPA-HGFPMAVAICSAFVTTWAGVGVGMARKKYGIKYPQMYA-DQSDANGVIFN  58

Query  197  CVQRGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTL  376
            C QR HQN LEN P F +L+ L  I  P I+   GA+ +     Y  GY TGDP KR+  
Sbjct  59   CYQRAHQNVLENYPSFLLLLGLAAINRPTIAGVAGAVRLAGFVAYVIGYRTGDPEKRHR-  117

Query  377  GKYGFIAIFGLQICAISCAIKL  442
            G +G+I +  +  CAI   +K+
Sbjct  118  GAFGYIGLLTMLGCAIESVVKV  139



>gb|EHH15773.1| hypothetical protein EGK_01909, partial [Macaca mulatta]
 gb|EHH50782.1| hypothetical protein EGM_01659, partial [Macaca fascicularis]
Length=169

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 60/140 (43%), Positives = 83/140 (59%), Gaps = 3/140 (2%)
 Frame = +2

Query  26   VEILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQ  205
            + +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    LFNC+Q
Sbjct  18   MAVLSKEYGFVLLTGAASFIMVAHLAINVSKARKKYKVEYPTMYSTDPEN--GHLFNCIQ  75

Query  206  RGHQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKY  385
            R HQN+LE  P F   + +GG+ HP I++ LG  +IV R  Y  GY TG+P+KR + G  
Sbjct  76   RAHQNTLEVYPPFLFFLAVGGVYHPRIASGLGLAWIVGRVLYAYGYYTGEPSKR-SRGAL  134

Query  386  GFIAIFGLQICAISCAIKLL  445
            G IA+ GL    +  A + L
Sbjct  135  GSIALLGLVGTTVCSAFQHL  154



>ref|XP_005984245.1| PREDICTED: microsomal glutathione S-transferase 3 isoform X1 
[Pantholops hodgsonii]
Length=161

 Score =   110 bits (276),  Expect = 8e-27, Method: Compositional matrix adjust.
 Identities = 58/138 (42%), Positives = 80/138 (58%), Gaps = 3/138 (2%)
 Frame = +2

Query  32   ILPKEYGYVVIVLVLYCFLNLWMGFQVGTARKKYKVPYPTMYAIEAENKDAKLFNCVQRG  211
            +L KEYG+V++       +   +   V  ARKKYKV YPTMY+ + EN    +FNC+QR 
Sbjct  12   VLSKEYGFVILTGAASFLMVTHLAINVSKARKKYKVEYPTMYSTDPEN--GHIFNCIQRA  69

Query  212  HQNSLENMPVFFMLMILGGIRHPLISASLGAIYIVSRYGYFTGYATGDPTKRYTLGKYGF  391
            HQN+LE  P F   + +GG+ HP +++ LG  +IV R  Y  GY TG+P KR   G   F
Sbjct  70   HQNTLEVYPPFLFFLAVGGVYHPRVASGLGLAWIVGRVLYAYGYYTGEPRKR-QRGALSF  128

Query  392  IAIFGLQICAISCAIKLL  445
            IA+ GL    +  A + L
Sbjct  129  IALIGLMGTTVCSAFQHL  146



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 672416417960