BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A08

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011069394.1|  PREDICTED: proteasome subunit beta type-3-A        313   2e-105   Sesamum indicum [beniseed]
emb|CDP10945.1|  unnamed protein product                                313   2e-105   Coffea canephora [robusta coffee]
gb|KCW71243.1|  hypothetical protein EUGRSUZ_F04339                     313   2e-104   Eucalyptus grandis [rose gum]
ref|XP_010063943.1|  PREDICTED: proteasome subunit beta type-3-A        311   2e-104   Eucalyptus grandis [rose gum]
ref|XP_010243518.1|  PREDICTED: proteasome subunit beta type-3          310   3e-104   Nelumbo nucifera [Indian lotus]
ref|XP_009616684.1|  PREDICTED: proteasome subunit beta type-3-A        310   6e-104   Nicotiana tomentosiformis
ref|XP_009798221.1|  PREDICTED: proteasome subunit beta type-3-A        309   1e-103   Nicotiana sylvestris
ref|XP_010527680.1|  PREDICTED: proteasome subunit beta type-3-A-...    309   1e-103   Tarenaya hassleriana [spider flower]
ref|XP_010539660.1|  PREDICTED: proteasome subunit beta type-3-A-...    309   1e-103   Tarenaya hassleriana [spider flower]
gb|KDP32966.1|  hypothetical protein JCGZ_12997                         308   1e-103   Jatropha curcas
ref|XP_002285871.1|  PREDICTED: proteasome subunit beta type-3-A        308   2e-103   Vitis vinifera
gb|KDP32836.1|  hypothetical protein JCGZ_12128                         308   2e-103   Jatropha curcas
ref|XP_009769699.1|  PREDICTED: proteasome subunit beta type-3-A-...    308   2e-103   Nicotiana sylvestris
gb|ADR70868.1|  20S proteasome beta subunit C2                          308   2e-103   Hevea brasiliensis [jebe]
ref|XP_004149805.1|  PREDICTED: proteasome subunit beta type-3-A-...    308   3e-103   Cucumis sativus [cucumbers]
gb|KCW71242.1|  hypothetical protein EUGRSUZ_F04339                     310   3e-103   Eucalyptus grandis [rose gum]
ref|XP_010521275.1|  PREDICTED: proteasome subunit beta type-3-A ...    307   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_010539661.1|  PREDICTED: proteasome subunit beta type-3-A-...    307   5e-103   Tarenaya hassleriana [spider flower]
ref|XP_009601797.1|  PREDICTED: proteasome subunit beta type-3-A-...    306   6e-103   Nicotiana tomentosiformis
gb|KJB29135.1|  hypothetical protein B456_005G088700                    306   7e-103   Gossypium raimondii
gb|AFK48891.1|  unknown                                                 307   7e-103   Lotus japonicus
ref|XP_002520338.1|  proteasome subunit beta type, putative             306   8e-103   Ricinus communis
ref|XP_010268988.1|  PREDICTED: proteasome subunit beta type-3-like     306   9e-103   Nelumbo nucifera [Indian lotus]
emb|CAC43324.1|  putative beta 3 proteasome subunit                     305   9e-103   Nicotiana tabacum [American tobacco]
gb|KJB29134.1|  hypothetical protein B456_005G088700                    305   1e-102   Gossypium raimondii
gb|KJB64503.1|  hypothetical protein B456_010G052100                    306   1e-102   Gossypium raimondii
gb|KJB29133.1|  hypothetical protein B456_005G088700                    306   1e-102   Gossypium raimondii
gb|KJB29136.1|  hypothetical protein B456_005G088700                    307   1e-102   Gossypium raimondii
ref|NP_001237278.1|  uncharacterized protein LOC100306084               306   2e-102   Glycine max [soybeans]
ref|XP_007019135.1|  Proteasome beta subunit C1                         306   2e-102   Theobroma cacao [chocolate]
ref|XP_010521276.1|  PREDICTED: proteasome subunit beta type-3-A ...    306   2e-102   Tarenaya hassleriana [spider flower]
ref|XP_004493306.1|  PREDICTED: proteasome subunit beta type-3-A-...    306   2e-102   Cicer arietinum [garbanzo]
ref|NP_564149.1|  proteasome beta subunit C1                            306   2e-102   Arabidopsis thaliana [mouse-ear cress]
gb|AFK33992.1|  unknown                                                 305   2e-102   Lotus japonicus
ref|XP_010428822.1|  PREDICTED: proteasome subunit beta type-3-B        305   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_006302830.1|  hypothetical protein CARUB_v10020962mg             305   3e-102   Capsella rubella
ref|XP_010416685.1|  PREDICTED: proteasome subunit beta type-3-B-...    305   3e-102   Camelina sativa [gold-of-pleasure]
ref|XP_008352621.1|  PREDICTED: proteasome subunit beta type-3-A        305   3e-102   
ref|XP_006838497.1|  hypothetical protein AMTR_s00002p00168080          305   4e-102   Amborella trichopoda
gb|ADR70867.1|  20S proteasome beta subunit C1                          305   4e-102   Hevea brasiliensis [jebe]
