BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A09

Length=547
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010320455.1|  PREDICTED: BTB/POZ domain-containing protein...    213   8e-61   Solanum lycopersicum
ref|XP_007018027.1|  BTB/POZ domain-containing protein isoform 3        212   1e-60   
ref|XP_007018025.1|  BTB/POZ domain-containing protein isoform 1        212   1e-60   
ref|XP_007018026.1|  BTB/POZ domain-containing protein isoform 2        206   3e-60   
ref|XP_009631572.1|  PREDICTED: BTB/POZ domain-containing protein...    209   1e-59   Nicotiana tomentosiformis
ref|XP_006342129.1|  PREDICTED: BTB/POZ domain-containing protein...    209   1e-59   Solanum tuberosum [potatoes]
ref|XP_009631574.1|  PREDICTED: BTB/POZ domain-containing protein...    209   1e-59   
ref|XP_009759339.1|  PREDICTED: BTB/POZ domain-containing protein...    209   2e-59   Nicotiana sylvestris
ref|XP_006473784.1|  PREDICTED: BTB/POZ domain-containing protein...    208   3e-59   Citrus sinensis [apfelsine]
ref|XP_004238427.1|  PREDICTED: BTB/POZ domain-containing protein...    208   3e-59   Solanum lycopersicum
ref|XP_011074097.1|  PREDICTED: BTB/POZ domain-containing protein...    207   4e-59   Sesamum indicum [beniseed]
ref|XP_006435355.1|  hypothetical protein CICLE_v10003249mg             208   4e-59   
ref|XP_006342130.1|  PREDICTED: BTB/POZ domain-containing protein...    207   4e-59   Solanum tuberosum [potatoes]
ref|XP_006473785.1|  PREDICTED: BTB/POZ domain-containing protein...    206   1e-58   Citrus sinensis [apfelsine]
gb|KHG01113.1|  hypothetical protein F383_22949                         206   2e-58   Gossypium arboreum [tree cotton]
ref|XP_002300643.1|  BTB/POZ domain-containing family protein           206   2e-58   Populus trichocarpa [western balsam poplar]
ref|XP_002307790.1|  BTB/POZ domain-containing family protein           206   2e-58   
gb|KJB57964.1|  hypothetical protein B456_009G187700                    206   2e-58   Gossypium raimondii
ref|XP_010094552.1|  BTB/POZ domain-containing protein                  206   2e-58   Morus notabilis
ref|XP_009631576.1|  PREDICTED: BTB/POZ domain-containing protein...    205   3e-58   Nicotiana tomentosiformis
ref|XP_011034881.1|  PREDICTED: BTB/POZ domain-containing protein...    204   5e-58   Populus euphratica
ref|XP_011034879.1|  PREDICTED: BTB/POZ domain-containing protein...    204   7e-58   Populus euphratica
gb|EYU36560.1|  hypothetical protein MIMGU_mgv1a001528mg                202   3e-57   Erythranthe guttata [common monkey flower]
ref|XP_008221133.1|  PREDICTED: BTB/POZ domain-containing protein...    202   3e-57   Prunus mume [ume]
ref|XP_011041233.1|  PREDICTED: BTB/POZ domain-containing protein...    202   4e-57   Populus euphratica
ref|XP_011013905.1|  PREDICTED: BTB/POZ domain-containing protein...    202   5e-57   Populus euphratica
ref|XP_002270675.1|  PREDICTED: BTB/POZ domain-containing protein...    201   1e-56   Vitis vinifera
emb|CBI40712.3|  unnamed protein product                                200   1e-56   Vitis vinifera
ref|XP_010266159.1|  PREDICTED: BTB/POZ domain-containing protein...    200   2e-56   Nelumbo nucifera [Indian lotus]
ref|XP_007221940.1|  hypothetical protein PRUPE_ppa001540mg             199   6e-56   Prunus persica
gb|KDP36794.1|  hypothetical protein JCGZ_08085                         195   6e-56   Jatropha curcas
ref|XP_010935266.1|  PREDICTED: BTB/POZ domain-containing protein...    198   1e-55   
ref|XP_004291228.1|  PREDICTED: BTB/POZ domain-containing protein...    197   1e-55   Fragaria vesca subsp. vesca
ref|XP_008781287.1|  PREDICTED: BTB/POZ domain-containing protein...    195   9e-55   
ref|XP_002510674.1|  protein binding protein, putative                  195   9e-55   Ricinus communis
ref|XP_008781284.1|  PREDICTED: BTB/POZ domain-containing protein...    195   1e-54   
ref|XP_006410166.1|  hypothetical protein EUTSA_v10016264mg             195   1e-54   Eutrema salsugineum [saltwater cress]
gb|KEH28127.1|  BTB/POZ domain plant protein                            192   3e-54   Medicago truncatula
ref|XP_010469825.1|  PREDICTED: BTB/POZ domain-containing protein...    194   4e-54   Camelina sativa [gold-of-pleasure]
ref|XP_010556054.1|  PREDICTED: BTB/POZ domain-containing protein...    193   6e-54   Tarenaya hassleriana [spider flower]
emb|CDP07293.1|  unnamed protein product                                192   8e-54   Coffea canephora [robusta coffee]
ref|XP_006596518.1|  PREDICTED: BTB/POZ domain-containing protein...    191   3e-53   
ref|XP_003545003.1|  PREDICTED: BTB/POZ domain-containing protein...    191   5e-53   Glycine max [soybeans]
ref|XP_010469824.1|  PREDICTED: BTB/POZ domain-containing protein...    190   6e-53   Camelina sativa [gold-of-pleasure]
ref|XP_010414240.1|  PREDICTED: BTB/POZ domain-containing protein...    190   6e-53   
ref|XP_006596517.1|  PREDICTED: BTB/POZ domain-containing protein...    190   6e-53   
gb|AES98295.2|  BTB/POZ domain plant protein                            190   7e-53   Medicago truncatula
ref|XP_008377082.1|  PREDICTED: BTB/POZ domain-containing protein...    190   9e-53   
ref|XP_008377081.1|  PREDICTED: BTB/POZ domain-containing protein...    190   9e-53   
ref|XP_008377080.1|  PREDICTED: BTB/POZ domain-containing protein...    190   9e-53   Malus domestica [apple tree]
ref|XP_007160598.1|  hypothetical protein PHAVU_001G001100g             189   1e-52   Phaseolus vulgaris [French bean]
gb|AAB63077.1|  unknown protein                                         188   1e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003615337.1|  Kelch-like protein                                 190   1e-52   
gb|EPS65824.1|  hypothetical protein M569_08953                         188   3e-52   Genlisea aurea
ref|NP_180618.2|  BTB/POZ domain-containing protein                     188   4e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010469826.1|  PREDICTED: BTB/POZ domain-containing protein...    187   6e-52   Camelina sativa [gold-of-pleasure]
ref|NP_001189642.1|  BTB/POZ domain-containing protein                  187   7e-52   Arabidopsis thaliana [mouse-ear cress]
ref|XP_004512607.1|  PREDICTED: BTB/POZ domain-containing protein...    187   8e-52   Cicer arietinum [garbanzo]
ref|XP_004512608.1|  PREDICTED: BTB/POZ domain-containing protein...    187   1e-51   Cicer arietinum [garbanzo]
ref|XP_010510327.1|  PREDICTED: BTB/POZ domain-containing protein...    186   1e-51   Camelina sativa [gold-of-pleasure]
dbj|BAD93995.1|  hypothetical protein                                   186   1e-51   Arabidopsis thaliana [mouse-ear cress]
gb|KFK23322.1|  hypothetical protein AALP_AAs74635U001200               186   1e-51   Arabis alpina [alpine rockcress]
ref|XP_002879271.1|  BTB/POZ domain-containing protein                  186   1e-51   
ref|XP_006293695.1|  hypothetical protein CARUB_v10022653mg             186   2e-51   Capsella rubella
ref|XP_004145539.1|  PREDICTED: BTB/POZ domain-containing protein...    186   2e-51   Cucumis sativus [cucumbers]
ref|XP_009141083.1|  PREDICTED: BTB/POZ domain-containing protein...    186   2e-51   Brassica rapa
ref|XP_009141084.1|  PREDICTED: BTB/POZ domain-containing protein...    186   3e-51   Brassica rapa
ref|XP_010061166.1|  PREDICTED: BTB/POZ domain-containing protein...    184   9e-51   Eucalyptus grandis [rose gum]
emb|CDY29657.1|  BnaA04g17700D                                          184   1e-50   Brassica napus [oilseed rape]
ref|XP_010061165.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50   Eucalyptus grandis [rose gum]
ref|XP_008452951.1|  PREDICTED: BTB/POZ domain-containing protein...    184   1e-50   Cucumis melo [Oriental melon]
dbj|BAH56763.1|  AT2G30600                                              180   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009418296.1|  PREDICTED: BTB/POZ domain-containing protein...    180   3e-49   Musa acuminata subsp. malaccensis [pisang utan]
gb|EEC79014.1|  hypothetical protein OsI_19541                          178   1e-48   Oryza sativa Indica Group [Indian rice]
gb|AAV43802.1|  unknown protein                                         177   4e-48   Oryza sativa Japonica Group [Japonica rice]
emb|CDX97805.1|  BnaC04g41340D                                          176   5e-48   
ref|XP_010692549.1|  PREDICTED: BTB/POZ domain-containing protein...    176   7e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006664953.1|  PREDICTED: BTB/POZ domain-containing protein...    174   6e-47   Oryza brachyantha
ref|XP_003561246.1|  PREDICTED: BTB/POZ domain-containing protein...    171   8e-46   Brachypodium distachyon [annual false brome]
ref|XP_002437659.1|  hypothetical protein SORBIDRAFT_10g000240          169   2e-45   Sorghum bicolor [broomcorn]
dbj|BAK07994.1|  predicted protein                                      166   3e-45   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDM85346.1|  unnamed protein product                                168   7e-45   Triticum aestivum [Canadian hard winter wheat]
ref|XP_006828729.1|  hypothetical protein AMTR_s00001p00041750          167   1e-44   
ref|XP_004964253.1|  PREDICTED: LOW QUALITY PROTEIN: BTB/POZ doma...    165   1e-43   
gb|EEE63337.1|  hypothetical protein OsJ_18148                          133   2e-32   Oryza sativa Japonica Group [Japonica rice]
ref|XP_001751401.1|  predicted protein                                  120   7e-28   
ref|XP_002965955.1|  hypothetical protein SELMODRAFT_84039              113   3e-25   
ref|XP_002962812.1|  hypothetical protein SELMODRAFT_438140             112   4e-25   
gb|KDD75170.1|  hypothetical protein H632_c829p0                      59.3    2e-07   Helicosporidium sp. ATCC 50920
ref|XP_005845262.1|  hypothetical protein CHLNCDRAFT_58586            55.5    5e-06   Chlorella variabilis



>ref|XP_010320455.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Solanum lycopersicum]
Length=824

 Score =   213 bits (541),  Expect = 8e-61, Method: Composition-based stats.
 Identities = 96/113 (85%), Positives = 101/113 (89%), Gaps = 0/113 (0%)
 Frame = +1

Query  208  EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYH  387
            +GE ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYH
Sbjct  18   QGEMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYH  77

Query  388  YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            YKRD+ PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  78   YKRDNCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  130



>ref|XP_007018027.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
 gb|EOY15252.1| BTB/POZ domain-containing protein isoform 3 [Theobroma cacao]
Length=789

 Score =   212 bits (539),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  109



>ref|XP_007018025.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
 gb|EOY15250.1| BTB/POZ domain-containing protein isoform 1 [Theobroma cacao]
Length=805

 Score =   212 bits (539),  Expect = 1e-60, Method: Composition-based stats.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  109



>ref|XP_007018026.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
 gb|EOY15251.1| BTB/POZ domain-containing protein isoform 2 [Theobroma cacao]
Length=495

 Score =   206 bits (524),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAWR DL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  1    MEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRNRRLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNRRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  109



>ref|XP_009631572.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Nicotiana tomentosiformis]
Length=826

 Score =   209 bits (533),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  211  GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY  390
            GE +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHY
Sbjct  21   GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHY  80

Query  391  KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  81   KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  132



>ref|XP_006342129.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Solanum tuberosum]
Length=824

 Score =   209 bits (532),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 95/111 (86%), Positives = 99/111 (89%), Gaps = 0/111 (0%)
 Frame = +1

Query  214  ETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYK  393
            E ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHYK
Sbjct  20   EMMEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYK  79

Query  394  RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            RD+ PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  80   RDNCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  130



>ref|XP_009631574.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
 ref|XP_009631575.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Nicotiana tomentosiformis]
Length=824

 Score =   209 bits (532),  Expect = 1e-59, Method: Composition-based stats.
 Identities = 94/112 (84%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  211  GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY  390
            GE +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHY
Sbjct  19   GEMLEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHY  78

Query  391  KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  79   KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  130



>ref|XP_009759339.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nicotiana 
sylvestris]
Length=810

 Score =   209 bits (531),  Expect = 2e-59, Method: Composition-based stats.
 Identities = 93/112 (83%), Positives = 99/112 (88%), Gaps = 0/112 (0%)
 Frame = +1

Query  211  GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY  390
            GE M+ K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VT+VFRE VGSQHYHY
Sbjct  19   GEMMDKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTIVFREQVGSQHYHY  78

Query  391  KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            KRD+ PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  79   KRDNCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  130



>ref|XP_006473784.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Citrus sinensis]
Length=817

 Score =   208 bits (529),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 94/112 (84%), Positives = 102/112 (91%), Gaps = 0/112 (0%)
 Frame = +1

Query  211  GETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY  390
            G+  E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VTVVFRE+VGSQHYHY
Sbjct  10   GKMAEKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHY  69

Query  391  KRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            KRD+SPHYTVIIGS+RNRRLKIEV+G+TVVDVA V LCCSS FQSYWI IYD
Sbjct  70   KRDNSPHYTVIIGSNRNRRLKIEVNGKTVVDVAGVGLCCSSAFQSYWISIYD  121



>ref|XP_004238427.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
 ref|XP_010320456.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Solanum lycopersicum]
Length=804

 Score =   208 bits (529),  Expect = 3e-59, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHYKRD
Sbjct  2    MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            + PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  62   NCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  110



>ref|XP_011074097.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Sesamum 
indicum]
Length=804

 Score =   207 bits (528),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPF+CAW DDLRFREAGRGCVAFDAFAHN VTVVFRE+ GSQHYHYKRD
Sbjct  1    MEKKQKKFLTVAPFQCAWHDDLRFREAGRGCVAFDAFAHNDVTVVFRENAGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRN+RL IEV+G+TVVDVA VDL CSSTFQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNKRLNIEVNGKTVVDVAGVDLYCSSTFQSYWISIYD  109