gb|KHG23898.1|  Proteasome subunit beta type-3-A -like protein          305   5e-102   Gossypium arboreum [tree cotton]
ref|XP_007223461.1|  hypothetical protein PRUPE_ppa011601mg             305   5e-102   Prunus persica
ref|XP_006595528.1|  PREDICTED: uncharacterized protein LOC100527...    305   6e-102   
gb|KJB59983.1|  hypothetical protein B456_009G283900                    305   6e-102   Gossypium raimondii
ref|XP_010670575.1|  PREDICTED: proteasome subunit beta type-3-A        304   7e-102   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_006416271.1|  hypothetical protein EUTSA_v10008793mg             304   8e-102   Eutrema salsugineum [saltwater cress]
ref|XP_002890456.1|  predicted protein                                  304   9e-102   
ref|XP_009149692.1|  PREDICTED: proteasome subunit beta type-3-A        304   9e-102   Brassica rapa
gb|AFK33863.1|  unknown                                                 304   1e-101   Medicago truncatula
emb|CDY00398.1|  BnaC07g14280D                                          304   1e-101   
ref|NP_565156.1|  20S proteasome beta subunit C2                        304   1e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003624868.1|  Proteasome subunit beta type                       304   1e-101   Medicago truncatula
ref|XP_009128227.1|  PREDICTED: proteasome subunit beta type-3-A        303   1e-101   Brassica rapa
ref|XP_008219606.1|  PREDICTED: proteasome subunit beta type-3-A        303   1e-101   Prunus mume [ume]
ref|XP_010471938.1|  PREDICTED: proteasome subunit beta type-3-B ...    303   1e-101   Camelina sativa [gold-of-pleasure]
ref|NP_001237990.1|  uncharacterized protein LOC100499664               303   1e-101   Glycine max [soybeans]
ref|XP_010416686.1|  PREDICTED: proteasome subunit beta type-3-B-...    303   2e-101   Camelina sativa [gold-of-pleasure]
ref|XP_008338662.1|  PREDICTED: proteasome subunit beta type-3-A        303   2e-101   
emb|CDY01316.1|  BnaA07g10890D                                          303   2e-101   
gb|EYU31766.1|  hypothetical protein MIMGU_mgv1a013986mg                303   2e-101   Erythranthe guttata [common monkey flower]
ref|XP_006434244.1|  hypothetical protein CICLE_v10002515mg             303   3e-101   Citrus clementina [clementine]
gb|AFK44934.1|  unknown                                                 303   3e-101   Medicago truncatula
ref|XP_002887683.1|  hypothetical protein ARALYDRAFT_895633             303   3e-101   Arabidopsis lyrata subsp. lyrata
gb|AAM62756.1|  putative 20S proteasome beta subunit PBC2               302   4e-101   Arabidopsis thaliana [mouse-ear cress]
ref|XP_002307450.1|  Proteasome subunit beta type 3-2 family protein    302   4e-101   Populus trichocarpa [western balsam poplar]
ref|XP_009376873.1|  PREDICTED: proteasome subunit beta type-3-A        302   4e-101   Pyrus x bretschneideri [bai li]
ref|XP_006390090.1|  hypothetical protein EUTSA_v10019145mg             302   4e-101   Eutrema salsugineum [saltwater cress]
ref|XP_006304134.1|  hypothetical protein CARUB_v10010099mg             304   5e-101   
ref|XP_009112575.1|  PREDICTED: proteasome subunit beta type-3-A-...    302   5e-101   Brassica rapa
ref|XP_006434245.1|  hypothetical protein CICLE_v10002515mg             301   5e-101   
ref|XP_009110172.1|  PREDICTED: proteasome subunit beta type-3-A-...    302   6e-101   Brassica rapa
gb|KFK44279.1|  hypothetical protein AALP_AA1G237600                    300   2e-100   Arabis alpina [alpine rockcress]
gb|KFK42138.1|  hypothetical protein AALP_AA2G216100                    300   2e-100   Arabis alpina [alpine rockcress]
sp|O65084.1|PSB3_PICMA  RecName: Full=Proteasome subunit beta typ...    300   2e-100   Picea mariana [black spruce]
gb|ACJ85972.1|  unknown                                                 300   4e-100   Medicago truncatula
gb|KHG25919.1|  Proteasome subunit beta type-3-A -like protein          302   4e-100   Gossypium arboreum [tree cotton]
gb|EPS70809.1|  proteasome subunit beta type                            300   5e-100   Genlisea aurea
dbj|BAJ98022.1|  predicted protein                                      300   5e-100   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_006359316.1|  PREDICTED: proteasome subunit beta type-3-A-...    299   6e-100   Solanum tuberosum [potatoes]
ref|XP_007161473.1|  hypothetical protein PHAVU_001G072000g             299   6e-100   Phaseolus vulgaris [French bean]
ref|XP_009379033.1|  PREDICTED: proteasome subunit beta type-3-A-...    299   7e-100   Pyrus x bretschneideri [bai li]
ref|XP_009103286.1|  PREDICTED: proteasome subunit beta type-3-A-...    299   7e-100   Brassica rapa