>ref|XP_006435355.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
 gb|ESR48595.1| hypothetical protein CICLE_v10003249mg [Citrus clementina]
Length=818

 Score =   208 bits (529),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 94/108 (87%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  223  EIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDD  402
            E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VTVVFRE+VGSQHYHYKRD+
Sbjct  3    EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHYKRDN  62

Query  403  SPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            SPHYTVIIGS+RNRRLKIEVDG+TVVDVA V LCCSS FQSYWI IYD
Sbjct  63   SPHYTVIIGSNRNRRLKIEVDGKTVVDVAGVGLCCSSAFQSYWISIYD  110



>ref|XP_006342130.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Solanum tuberosum]
 ref|XP_006342131.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Solanum tuberosum]
Length=804

 Score =   207 bits (528),  Expect = 4e-59, Method: Composition-based stats.
 Identities = 94/109 (86%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHYKRD
Sbjct  2    MEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            + PHYTVIIGSHRN+RLKIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  62   NCPHYTVIIGSHRNKRLKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  110



>ref|XP_006473785.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Citrus sinensis]
 ref|XP_006473786.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Citrus sinensis]
 gb|KDO85089.1| hypothetical protein CISIN_1g040529mg [Citrus sinensis]
Length=806

 Score =   206 bits (524),  Expect = 1e-58, Method: Composition-based stats.
 Identities = 93/108 (86%), Positives = 100/108 (93%), Gaps = 0/108 (0%)
 Frame = +1

Query  223  EIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDD  402
            E K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VTVVFRE+VGSQHYHYKRD+
Sbjct  3    EKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTVVFRENVGSQHYHYKRDN  62

Query  403  SPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            SPHYTVIIGS+RNRRLKIEV+G+TVVDVA V LCCSS FQSYWI IYD
Sbjct  63   SPHYTVIIGSNRNRRLKIEVNGKTVVDVAGVGLCCSSAFQSYWISIYD  110



>gb|KHG01113.1| hypothetical protein F383_22949 [Gossypium arboreum]
Length=802

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAW  DL+FREAGRGCV+FDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  1    METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRN RLKIEVDG+TVVDV  + LCCSS FQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNSRLKIEVDGKTVVDVVGIGLCCSSAFQSYWISIYD  109



>ref|XP_002300643.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE79916.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=801

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            I+  KFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYKRD+S
Sbjct  2    IEENKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYD
Sbjct  62   PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWISIYD  108



>ref|XP_002307790.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
 gb|EEE94786.1| BTB/POZ domain-containing family protein [Populus trichocarpa]
Length=806

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYD  110



>gb|KJB57964.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
 gb|KJB57965.1| hypothetical protein B456_009G187700 [Gossypium raimondii]
Length=802

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAW  DL+FREAGRGCV+FDAFAHN VTVVFRE+VGSQHYHYKRD
Sbjct  1    METKEKKFLTVAPFECAWIKDLKFREAGRGCVSFDAFAHNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRN RLKIEVDG+TVVDV  + LCCSS FQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNSRLKIEVDGKTVVDVVGIGLCCSSAFQSYWISIYD  109



>ref|XP_010094552.1| BTB/POZ domain-containing protein [Morus notabilis]
 gb|EXB56306.1| BTB/POZ domain-containing protein [Morus notabilis]
Length=810

 Score =   206 bits (523),  Expect = 2e-58, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 101/109 (93%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K K+FLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MEKKEKEFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            ++PHYTVI+GSHRNRRL+IEVDG+TVVDV  V LCCSS+FQSYWI IYD
Sbjct  62   NTPHYTVILGSHRNRRLRIEVDGKTVVDVEGVGLCCSSSFQSYWISIYD  110



>ref|XP_009631576.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Nicotiana tomentosiformis]
Length=804

 Score =   205 bits (521),  Expect = 3e-58, Method: Composition-based stats.
 Identities = 92/109 (84%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPFECAW +DLRFREAGRGCVAFDAFAHN VTVVFRE VGSQHYHYKRD
Sbjct  2    LEKKQKKFLTVAPFECAWPNDLRFREAGRGCVAFDAFAHNDVTVVFREQVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            + PHYTVIIGSHRN+R KIEVDG+TVVD A V LCCSS FQSYWI IYD
Sbjct  62   NCPHYTVIIGSHRNKRFKIEVDGKTVVDAAGVGLCCSSAFQSYWISIYD  110



>ref|XP_011034881.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Populus euphratica]
Length=801

 Score =   204 bits (520),  Expect = 5e-58, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            I+ KKFLTVAPF+CAWR DL+FREAGRGCV FDAFAHN VTVVFRE+VGSQHYHYKRD+S
Sbjct  2    IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYD
Sbjct  62   PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWICIYD  108



>ref|XP_011034879.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
 ref|XP_011034880.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Populus euphratica]
Length=808

 Score =   204 bits (519),  Expect = 7e-58, Method: Composition-based stats.
 Identities = 91/107 (85%), Positives = 98/107 (92%), Gaps = 0/107 (0%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            I+ KKFLTVAPF+CAWR DL+FREAGRGCV FDAFAHN VTVVFRE+VGSQHYHYKRD+S
Sbjct  2    IEEKKFLTVAPFQCAWRKDLKFREAGRGCVTFDAFAHNDVTVVFRENVGSQHYHYKRDNS  61

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            PHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSSTFQSYWI IYD
Sbjct  62   PHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSTFQSYWICIYD  108



>gb|EYU36560.1| hypothetical protein MIMGU_mgv1a001528mg [Erythranthe guttata]
Length=802

 Score =   202 bits (515),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 96/109 (88%), Positives = 99/109 (91%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHN VTVVFRE  GSQHYHYKRD
Sbjct  1    MEKKQKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNDVTVVFREKTGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVIIGSHRN+RL IEVDG+TVVDV  VDL CSSTFQSYWI IYD
Sbjct  61   NSPHYTVIIGSHRNKRLNIEVDGKTVVDVTGVDLYCSSTFQSYWISIYD  109



>ref|XP_008221133.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221134.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221135.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
 ref|XP_008221136.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Prunus 
mume]
Length=805

 Score =   202 bits (514),  Expect = 3e-57, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LCCSS FQSYWI I D
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCCSSAFQSYWISICD  110



>ref|XP_011041233.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011041234.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   202 bits (514),  Expect = 4e-57, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFA N VTVVFRE+VGSQHYHYKRD
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFACNDVTVVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYD  110



>ref|XP_011013905.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
 ref|XP_011013907.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Populus 
euphratica]
Length=806

 Score =   202 bits (513),  Expect = 5e-57, Method: Composition-based stats.
 Identities = 91/109 (83%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFA N VTVVFRE+VGSQHYHYKRD
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFACNDVTVVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG+TVVD   V LCCSS FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGKTVVDEEGVALCCSSMFQSYWISIYD  110



>ref|XP_002270675.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Vitis 
vinifera]
Length=806

 Score =   201 bits (510),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPFECAWR DLRFREAGRGCVAF+AFAHN VT+VFRE VGSQHYHYKRD
Sbjct  2    IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFAHNDVTLVFRESVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSS FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSAFQSYWISIYD  110



>emb|CBI40712.3| unnamed protein product [Vitis vinifera]
Length=789

 Score =   200 bits (509),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 93/109 (85%), Positives = 100/109 (92%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPFECAWR DLRFREAGRGCVAF+AFAHN VT+VFRE VGSQHYHYKRD
Sbjct  2    IEKKQKKFLTVAPFECAWRKDLRFREAGRGCVAFEAFAHNDVTLVFRESVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSS FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSAFQSYWISIYD  110



>ref|XP_010266159.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266161.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266162.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
 ref|XP_010266163.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Nelumbo 
nucifera]
Length=806

 Score =   200 bits (508),  Expect = 2e-56, Method: Composition-based stats.
 Identities = 89/106 (84%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPFECAWR +LRFR AGRGCVAF+AFAHN VTVVFREHVGSQHYHYK D+SP
Sbjct  5    KQKKFLTVAPFECAWRKELRFRVAGRGCVAFEAFAHNDVTVVFREHVGSQHYHYKTDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +YTV++GSHRNRRLKIEVDG+TVVDVA V LCCSS F+SYWI IYD
Sbjct  65   NYTVVLGSHRNRRLKIEVDGKTVVDVAGVGLCCSSAFRSYWISIYD  110



>ref|XP_007221940.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
 gb|EMJ23139.1| hypothetical protein PRUPE_ppa001540mg [Prunus persica]
Length=805

 Score =   199 bits (505),  Expect = 6e-56, Method: Composition-based stats.
 Identities = 90/109 (83%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K KKFLTVAPFECAWR DL+FREAGRGCVAF+AFAHN VT+VFRE+VGSQH HYKRD
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHNHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LCCSS FQSYWI I D
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCCSSAFQSYWISICD  110



>gb|KDP36794.1| hypothetical protein JCGZ_08085 [Jatropha curcas]
Length=506

 Score =   195 bits (495),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 88/106 (83%), Positives = 97/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHN VT+VFRE+VGSQHYHYKRD+SP
Sbjct  5    KEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTIVFRENVGSQHYHYKRDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            HYTVI+GSHRNRRLKIEVDG+TVVD   + LCCSS FQSYWI +YD
Sbjct  65   HYTVILGSHRNRRLKIEVDGKTVVDAEGIGLCCSSAFQSYWICLYD  110



>ref|XP_010935266.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935267.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
 ref|XP_010935268.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Elaeis 
guineensis]
Length=805

 Score =   198 bits (503),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 87/106 (82%), Positives = 96/106 (91%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA N VT+VFRE VGSQHYHYK D+ P
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +YTVI+GSHRNRRLKIEVDG+T VDVA + LCCSSTFQSYWI IYD
Sbjct  65   NYTVILGSHRNRRLKIEVDGKTAVDVAGIGLCCSSTFQSYWISIYD  110



>ref|XP_004291228.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
 ref|XP_011459073.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Fragaria 
vesca subsp. vesca]
Length=803

 Score =   197 bits (502),  Expect = 1e-55, Method: Composition-based stats.
 Identities = 88/109 (81%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K  KFLTVAPFECAWR+DL+FREAGRGCVAF+AFAHN VT+VFRE+VGSQHYHYK+D
Sbjct  1    MEKKENKFLTVAPFECAWRNDLKFREAGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKKD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            ++PHYTVI+GSHRNRRLKIEVDG+TVVDV  V LC SS FQSYWI I D
Sbjct  61   NTPHYTVILGSHRNRRLKIEVDGKTVVDVEGVGLCSSSAFQSYWISICD  109



>ref|XP_008781287.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Phoenix dactylifera]
Length=803

 Score =   195 bits (496),  Expect = 9e-55, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA N VT+VFRE VGSQHYHYK D+ P
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +YTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSSTFQSYWIGIYD
Sbjct  65   NYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSTFQSYWIGIYD  110



>ref|XP_002510674.1| protein binding protein, putative [Ricinus communis]
 gb|EEF52861.1| protein binding protein, putative [Ricinus communis]
Length=806

 Score =   195 bits (496),  Expect = 9e-55, Method: Composition-based stats.
 Identities = 87/109 (80%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPF+CAWR DL+FREAGRGCVAFDAFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    IEEKEKKFLTVAPFQCAWRKDLKFREAGRGCVAFDAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEV+G+TVVD   + LC S  FQSYWI IYD
Sbjct  62   NSPHYTVILGSHRNRRLKIEVNGKTVVDAEGIGLCSSFAFQSYWICIYD  110



>ref|XP_008781284.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781285.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
 ref|XP_008781286.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Phoenix dactylifera]
Length=805

 Score =   195 bits (496),  Expect = 1e-54, Method: Compositional matrix adjust.
 Identities = 89/106 (84%), Positives = 98/106 (92%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPFECAWR++LRFREAGRGCVAF+AFA N VT+VFRE VGSQHYHYK D+ P
Sbjct  5    KQKKFLTVAPFECAWREELRFREAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNGP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +YTVI+GSHRNRRLKIEVDG+TVVDVA + LCCSSTFQSYWIGIYD
Sbjct  65   NYTVILGSHRNRRLKIEVDGKTVVDVAGIGLCCSSTFQSYWIGIYD  110



>ref|XP_006410166.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
 gb|ESQ51619.1| hypothetical protein EUTSA_v10016264mg [Eutrema salsugineum]
Length=806

 Score =   195 bits (495),  Expect = 1e-54, Method: Composition-based stats.
 Identities = 86/107 (80%), Positives = 97/107 (91%), Gaps = 0/107 (0%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            +K KKFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VGSQHYHYK+D+S
Sbjct  4    LKEKKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNS  63

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            PHY VIIGS+RNRRLKI+VDG++VVD  + DLCCS  F+SYWI IYD
Sbjct  64   PHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCCSLEFESYWISIYD  110



>gb|KEH28127.1| BTB/POZ domain plant protein [Medicago truncatula]
Length=614

 Score =   192 bits (489),  Expect = 3e-54, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA N VT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3    EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYD
Sbjct  63   TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYD  106



>ref|XP_010469825.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Camelina sativa]
Length=818

 Score =   194 bits (492),  Expect = 4e-54, Method: Composition-based stats.
 Identities = 86/115 (75%), Positives = 101/115 (88%), Gaps = 1/115 (1%)
 Frame = +1

Query  205  CEGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHY  384
            C+G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHY
Sbjct  6    CKGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHY  65

Query  385  HYKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HYK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  66   HYKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  120



>ref|XP_010556054.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556055.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
 ref|XP_010556056.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Tarenaya 
hassleriana]
Length=804

 Score =   193 bits (490),  Expect = 6e-54, Method: Composition-based stats.
 Identities = 86/107 (80%), Positives = 95/107 (89%), Gaps = 0/107 (0%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            I+ KKFLTVAPFECAWR+DL+FRE GRGCVAFDAFAHN VTVVFRE+VGS+HYHYK+D+S
Sbjct  4    IQEKKFLTVAPFECAWREDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSRHYHYKKDNS  63

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            PHY VIIGS+RNRRLKI VDGR  VD   + LCCSS FQSYWIGIYD
Sbjct  64   PHYIVIIGSNRNRRLKILVDGRVAVDEEGIGLCCSSGFQSYWIGIYD  110



>emb|CDP07293.1| unnamed protein product [Coffea canephora]
Length=802

 Score =   192 bits (489),  Expect = 8e-54, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 98/109 (90%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            +E K KKFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VT+VFREHVGSQ  HYKRD
Sbjct  2    IEKKQKKFLTVAPFECAWCDDLKFREAGRGCVAFDAFAHNDVTIVFREHVGSQQCHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            ++PHYTVIIGSH+N+RLKIEVDG TVVDVA + LCCSS FQSYWI +YD
Sbjct  62   NNPHYTVIIGSHKNKRLKIEVDGETVVDVAGIGLCCSSAFQSYWISVYD  110