ref|XP_004236827.1|  PREDICTED: proteasome subunit beta type-3-A        299   7e-100   Solanum lycopersicum
gb|EMT19931.1|  Proteasome subunit beta type-3                          299   7e-100   
ref|XP_003570772.1|  PREDICTED: proteasome subunit beta type-3-like     299   9e-100   Brachypodium distachyon [annual false brome]
ref|XP_002438734.1|  hypothetical protein SORBIDRAFT_10g025190          299   1e-99    Sorghum bicolor [broomcorn]
ref|XP_003563301.1|  PREDICTED: proteasome subunit beta type-3          299   1e-99    Brachypodium distachyon [annual false brome]
ref|XP_002453412.1|  hypothetical protein SORBIDRAFT_04g005590          298   2e-99    Sorghum bicolor [broomcorn]
ref|XP_002300970.2|  Proteasome subunit beta type 3-2 family protein    298   2e-99    
ref|XP_008649041.1|  PREDICTED: proteasome subunit beta type-3          298   2e-99    Zea mays [maize]
ref|XP_010929114.1|  PREDICTED: proteasome subunit beta type-3          297   4e-99    Elaeis guineensis
gb|ABK95590.1|  unknown                                                 297   4e-99    Populus trichocarpa [western balsam poplar]
ref|XP_008347744.1|  PREDICTED: proteasome subunit beta type-3-A-...    297   5e-99    Malus domestica [apple tree]
ref|XP_010942147.1|  PREDICTED: proteasome subunit beta type-3          297   6e-99    Elaeis guineensis
ref|XP_008806302.1|  PREDICTED: proteasome subunit beta type-3          296   7e-99    Phoenix dactylifera
dbj|BAJ87014.1|  predicted protein                                      296   7e-99    Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_009417439.1|  PREDICTED: proteasome subunit beta type-3          296   1e-98    Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAD25149.1|  Proteasome subunit beta type 3                         296   1e-98    Oryza sativa Japonica Group [Japonica rice]
ref|XP_008784796.1|  PREDICTED: proteasome subunit beta type-3          296   2e-98    Phoenix dactylifera
gb|AFW87307.1|  proteasome subunit beta type                            296   2e-98    
ref|NP_001058176.1|  Os06g0643100                                       295   2e-98    
ref|XP_009394944.1|  PREDICTED: proteasome subunit beta type-3-like     295   2e-98    Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001140276.1|  uncharacterized protein LOC100272320               295   2e-98    Zea mays [maize]
ref|XP_003608106.1|  Proteasome subunit beta type                       295   2e-98    Medicago truncatula
gb|EMS62704.1|  Proteasome subunit beta type-3                          295   3e-98    Triticum urartu
ref|XP_010095417.1|  Proteasome subunit beta type-3-A                   311   3e-98    
ref|XP_006648378.1|  PREDICTED: proteasome subunit beta type-3-like     295   3e-98    Oryza brachyantha
ref|NP_001141963.1|  uncharacterized protein LOC100274112               295   5e-98    Zea mays [maize]
ref|XP_004290891.1|  PREDICTED: proteasome subunit beta type-3-A        295   5e-98    Fragaria vesca subsp. vesca
ref|XP_004951671.1|  PREDICTED: proteasome subunit beta type-3-like     295   5e-98    Setaria italica
gb|AFW70451.1|  proteasome subunit beta type                            298   6e-98    
gb|EAY84744.1|  hypothetical protein OsI_06114                          293   3e-97    Oryza sativa Indica Group [Indian rice]
ref|XP_004965763.1|  PREDICTED: proteasome subunit beta type-3-like     290   2e-96    Setaria italica
gb|KJB64504.1|  hypothetical protein B456_010G052100                    280   1e-92    Gossypium raimondii
emb|CDY38347.1|  BnaA02g18400D                                          280   2e-92    Brassica napus [oilseed rape]
gb|AAG51672.1|AC010704_16  putative 20S proteasome beta subunit P...    279   4e-92    Arabidopsis thaliana [mouse-ear cress]
gb|KJB59985.1|  hypothetical protein B456_009G283900                    279   4e-92    Gossypium raimondii
emb|CDY67773.1|  BnaAnng25130D                                          277   2e-91    Brassica napus [oilseed rape]
ref|XP_011027490.1|  PREDICTED: proteasome subunit beta type-3-A        277   2e-91    Populus euphratica
emb|CDY71260.1|  BnaAnng36740D                                          276   8e-91    Brassica napus [oilseed rape]
gb|AEC11048.1|  20S proteasome beta subunit pbc2                        275   1e-90    Camellia sinensis [black tea]
ref|XP_001770816.1|  predicted protein                                  275   2e-90    
gb|AGV54396.1|  proteasome subunit beta type-3-A isoform 1              274   7e-90    Phaseolus vulgaris [French bean]