>ref|XP_006596518.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Glycine max]
Length=714

 Score =   191 bits (484),  Expect = 3e-53, Method: Composition-based stats.
 Identities = 83/103 (81%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  238  KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            KFLTV PFECAWR+DL+FREAGRGCVAF+AFA N VT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYD
Sbjct  64   IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYD  106



>ref|XP_003545003.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Glycine max]
 gb|KHN12601.1| BTB/POZ domain-containing protein [Glycine soja]
Length=802

 Score =   191 bits (484),  Expect = 5e-53, Method: Composition-based stats.
 Identities = 83/103 (81%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  238  KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            KFLTV PFECAWR+DL+FREAGRGCVAF+AFA N VT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYD
Sbjct  64   IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYD  106



>ref|XP_010469824.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Camelina sativa]
Length=823

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +1

Query  208  EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYH  387
            +G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYH
Sbjct  12   KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYH  71

Query  388  YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            YK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  72   YKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  125



>ref|XP_010414240.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Camelina 
sativa]
Length=824

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 85/114 (75%), Positives = 100/114 (88%), Gaps = 1/114 (1%)
 Frame = +1

Query  208  EGETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYH  387
            +G+ + +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYH
Sbjct  12   KGKMVAVKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYH  71

Query  388  YKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            YK+D+SPHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  72   YKKDNSPHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  125



>ref|XP_006596517.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Glycine max]
Length=806

 Score =   190 bits (483),  Expect = 6e-53, Method: Composition-based stats.
 Identities = 83/103 (81%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  238  KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            KFLTV PFECAWR+DL+FREAGRGCVAF+AFA N VT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +I+GSHRNRRL+IEV+G+ VVDVA V LCCSS+FQSYWI IYD
Sbjct  64   IILGSHRNRRLRIEVNGKAVVDVAGVGLCCSSSFQSYWISIYD  106



>gb|AES98295.2| BTB/POZ domain plant protein [Medicago truncatula]
Length=799

 Score =   190 bits (483),  Expect = 7e-53, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA N VT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3    EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYD
Sbjct  63   TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYD  106



>ref|XP_008377082.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X3 [Malus domestica]
Length=797

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I D
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICD  110



>ref|XP_008377081.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Malus domestica]
Length=803

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I D
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICD  110



>ref|XP_008377080.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Malus domestica]
Length=805

 Score =   190 bits (482),  Expect = 9e-53, Method: Compositional matrix adjust.
 Identities = 89/109 (82%), Positives = 97/109 (89%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K KKFLTVAPFECAWR DL+FRE+GRGCVAF+AFAHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKKFLTVAPFECAWRKDLKFRESGRGCVAFEAFAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRRLKIEVDG TVVDV  V LC SS FQSYWI I D
Sbjct  62   NSPHYTVILGSHRNRRLKIEVDGNTVVDVEGVGLCSSSAFQSYWISICD  110



>ref|XP_007160598.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 ref|XP_007160599.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32592.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
 gb|ESW32593.1| hypothetical protein PHAVU_001G001100g [Phaseolus vulgaris]
Length=802

 Score =   189 bits (481),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 82/103 (80%), Positives = 94/103 (91%), Gaps = 0/103 (0%)
 Frame = +1

Query  238  KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            KFLTV PFECAWR+DL+FREAGRGCVAF+AFA N VT+VFRE+VGSQ YHYKRD SPHYT
Sbjct  4    KFLTVPPFECAWREDLKFREAGRGCVAFEAFACNDVTLVFRENVGSQGYHYKRDSSPHYT  63

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +I+GSHRNRRL+IEV+G+ VVD+A V LCCSS+FQSYWI IYD
Sbjct  64   IILGSHRNRRLRIEVNGKAVVDIAGVGLCCSSSFQSYWISIYD  106



>gb|AAB63077.1| unknown protein [Arabidopsis thaliana]
Length=586

 Score =   188 bits (477),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYD  111



>ref|XP_003615337.1| Kelch-like protein [Medicago truncatula]
Length=884

 Score =   190 bits (482),  Expect = 1e-52, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            +KFLTV PFECAWR+DL+F+EAGRGCVAFDAFA N VT+VFRE+VGSQ YHYKRD SPHY
Sbjct  88   EKFLTVPPFECAWREDLKFQEAGRGCVAFDAFACNDVTLVFRENVGSQGYHYKRDSSPHY  147

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            TVI+GSHRNRRLKIEV+G TVVDV  V LCCS++FQSYWI IYD
Sbjct  148  TVILGSHRNRRLKIEVNGETVVDVVGVGLCCSNSFQSYWISIYD  191



>gb|EPS65824.1| hypothetical protein M569_08953, partial [Genlisea aurea]
Length=780

 Score =   188 bits (478),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 87/109 (80%), Positives = 95/109 (87%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K K+FLTVAPFECAW DDLRFREAGRGCVAFDAFAHN VT+VFRE+ GSQ YHYKRD
Sbjct  1    MENKHKRFLTVAPFECAWHDDLRFREAGRGCVAFDAFAHNDVTIVFRENAGSQQYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             SPHYTVIIGSHRN+R  I V+G+TVVDV+ +DL CSS FQSYWI IYD
Sbjct  61   SSPHYTVIIGSHRNKRFNILVNGKTVVDVSGIDLYCSSKFQSYWISIYD  109



>ref|NP_180618.2| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_850151.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031447.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 ref|NP_001031448.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 sp|Q8LEV3.1|Y2060_ARATH RecName: Full=BTB/POZ domain-containing protein At2g30600 [Arabidopsis 
thaliana]
 gb|AAM62449.1| unknown [Arabidopsis thaliana]
 dbj|BAD42918.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD43840.1| unknown protein [Arabidopsis thaliana]
 dbj|BAD44307.1| unknown protein [Arabidopsis thaliana]
 gb|AEC08413.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08414.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08415.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08416.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=809

 Score =   188 bits (477),  Expect = 4e-52, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYD  111



>ref|XP_010469826.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469827.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469828.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
 ref|XP_010469829.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Camelina sativa]
Length=809

 Score =   187 bits (476),  Expect = 6e-52, Method: Composition-based stats.
 Identities = 84/108 (78%), Positives = 96/108 (89%), Gaps = 1/108 (1%)
 Frame = +1

Query  226  IKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDS  405
            +K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+S
Sbjct  4    VKENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNS  63

Query  406  PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            PHY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  64   PHYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  111



>ref|NP_001189642.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
 gb|AEC08417.1| BTB/POZ domain-containing protein [Arabidopsis thaliana]
Length=855

 Score =   187 bits (476),  Expect = 7e-52, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYD  111



>ref|XP_004512607.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X1 [Cicer arietinum]
Length=815

 Score =   187 bits (475),  Expect = 8e-52, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            +KFLTVAPFECAWR+DL+FREAGRGCV F+AFA N VT+VFRE+VGSQ YHYKRD SPHY
Sbjct  23   EKFLTVAPFECAWREDLKFREAGRGCVTFEAFACNDVTLVFRENVGSQGYHYKRDSSPHY  82

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            T+I+GSHRNRRL+IEV+G+TVVD A V LC S+TFQSYWI IYD
Sbjct  83   TIILGSHRNRRLRIEVNGKTVVDAAGVGLCGSNTFQSYWISIYD  126