gb|EMT12457.1|  Proteasome subunit beta type-3                          271   2e-89    
gb|EMS47536.1|  Proteasome subunit beta type-3                          271   3e-89    Triticum urartu
ref|XP_006656285.1|  PREDICTED: proteasome subunit beta type-3-like     270   9e-89    
ref|XP_001771449.1|  predicted protein                                  270   2e-88    
ref|XP_002965476.1|  hypothetical protein SELMODRAFT_266913             268   1e-87    Selaginella moellendorffii
ref|XP_008219607.1|  PREDICTED: proteasome subunit beta type-3-A-...    249   4e-81    
gb|KDO80554.1|  hypothetical protein CISIN_1g028737mg                   251   4e-81    Citrus sinensis [apfelsine]
gb|KDO80557.1|  hypothetical protein CISIN_1g028737mg                   248   2e-80    Citrus sinensis [apfelsine]
ref|XP_005850127.1|  hypothetical protein CHLNCDRAFT_48590              237   2e-75    Chlorella variabilis
ref|XP_005646581.1|  N-terminal nucleophile aminohydrolase              234   3e-74    Coccomyxa subellipsoidea C-169
ref|XP_011401184.1|  Proteasome subunit beta type-3                     231   4e-73    Auxenochlorella protothecoides
gb|KIY94892.1|  hypothetical protein MNEG_13071                         230   9e-73    Monoraphidium neglectum
ref|XP_001696254.1|  hypothetical protein CHLREDRAFT_187099             219   1e-68    Chlamydomonas reinhardtii
ref|XP_002946290.1|  hypothetical protein VOLCADRAFT_78969              218   3e-68    Volvox carteri f. nagariensis
gb|EJK68962.1|  hypothetical protein THAOC_09830                        218   4e-68    Thalassiosira oceanica
ref|XP_002679261.1|  predicted protein                                  217   2e-67    Naegleria gruberi strain NEG-M
emb|CEI98111.1|  Putative Proteasome subunit beta type                  214   6e-67    Rhizopus microsporus
emb|CEG65349.1|  Putative Proteasome subunit beta type                  215   1e-66    Rhizopus microsporus
gb|EWM23143.1|  Proteasome, beta-type subunit, conserved site           214   1e-65    Nannochloropsis gaditana
gb|KFB35883.1|  hypothetical protein ZHAS_00002836                      209   2e-64    Anopheles sinensis
dbj|GAN06988.1|  20S proteasome subunit beta 3                          209   2e-64    Mucor ambiguus
ref|XP_002297096.1|  predicted protein                                  209   2e-64    Thalassiosira pseudonana CCMP1335
ref|XP_008877157.1|  hypothetical protein, variant                      208   2e-64    Aphanomyces invadans
ref|XP_008877158.1|  hypothetical protein H310_12029                    209   2e-64    Aphanomyces invadans
ref|XP_002904370.1|  proteasome subunit beta type-3, putative           208   3e-64    Phytophthora infestans T30-4
emb|CEP10278.1|  hypothetical protein                                   208   4e-64    Parasitella parasitica
ref|XP_321394.2|  AGAP001697-PA                                         208   4e-64    Anopheles gambiae str. PEST
ref|XP_001635037.1|  predicted protein                                  208   5e-64    Nematostella vectensis
gb|AAT09074.1|  proteasome beta subunit                                 207   5e-64    Bigelowiella natans
ref|XP_009536762.1|  hypothetical protein PHYSODRAFT_288866             207   6e-64    Phytophthora sojae
gb|KDD73458.1|  proteasome subunit protein                              207   6e-64    Helicosporidium sp. ATCC 50920
ref|XP_001651824.1|  AAEL006174-PA                                      207   1e-63    Aedes aegypti
gb|ETN62797.1|  proteasome subunit beta type                            207   1e-63    Anopheles darlingi [American malaria mosquito]
gb|ABF18140.1|  20S proteasome regulatory subunit beta type PSMB3...    207   1e-63    Aedes aegypti
emb|CCA14375.1|  proteasome subunit beta type3 putative                 206   2e-63    Albugo laibachii Nc14
emb|CDH60663.1|  20s proteasome subunit beta 3                          205   8e-63    Lichtheimia corymbifera JMRC:FSU:9682
ref|XP_002732675.1|  PREDICTED: proteasome subunit beta type-3-li...    205   8e-63    Saccoglossus kowalevskii
ref|XP_001843139.1|  proteasome subunit beta type 3                     204   1e-62    Culex quinquefasciatus
emb|CBJ32446.1|  conserved unknown protein                              204   1e-62    Ectocarpus siliculosus
ref|XP_006679179.1|  hypothetical protein BATDEDRAFT_88542              204   1e-62    Batrachochytrium dendrobatidis JAM81
ref|XP_004998595.1|  proteasome subunit beta type-3                     204   2e-62    Salpingoeca rosetta
gb|KDQ16840.1|  hypothetical protein BOTBODRAFT_53901                   203   3e-62    Botryobasidium botryosum FD-172 SS1