>ref|XP_004512608.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X2 [Cicer arietinum]
 ref|XP_004512609.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X3 [Cicer arietinum]
 ref|XP_004512610.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like isoform 
X4 [Cicer arietinum]
Length=795

 Score =   187 bits (474),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 82/104 (79%), Positives = 94/104 (90%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            +KFLTVAPFECAWR+DL+FREAGRGCV F+AFA N VT+VFRE+VGSQ YHYKRD SPHY
Sbjct  3    EKFLTVAPFECAWREDLKFREAGRGCVTFEAFACNDVTLVFRENVGSQGYHYKRDSSPHY  62

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            T+I+GSHRNRRL+IEV+G+TVVD A V LC S+TFQSYWI IYD
Sbjct  63   TIILGSHRNRRLRIEVNGKTVVDAAGVGLCGSNTFQSYWISIYD  106



>ref|XP_010510327.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
 ref|XP_010510328.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Camelina 
sativa]
Length=809

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  111



>dbj|BAD93995.1| hypothetical protein [Arabidopsis thaliana]
Length=812

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/104 (81%), Positives = 94/104 (90%), Gaps = 1/104 (1%)
 Frame = +1

Query  238  KFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SPHY 
Sbjct  11   KFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSPHYI  70

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            VIIGS+RNRRLKI+VDG++VVD  + DLC CS  FQSYWI IYD
Sbjct  71   VIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFQSYWISIYD  114



>gb|KFK23322.1| hypothetical protein AALP_AAs74635U001200 [Arabis alpina]
Length=807

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KK+LTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+ GSQHYHYK+D+SP
Sbjct  5    KEKKYLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENAGSQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  111



>ref|XP_002879271.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH55530.1| BTB/POZ domain-containing protein [Arabidopsis lyrata subsp. 
lyrata]
Length=809

 Score =   186 bits (473),  Expect = 1e-51, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  111



>ref|XP_006293695.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
 gb|EOA26593.1| hypothetical protein CARUB_v10022653mg [Capsella rubella]
Length=809

 Score =   186 bits (471),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFESYWISIYD  111



>ref|XP_004145539.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 ref|XP_004164111.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Cucumis 
sativus]
 gb|KGN55497.1| hypothetical protein Csa_4G658570 [Cucumis sativus]
Length=806

 Score =   186 bits (471),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/109 (78%), Positives = 92/109 (84%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K K  +TVAPFECAW  DLRFREAGRGCVAF+A AHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             SPHYTVIIGSHRNRRL+I  DGRTVVDV  V LC SS FQSYWI +YD
Sbjct  62   MSPHYTVIIGSHRNRRLRIIADGRTVVDVEGVALCSSSAFQSYWISVYD  110



>ref|XP_009141083.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Brassica rapa]
Length=806

 Score =   186 bits (471),  Expect = 2e-51, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHN VTVVFRE+VGSQHYHYK+D+SP
Sbjct  10   KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  69

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG +VVD  S DLC CS  F+SYWI IYD
Sbjct  70   HYIVIIGSNRNRRLKIQVDGESVVDEESSDLCRCSLEFESYWISIYD  116



>ref|XP_009141084.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
 ref|XP_009141086.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Brassica rapa]
Length=801

 Score =   186 bits (471),  Expect = 3e-51, Method: Composition-based stats.
 Identities = 85/107 (79%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHN VTVVFRE+VGSQHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG +VVD  S DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGESVVDEESSDLCRCSLEFESYWISIYD  111



>ref|XP_010061166.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X2 [Eucalyptus grandis]
 gb|KCW68087.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
 gb|KCW68088.1| hypothetical protein EUGRSUZ_F01772 [Eucalyptus grandis]
Length=802

 Score =   184 bits (467),  Expect = 9e-51, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M  K KKF+ VAPFECAW +DL FREAGRGCVAF+A A N VTVVFRE+VGSQHYHYKRD
Sbjct  1    MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASARNDVTVVFRENVGSQHYHYKRD  60

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRR KIEVDG+T VD   + LC SS FQSYWI IYD
Sbjct  61   NSPHYTVILGSHRNRRFKIEVDGKTAVDEVGMALCSSSAFQSYWISIYD  109



>emb|CDY29657.1| BnaA04g17700D [Brassica napus]
Length=844

 Score =   184 bits (467),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/107 (79%), Positives = 93/107 (87%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHN VTVVFRE+VGSQHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG +VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGESVVDEEASDLCRCSLEFESYWISIYD  111



>ref|XP_010061165.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 isoform 
X1 [Eucalyptus grandis]
Length=853

 Score =   184 bits (467),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 83/109 (76%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M  K KKF+ VAPFECAW +DL FREAGRGCVAF+A A N VTVVFRE+VGSQHYHYKRD
Sbjct  52   MAEKEKKFVRVAPFECAWSEDLMFREAGRGCVAFEASARNDVTVVFRENVGSQHYHYKRD  111

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +SPHYTVI+GSHRNRR KIEVDG+T VD   + LC SS FQSYWI IYD
Sbjct  112  NSPHYTVILGSHRNRRFKIEVDGKTAVDEVGMALCSSSAFQSYWISIYD  160



>ref|XP_008452951.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452952.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
 ref|XP_008452953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Cucumis 
melo]
Length=806

 Score =   184 bits (466),  Expect = 1e-50, Method: Composition-based stats.
 Identities = 84/109 (77%), Positives = 91/109 (83%), Gaps = 0/109 (0%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            M+ K K  +TVAPFECAW  DLRFREAGRGCVAF+A AHN VT+VFRE+VGSQHYHYKRD
Sbjct  2    MDKKEKNSITVAPFECAWLKDLRFREAGRGCVAFEASAHNDVTLVFRENVGSQHYHYKRD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             SPHYTVIIGSHRNRRL+I  DGRTVVD   V LC SS FQSYWI +YD
Sbjct  62   MSPHYTVIIGSHRNRRLRIIADGRTVVDEEGVALCSSSAFQSYWISVYD  110



>dbj|BAH56763.1| AT2G30600 [Arabidopsis thaliana]
Length=481

 Score =   180 bits (456),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 84/107 (79%), Positives = 95/107 (89%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FREAGRGCVAFDAFAHN VTVVFRE+VG+QHYHYK+D+SP
Sbjct  5    KENKFLTVAPFECAWSDDLKFREAGRGCVAFDAFAHNDVTVVFRENVGTQHYHYKKDNSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG++VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGKSVVDEEASDLCRCSLEFRSYWISIYD  111



>ref|XP_009418296.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418297.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418298.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418299.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418300.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
 ref|XP_009418301.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Musa 
acuminata subsp. malaccensis]
Length=803

 Score =   180 bits (456),  Expect = 3e-49, Method: Composition-based stats.
 Identities = 81/106 (76%), Positives = 92/106 (87%), Gaps = 1/106 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPF+C WR++LRF+EAGRGCVAF+AFA N VT+VFRE VGSQHYHYK D++P
Sbjct  5    KQKKFLTVAPFKCVWREELRFKEAGRGCVAFEAFAQNDVTLVFREQVGSQHYHYKMDNNP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +YT+I GSHRNRRLKIE  G+TVVDVA V L CSS FQSYWI IYD
Sbjct  65   NYTIIFGSHRNRRLKIEASGKTVVDVAGVGL-CSSAFQSYWISIYD  109