gb|EPB88707.1|  proteasome subunit beta type-3                          203   4e-62    Mucor circinelloides f. circinelloides 1006PhL
ref|XP_001745472.1|  hypothetical protein                               203   4e-62    Monosiga brevicollis MX1
dbj|GAM19772.1|  hypothetical protein SAMD00019534_029470               202   5e-62    Acytostelium subglobosum LB1
ref|XP_009824833.1|  hypothetical protein H257_02748                    202   5e-62    Aphanomyces astaci
emb|CDS02721.1|  Putative Proteasome subunit beta type                  202   6e-62    Lichtheimia ramosa
gb|ESA23897.1|  hypothetical protein GLOINDRAFT_341917                  202   7e-62    
ref|XP_011428234.1|  PREDICTED: proteasome subunit beta type-3-like     202   9e-62    Crassostrea gigas
gb|KFH62657.1|  proteasome subunit beta type-3                          202   1e-61    Mortierella verticillata NRRL 6337
gb|ELU08769.1|  hypothetical protein CAPTEDRAFT_228896                  202   1e-61    Capitella teleta
ref|XP_010730943.1|  PREDICTED: proteasome subunit beta type-3          202   1e-61    Larimichthys crocea [croceine croaker]
ref|XP_007258523.1|  PREDICTED: proteasome subunit beta type-3-like     202   1e-61    
ref|XP_418119.2|  PREDICTED: proteasome subunit beta type-3             202   1e-61    
ref|XP_780413.3|  PREDICTED: proteasome subunit beta type-3-like        201   2e-61    Strongylocentrotus purpuratus [purple urchin]
ref|XP_646265.1|  proteasome subunit beta type 3                        201   3e-61    Dictyostelium discoideum AX4
gb|EIE91509.1|  hypothetical protein RO3G_16220                         201   3e-61    Rhizopus delemar RA 99-880
ref|XP_004085833.1|  PREDICTED: proteasome subunit beta type-3          201   3e-61    Oryzias latipes [Japanese rice fish]
gb|ACI67569.1|  Proteasome subunit beta type-3                          201   3e-61    Salmo salar
ref|XP_006799729.1|  PREDICTED: proteasome subunit beta type-3-like     201   4e-61    Neolamprologus brichardi [lyretail cichlid]
ref|XP_004538793.1|  PREDICTED: proteasome subunit beta type-3-like     200   4e-61    Maylandia zebra
gb|KFO73083.1|  Proteasome subunit beta type-3                          200   4e-61    Cuculus canorus
ref|XP_008292536.1|  PREDICTED: proteasome subunit beta type-3          200   5e-61    Stegastes partitus
ref|XP_010583832.1|  PREDICTED: proteasome subunit beta type-3          200   6e-61    Haliaeetus leucocephalus
ref|XP_003448021.2|  PREDICTED: proteasome subunit beta type-3-like     200   6e-61    Oreochromis niloticus
gb|ADO27744.1|  proteasome subunit beta type-3                          200   7e-61    Ictalurus furcatus
ref|XP_007545257.1|  PREDICTED: proteasome subunit beta type-3          200   7e-61    Poecilia formosa
ref|XP_005803095.1|  PREDICTED: proteasome subunit beta type-3-like     199   8e-61    Xiphophorus maculatus
gb|ACH70865.1|  proteasome (prosome, macropain) subunit, beta type 3    199   1e-60    Salmo salar
ref|NP_001117722.1|  proteasome subunit beta type-3                     199   1e-60    Oncorhynchus mykiss
ref|XP_005301900.1|  PREDICTED: proteasome subunit beta type-3          199   1e-60    Chrysemys picta bellii
gb|ACO09022.1|  Proteasome subunit beta type 3                          199   1e-60    Osmerus mordax
gb|KFM04559.1|  Proteasome subunit beta type-3                          199   2e-60    Aptenodytes forsteri
ref|NP_001188163.1|  proteasome subunit beta type-3                     199   2e-60    Ictalurus punctatus
ref|XP_004361687.1|  proteasome subunit beta type 3                     198   2e-60    Cavenderia fasciculata
ref|XP_006022632.1|  PREDICTED: proteasome subunit beta type-3          201   2e-60    Alligator sinensis
ref|NP_001123295.1|  proteasome subunit beta type-3                     198   2e-60    Danio rerio [leopard danio]
ref|XP_011260355.1|  PREDICTED: proteasome subunit beta type-3          198   3e-60    Camponotus floridanus
ref|XP_003414726.1|  PREDICTED: proteasome subunit beta type-3          198   3e-60    Loxodonta africana [African bush elephant]
ref|XP_006259773.1|  PREDICTED: proteasome subunit beta type-3          198   3e-60    
gb|AFM87627.1|  proteasome (prosome, macropain) subunit, beta typ...    198   3e-60    Callorhinchus milii [Australian ghost shark]
ref|NP_001279732.1|  proteasome (prosome, macropain) subunit, bet...    198   3e-60    Callorhinchus milii [Australian ghost shark]
gb|AFK10923.1|  proteasome (prosome, macropain) subunit, beta typ...    198   3e-60    Callorhinchus milii [Australian ghost shark]
ref|XP_001599218.1|  PREDICTED: proteasome subunit beta type-3 is...    198   3e-60    Nasonia vitripennis
ref|XP_005711307.1|  20S core proteasome subunit beta                   198   3e-60    Chondrus crispus [carageen]
ref|XP_003972178.1|  PREDICTED: proteasome subunit beta type-3-like     198   3e-60    Takifugu rubripes [tiger puffer]
ref|NP_001016503.1|  proteasome subunit beta type-3                     198   4e-60    Xenopus tropicalis [western clawed frog]
gb|ACO07526.1|  Proteasome subunit beta type 3                          198   4e-60    Oncorhynchus mykiss
ref|XP_003768326.1|  PREDICTED: proteasome subunit beta type-3          198   4e-60    Sarcophilus harrisii
gb|KFP34344.1|  Proteasome subunit beta type-3                          198   4e-60    Colius striatus
ref|XP_002599453.1|  hypothetical protein BRAFLDRAFT_281217             198   4e-60    Branchiostoma floridae
gb|ACO08764.1|  Proteasome subunit beta type 3                          197   4e-60    Oncorhynchus mykiss
ref|XP_002508440.1|  predicted protein                                  198   5e-60    Micromonas commoda
gb|KJE95802.1|  proteasome subunit beta type-3                          199   5e-60    Capsaspora owczarzaki ATCC 30864
ref|XP_002183677.1|  predicted protein                                  197   5e-60    Phaeodactylum tricornutum CCAP 1055/1
ref|XP_006685609.1|  proteasome-domain-containing protein               197   5e-60    Yamadazyma tenuis ATCC 10573
ref|XP_001501618.2|  PREDICTED: proteasome subunit beta type-3          197   6e-60    Equus caballus [domestic horse]
gb|AEB53189.1|  proteasome subunit beta type 3                          197   6e-60    Holothuria glaberrima
ref|NP_587985.1|  20S proteasome component beta 3, Pup3 (predicted)     197   6e-60    Schizosaccharomyces pombe
gb|KDR23887.1|  Proteasome subunit beta type-3                          197   6e-60    Zootermopsis nevadensis
gb|ACI69598.1|  Proteasome subunit beta type-3                          197   7e-60    Salmo salar
ref|XP_007177581.1|  PREDICTED: proteasome subunit beta type-3          197   7e-60    Balaenoptera acutorostrata scammoni
ref|XP_009052112.1|  hypothetical protein LOTGIDRAFT_226791             197   7e-60    Lottia gigantea
ref|XP_004378066.1|  PREDICTED: proteasome subunit beta type-3          197   8e-60    Trichechus manatus latirostris
ref|XP_009554975.1|  PREDICTED: proteasome subunit beta type-3          197   9e-60    Cuculus canorus
ref|XP_004434651.1|  PREDICTED: proteasome subunit beta type-3 is...    197   9e-60    Ceratotherium simum simum [southern square-lipped rhinoceros]
ref|XP_005368450.1|  PREDICTED: proteasome subunit beta type-3          196   9e-60    
ref|XP_004608774.1|  PREDICTED: proteasome subunit beta type-3          197   9e-60    Sorex araneus [Eurasian shrew]
ref|XP_003222559.1|  PREDICTED: proteasome subunit beta type-3          197   9e-60    Anolis carolinensis [Carolina anole]
ref|XP_007429906.1|  PREDICTED: proteasome subunit beta type-3          197   9e-60    Python bivittatus
gb|ETE71446.1|  Proteasome subunit beta type-3                          198   1e-59    Ophiophagus hannah
gb|AAH87457.1|  Unknown (protein for MGC:99279)                         197   1e-59    Xenopus laevis [clawed frog]
ref|NP_036101.1|  proteasome subunit beta type-3                        197   1e-59    Mus musculus [mouse]
ref|NP_001277537.1|  proteasome (prosome, macropain) subunit, bet...    197   1e-59    Panthera tigris altaica
ref|NP_001239086.1|  proteasome subunit beta type-3                     197   1e-59    Canis lupus familiaris [dogs]
emb|CAG06144.1|  unnamed protein product                                197   1e-59    Tetraodon nigroviridis
ref|XP_006214288.1|  PREDICTED: proteasome subunit beta type-3          197   1e-59    Vicugna pacos
emb|CCA71352.1|  probable PUP3-20S proteasome subunit beta3             196   1e-59    Serendipita indica DSM 11827
ref|XP_001371633.2|  PREDICTED: proteasome subunit beta type-3          196   1e-59    Monodelphis domestica
ref|XP_004041889.1|  PREDICTED: proteasome subunit beta type-3          196   1e-59    Gorilla gorilla gorilla [lowland gorilla]
ref|NP_001088741.1|  proteasome (prosome, macropain) subunit, bet...    196   1e-59    Xenopus laevis [clawed frog]
ref|NP_001138374.1|  proteasome subunit beta type-3                     196   2e-59    Sus scrofa [pigs]
emb|CDQ68912.1|  unnamed protein product                                197   2e-59    Oncorhynchus mykiss
ref|XP_004282754.1|  PREDICTED: proteasome subunit beta type-3          196   2e-59    Orcinus orca [Orca]
ref|NP_058981.1|  proteasome subunit beta type-3                        196   2e-59    Rattus norvegicus [brown rat]