>gb|EEC79014.1| hypothetical protein OsI_19541 [Oryza sativa Indica Group]
Length=806

 Score =   178 bits (452),  Expect = 1e-48, Method: Composition-based stats.
 Identities = 77/104 (74%), Positives = 90/104 (87%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ +TVAPFECAW ++ RFREAGRGC+ F+A AHN VT+VFRE  GSQHYHYK D+S HY
Sbjct  7    KRSITVAPFECAWDEEFRFREAGRGCITFEASAHNDVTLVFREQPGSQHYHYKMDNSRHY  66

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             VI+GSHRN+RLKIEVDG+TVVDVA + LCCSS+FQSYWI IYD
Sbjct  67   IVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSSFQSYWISIYD  110



>gb|AAV43802.1| unknown protein [Oryza sativa Japonica Group]
Length=806

 Score =   177 bits (448),  Expect = 4e-48, Method: Composition-based stats.
 Identities = 76/104 (73%), Positives = 89/104 (86%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ +TVAPFECAW ++ RFRE GRGC+ F+A AHN VT+VFRE  GSQHYHYK D+S HY
Sbjct  7    KRSITVAPFECAWDEEFRFRETGRGCITFEASAHNDVTLVFREQPGSQHYHYKMDNSRHY  66

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             VI+GSHRN+RLKIEVDG+TVVDVA + LCCSS+FQSYWI IYD
Sbjct  67   IVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSSFQSYWISIYD  110



>emb|CDX97805.1| BnaC04g41340D [Brassica napus]
Length=796

 Score =   176 bits (447),  Expect = 5e-48, Method: Compositional matrix adjust.
 Identities = 83/107 (78%), Positives = 92/107 (86%), Gaps = 1/107 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K  KFLTVAPFECAW DDL+FRE GRGCVAFDAFAHN VTVVFRE+VGSQHYHYK+D+ P
Sbjct  5    KENKFLTVAPFECAWSDDLKFREPGRGCVAFDAFAHNDVTVVFRENVGSQHYHYKKDNCP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLC-CSSTFQSYWIGIYD  546
            HY VIIGS+RNRRLKI+VDG +VVD  + DLC CS  F+SYWI IYD
Sbjct  65   HYIVIIGSNRNRRLKIQVDGASVVDEEASDLCRCSLEFESYWISIYD  111



>ref|XP_010692549.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
 ref|XP_010692550.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Beta 
vulgaris subsp. vulgaris]
Length=805

 Score =   176 bits (446),  Expect = 7e-48, Method: Compositional matrix adjust.
 Identities = 79/106 (75%), Positives = 91/106 (86%), Gaps = 0/106 (0%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K +KFLTVAPFECAW+ + +F+EAGRGCV F+AFA N VTVVFREHVGSQ+YHYK D SP
Sbjct  5    KQQKFLTVAPFECAWQKEFKFKEAGRGCVVFEAFARNDVTVVFREHVGSQYYHYKTDSSP  64

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            HYTV++GSHRNRRLKIEVDG+ VVDV  + LC S+ FQSYWI IYD
Sbjct  65   HYTVVLGSHRNRRLKIEVDGKAVVDVEGIGLCSSAAFQSYWISIYD  110



>ref|XP_006664953.1| PREDICTED: BTB/POZ domain-containing protein At2g30600-like [Oryza 
brachyantha]
Length=805

 Score =   174 bits (440),  Expect = 6e-47, Method: Composition-based stats.
 Identities = 78/109 (72%), Positives = 91/109 (83%), Gaps = 1/109 (1%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRD  399
            ME K K+ +TVAPFECAW +  +FREAGRGC+ F+A A N +T+VFRE  GSQHYHYK D
Sbjct  3    MEEK-KRSITVAPFECAWDEGFQFREAGRGCITFEASAQNDITLVFREQPGSQHYHYKMD  61

Query  400  DSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +S HYTVI+GSHRN+RLKIEVDG+TVVDVA + LCCSS FQSYWI IYD
Sbjct  62   NSRHYTVILGSHRNKRLKIEVDGKTVVDVAGIGLCCSSCFQSYWISIYD  110



>ref|XP_003561246.1| PREDICTED: BTB/POZ domain-containing protein At2g30600 [Brachypodium 
distachyon]
Length=812

 Score =   171 bits (432),  Expect = 8e-46, Method: Composition-based stats.
 Identities = 78/104 (75%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ LTVAPFECAW +  RF EAGRGCVAF+A A N VT+VFRE +GSQHYHYK D + HY
Sbjct  10   KRSLTVAPFECAWDEQFRFTEAGRGCVAFEASAQNDVTLVFREQLGSQHYHYKMDTTRHY  69

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            TVI+GSHRN+RLKIEVDGRTVVD A V LC SS FQSYWI IYD
Sbjct  70   TVILGSHRNKRLKIEVDGRTVVDQAGVGLCRSSAFQSYWISIYD  113



>ref|XP_002437659.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
 gb|EER89026.1| hypothetical protein SORBIDRAFT_10g000240 [Sorghum bicolor]
Length=807

 Score =   169 bits (428),  Expect = 2e-45, Method: Composition-based stats.
 Identities = 76/104 (73%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ LTVAPFECAW ++LRF E GRGC+AF+A A N VT+VFR  +GSQHYHYK D S HY
Sbjct  8    KRSLTVAPFECAWAEELRFGEPGRGCIAFEASAQNDVTLVFRHLLGSQHYHYKTDTSRHY  67

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            TVI+GSHRN+RLKIEVDG T VDV +V LCCSS+FQSYWI IYD
Sbjct  68   TVILGSHRNKRLKIEVDGITAVDVTAVGLCCSSSFQSYWISIYD  111



>dbj|BAK07994.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=487

 Score =   166 bits (420),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 77/104 (74%), Positives = 87/104 (84%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ LTVAPFECAW ++ RF EAGRGC+AF+A A N VT+VFRE +GSQHYHYK D S HY
Sbjct  7    KRSLTVAPFECAWGEEFRFVEAGRGCIAFEASAQNDVTLVFREQLGSQHYHYKMDSSRHY  66

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             VI+GSHRN+RLKIEVDGRTVVD A V LC SS+FQSYWI IYD
Sbjct  67   AVILGSHRNKRLKIEVDGRTVVDEAGVGLCRSSSFQSYWISIYD  110



>emb|CDM85346.1| unnamed protein product [Triticum aestivum]
Length=805

 Score =   168 bits (425),  Expect = 7e-45, Method: Composition-based stats.
 Identities = 76/104 (73%), Positives = 86/104 (83%), Gaps = 0/104 (0%)
 Frame = +1

Query  235  KKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHY  414
            K+ LTVAPF+CAW ++ RF EAGRGC+AF+A A N VT+VFRE  GSQHYHYK D S HY
Sbjct  7    KRSLTVAPFKCAWGEEFRFVEAGRGCIAFEASAQNDVTLVFREQPGSQHYHYKMDSSRHY  66

Query  415  TVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             VI+GSHRN+RLKIEVDGRTVVD A V LC SS+FQSYWI IYD
Sbjct  67   AVILGSHRNKRLKIEVDGRTVVDEAGVGLCRSSSFQSYWISIYD  110



>ref|XP_006828729.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
 gb|ERM96145.1| hypothetical protein AMTR_s00001p00041750 [Amborella trichopoda]
Length=827

 Score =   167 bits (423),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 77/106 (73%), Positives = 90/106 (85%), Gaps = 1/106 (1%)
 Frame = +1