ref|XP_011184092.1|  PREDICTED: proteasome subunit beta type-3          196   2e-59    Zeugodacus cucurbitae [melon fruit fly]
ref|XP_011297407.1|  PREDICTED: proteasome subunit beta type-3          196   3e-59    Fopius arisanus
ref|XP_005140622.1|  PREDICTED: proteasome subunit beta type-3          196   3e-59    Melopsittacus undulatus
ref|NP_001029768.1|  proteasome subunit beta type-3                     196   3e-59    Bos taurus [bovine]
ref|XP_006889428.1|  PREDICTED: proteasome subunit beta type-3          196   3e-59    Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_004454988.1|  PREDICTED: proteasome subunit beta type-3          197   3e-59    Dasypus novemcinctus
ref|XP_011149990.1|  PREDICTED: proteasome subunit beta type-3          196   3e-59    Harpegnathos saltator
ref|XP_008606850.1|  20S proteasome subunit beta 3                      196   3e-59    Saprolegnia diclina VS20
gb|KFV84500.1|  Proteasome subunit beta type-3                          196   3e-59    Struthio camelus australis
ref|XP_009273127.1|  PREDICTED: proteasome subunit beta type-3          195   3e-59    Aptenodytes forsteri
ref|XP_011503711.1|  PREDICTED: proteasome subunit beta type-3 is...    196   3e-59    Ceratosolen solmsi marchali
gb|EMP33809.1|  Proteasome subunit beta type-3                          196   3e-59    Chelonia mydas [green seaturtle]
ref|XP_004707157.1|  PREDICTED: proteasome subunit beta type-3          196   3e-59    Echinops telfairi [lesser hedgehog tenrec]
ref|XP_005584041.1|  PREDICTED: proteasome subunit beta type-3 is...    195   3e-59    Macaca fascicularis [crab eating macaque]
ref|XP_002827712.1|  PREDICTED: proteasome subunit beta type-3          196   4e-59    
ref|NP_001040460.1|  proteasome beta 3 subunit                          195   4e-59    Bombyx mori [silk moth]
gb|EPX72025.1|  20S proteasome component beta 3                         195   4e-59    Schizosaccharomyces octosporus yFS286
ref|NP_001244746.1|  proteasome subunit beta type-3                     195   4e-59    Macaca mulatta [rhesus macaque]
ref|XP_002719377.1|  PREDICTED: proteasome subunit beta type-3          195   4e-59    Oryctolagus cuniculus [domestic rabbit]
ref|NP_002786.2|  proteasome subunit beta type-3                        195   4e-59    Homo sapiens [man]
gb|AAV38526.1|  proteasome (prosome, macropain) subunit, beta typ...    195   4e-59    synthetic construct
gb|KFM57092.1|  Proteasome subunit beta type-3                          195   4e-59    Stegodyphus mimosarum
ref|XP_004641146.1|  PREDICTED: proteasome subunit beta type-3-like     195   5e-59    Octodon degus
gb|KFQ01357.1|  Proteasome subunit beta type-3                          195   5e-59    Leptosomus discolor
pdb|1IRU|J  Chain J, Crystal Structure Of The Mammalian 20s Prote...    195   5e-59    Bos taurus [bovine]
ref|XP_006638397.1|  PREDICTED: proteasome subunit beta type-3-like     195   5e-59    
ref|XP_003288673.1|  proteasome subunit beta type 3                     195   5e-59    Dictyostelium purpureum
ref|XP_008152006.1|  PREDICTED: proteasome subunit beta type-3          195   5e-59    Eptesicus fuscus
ref|XP_004519795.1|  PREDICTED: proteasome subunit beta type-3-like     195   5e-59    Ceratitis capitata [medfly]
ref|XP_008687168.1|  PREDICTED: proteasome subunit beta type-3          195   5e-59    Ursus maritimus [white bear]
ref|XP_011175200.1|  PREDICTED: proteasome subunit beta type-3          195   6e-59    Solenopsis invicta [imported red fire ant]
ref|XP_010990150.1|  PREDICTED: proteasome subunit beta type-3          195   6e-59    
gb|EHB09674.1|  Proteasome subunit beta type-3                          195   6e-59    
gb|EFN65731.1|  Proteasome subunit beta type-3                          197   6e-59    
ref|XP_010722907.1|  PREDICTED: proteasome subunit beta type-3          195   6e-59    
ref|XP_005236630.1|  PREDICTED: proteasome subunit beta type-3          195   6e-59    
ref|XP_011347090.1|  PREDICTED: proteasome subunit beta type-3          195   6e-59    
ref|XP_008401760.1|  PREDICTED: proteasome subunit beta type-3          194   7e-59    
ref|XP_010206644.1|  PREDICTED: proteasome subunit beta type-3          194   8e-59    
ref|XP_005182786.1|  PREDICTED: proteasome subunit beta type-3          194   8e-59    
ref|XP_008316071.1|  PREDICTED: proteasome subunit beta type-3          194   9e-59    
ref|XP_007940199.1|  PREDICTED: proteasome subunit beta type-3          194   9e-59    
ref|XP_003702795.1|  PREDICTED: proteasome subunit beta type-3-like     194   9e-59    
gb|EFZ21650.1|  hypothetical protein SINV_15015                         195   9e-59    