Query  229  KPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSP  408
            K KKFLTVAPFEC W  + RFR+AGRGCV F+AFA N +TVVFREH G+Q+YHYK D++P
Sbjct  28   KQKKFLTVAPFECVWLME-RFRDAGRGCVTFEAFARNDITVVFREHAGTQNYHYKTDNTP  86

Query  409  HYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            HYTVI+GSHRNRRLKIEVDG++VVDVA + LCC+S FQSYWI   D
Sbjct  87   HYTVILGSHRNRRLKIEVDGKSVVDVAGIGLCCTSGFQSYWISFCD  132



>ref|XP_004964253.1| PREDICTED: LOW QUALITY PROTEIN: BTB/POZ domain-containing protein 
At2g30600-like [Setaria italica]
Length=862

 Score =   165 bits (418),  Expect = 1e-43, Method: Composition-based stats.
 Identities = 74/111 (67%), Positives = 90/111 (81%), Gaps = 0/111 (0%)
 Frame = +1

Query  214  ETMEIKPKKFLTVAPFECAWRDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYK  393
            E +E   K+ LTVAPFECAW ++LRFRE GRGCV+F+A AHN VT+VFR H GS HYHYK
Sbjct  2    EFVEETKKRSLTVAPFECAWGEELRFREPGRGCVSFEASAHNDVTLVFRHHPGSHHYHYK  61

Query  394  RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
             D S HYTVI+GSHRN+RL+I+VDG TV DVA+  LCCS++FQ++WI I D
Sbjct  62   MDTSRHYTVILGSHRNKRLRIQVDGATVADVAAPGLCCSNSFQAFWITICD  112



>gb|EEE63337.1| hypothetical protein OsJ_18148 [Oryza sativa Japonica Group]
Length=734

 Score =   133 bits (334),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 59/81 (73%), Positives = 69/81 (85%), Gaps = 1/81 (1%)
 Frame = +1

Query  307  GCVAFDAFAHNYVTVVFREH-VGSQHYHYKRDDSPHYTVIIGSHRNRRLKIEVDGRTVVD  483
            GC+ F+A AHN VT+VFR   +GSQHYHYK D+S HY VI+GSHRN+RLKIEVDG+TVVD
Sbjct  12   GCITFEASAHNDVTLVFRRTTLGSQHYHYKMDNSRHYIVILGSHRNKRLKIEVDGKTVVD  71

Query  484  VASVDLCCSSTFQSYWIGIYD  546
            VA + LCCSS+FQSYWI IYD
Sbjct  72   VAGIGLCCSSSFQSYWISIYD  92



>ref|XP_001751401.1| predicted protein [Physcomitrella patens]
 gb|EDQ83718.1| predicted protein, partial [Physcomitrella patens]
Length=784

 Score =   120 bits (301),  Expect = 7e-28, Method: Composition-based stats.
 Identities = 59/103 (57%), Positives = 74/103 (72%), Gaps = 5/103 (5%)
 Frame = +1

Query  244  LTVAPFECAWR--DDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYKRDDSPHYT  417
            L V PF+CAW   D+  F   GRGCVAF+A A N VT+VF+EH G +HY  + D  P+YT
Sbjct  1    LVVPPFDCAWLMGDEQSFLTPGRGCVAFEARAANDVTIVFKEHPGCKHY--RTDLGPNYT  58

Query  418  VIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGIYD  546
            +I+GSH NRRLK+ VDG+TVVDVA + L C STF+ YWI + D
Sbjct  59   IILGSHGNRRLKMLVDGKTVVDVADIVL-CPSTFERYWISVLD  100



>ref|XP_002965955.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
 gb|EFJ33375.1| hypothetical protein SELMODRAFT_84039 [Selaginella moellendorffii]
Length=772

 Score =   113 bits (282),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAW--RDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYK  393
            M++     L V PF+CAW   ++LRF EAGRGCVAF+A A N VTV+F+E  G +HY  +
Sbjct  2    MKLVENNVLVVPPFDCAWLFEEELRFPEAGRGCVAFEARAENDVTVIFKELAGCKHY--R  59

Query  394  RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGI  540
             D  P+YTVIIGS+ N+RLKI  +GRTVVDVA   +     F+ YWI +
Sbjct  60   TDSDPNYTVIIGSNLNKRLKIAANGRTVVDVAG-PVVSPLVFERYWISV  107



>ref|XP_002962812.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
 gb|EFJ36275.1| hypothetical protein SELMODRAFT_438140 [Selaginella moellendorffii]
Length=792

 Score =   112 bits (281),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 57/109 (52%), Positives = 74/109 (68%), Gaps = 5/109 (5%)
 Frame = +1

Query  220  MEIKPKKFLTVAPFECAW--RDDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHYK  393
            M++     L V PF+CAW   ++LRF EAGRGCVAF+A A N VTV+F+E  G +HY  +
Sbjct  1    MKLVENNVLVVPPFDCAWLFEEELRFPEAGRGCVAFEARAENDVTVIFKELAGCKHY--R  58

Query  394  RDDSPHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSSTFQSYWIGI  540
             D  P+YTVIIGS+ N+RLKI  +GRTVVDVA   +     F+ YWI +
Sbjct  59   TDSDPNYTVIIGSNLNKRLKIAANGRTVVDVAG-PVVSPLVFERYWISV  106



>gb|KDD75170.1| hypothetical protein H632_c829p0, partial [Helicosporidium sp. 
ATCC 50920]
Length=285

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 54/111 (49%), Gaps = 30/111 (27%)
 Frame = +1

Query  241  FLTVAPFECAWRDDLRF---REAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY----KRD  399
             + V PFECAW  D  F   RE  RGC+ F+    N  T++ +   GS+ + +     R 
Sbjct  7    LVIVPPFECAWLQDPEFVFKRE--RGCLTFEVKGENDATILLKPQPGSRRWQHLSAVPRA  64

Query  400  DS------------PHYTVIIGSHRNRRLKIEVDGRTVVDVASVDLCCSST  516
            ++             +YT+I+GSHRN  LKIE +G         +LCC +T
Sbjct  65   EAGLHADAVGGVVESNYTIILGSHRNSCLKIEKNG---------ELCCMAT  106



>ref|XP_005845262.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
 gb|EFN53160.1| hypothetical protein CHLNCDRAFT_58586 [Chlorella variabilis]
Length=669

 Score = 55.5 bits (132),  Expect = 5e-06, Method: Composition-based stats.
 Identities = 38/120 (32%), Positives = 57/120 (48%), Gaps = 24/120 (20%)
 Frame = +1

Query  244  LTVAPFECAWR--DDLRFREAGRGCVAFDAFAHNYVTVVFREHVGSQHYHY---------  390
            L VAP E  W    +L+ ++ GRGC++F+       TV+ ++  GS+ + +         
Sbjct  15   LVVAPMEAVWLTGSELQLQD-GRGCLSFEVKGDTDATVLLKQQSGSRRWQHLALGAAAAA  73

Query  391  -------KRDDSP---HYTVIIGSHRNRRLKIEVDGR--TVVDVASVDLCCSSTFQSYWI  534
                       SP   +YT+I+GSHRN  LK E DG    +V  A      SS+F  YW+
Sbjct  74   AANGQPAAGRGSPVEQNYTIILGSHRNSCLKFEKDGELCCMVPTAPEAKLSSSSFSKYWL  133



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 592801777335