ref|XP_011220101.1|  PREDICTED: proteasome subunit beta type-3          196   1e-58    
ref|XP_005098842.1|  PREDICTED: proteasome subunit beta type-3-like     194   1e-58    
ref|XP_004895163.1|  PREDICTED: proteasome subunit beta type-3 is...    194   1e-58    
ref|XP_005767557.1|  hypothetical protein EMIHUDRAFT_459379             194   1e-58    
ref|XP_005531463.1|  PREDICTED: proteasome subunit beta type-3          194   1e-58    
ref|XP_004684325.1|  PREDICTED: proteasome subunit beta type-3          194   1e-58    
ref|XP_003400568.1|  PREDICTED: proteasome subunit beta type-3-like     194   1e-58    
ref|XP_008559789.1|  PREDICTED: proteasome subunit beta type-3          194   1e-58    
gb|EFB19939.1|  hypothetical protein PANDA_004975                       193   1e-58    
ref|XP_011065729.1|  PREDICTED: proteasome subunit beta type-3          194   1e-58    
ref|XP_005861974.1|  PREDICTED: proteasome subunit beta type-3          194   2e-58    
gb|AFW76219.1|  hypothetical protein ZEAMMB73_756098                    190   2e-58    
gb|ELR54761.1|  Proteasome subunit beta type-3                          194   2e-58    
ref|XP_006126284.1|  PREDICTED: proteasome subunit beta type-3          199   2e-58    
ref|XP_009094713.1|  PREDICTED: proteasome subunit beta type-3          193   2e-58    
gb|AEE62971.1|  unknown                                                 194   2e-58    
emb|CDQ69715.1|  unnamed protein product                                193   2e-58    
ref|XP_004344963.2|  proteasome subunit beta type-3                     194   2e-58    
ref|XP_010618373.1|  PREDICTED: proteasome subunit beta type-3          193   2e-58    
gb|KIO31342.1|  hypothetical protein M407DRAFT_241859                   193   2e-58    
ref|XP_003695002.1|  PREDICTED: proteasome subunit beta type-3-like     193   2e-58    
gb|EHH24734.1|  Proteasome subunit beta type-3                          193   2e-58    
pdb|4R3O|J  Chain J, Human Constitutive 20s Proteasome                  193   2e-58    
emb|CCI41098.1|  unnamed protein product                                207   2e-58    
ref|XP_004591290.1|  PREDICTED: proteasome subunit beta type-3          194   3e-58    
ref|XP_007062009.1|  PREDICTED: proteasome subunit beta type-3          193   3e-58    
emb|CCI41096.1|  unnamed protein product                                207   3e-58    
gb|EPZ36546.1|  putative proteasome subunit beta type-3                 193   3e-58    
emb|CCI41099.1|  unnamed protein product                                207   3e-58    
emb|CCI41094.1|  unnamed protein product                                207   3e-58    
emb|CCI41100.1|  unnamed protein product                                207   3e-58    
ref|XP_009858011.1|  PREDICTED: proteasome subunit beta type-3-like     193   4e-58    
emb|CCI41095.1|  unnamed protein product                                207   4e-58    
emb|CCI41097.1|  unnamed protein product                                207   4e-58    
gb|EPY49805.1|  20S proteasome component beta 3                         192   4e-58    
ref|XP_007351158.1|  20S proteasome subunit beta 3                      192   5e-58    
ref|XP_624958.3|  PREDICTED: proteasome subunit beta type-3-like        192   5e-58    
ref|XP_009496857.1|  20S proteasome subunit beta 3                      192   6e-58    
ref|XP_008521505.1|  PREDICTED: proteasome subunit beta type-3          192   6e-58    
gb|ELK01586.1|  Proteasome subunit beta type-3                          193   6e-58    
ref|XP_007377645.1|  hypothetical protein SPAPADRAFT_63501              192   7e-58    
ref|XP_009679368.1|  PREDICTED: proteasome subunit beta type-3          192   7e-58    
gb|EGI58480.1|  Proteasome subunit beta type-3                          193   8e-58    
dbj|GAC93340.1|  hypothetical protein PHSY_000905                       192   9e-58    
ref|XP_003484954.1|  PREDICTED: proteasome subunit beta type-3-like     192   9e-58    
ref|XP_003466953.2|  PREDICTED: proteasome subunit beta type-3          192   9e-58    
ref|XP_009957440.1|  PREDICTED: proteasome subunit beta type-3          192   1e-57    
ref|XP_008064651.1|  PREDICTED: proteasome subunit beta type-3 is...    191   1e-57    
ref|XP_010389682.1|  PREDICTED: proteasome subunit beta type-3          191   1e-57    
ref|XP_002175348.1|  20S proteasome component beta 3                    191   2e-57    
gb|ACO08515.1|  Proteasome subunit beta type 3                          191   2e-57    
gb|EDM05877.1|  rCG33987, isoform CRA_d                                 191   2e-57    
ref|XP_007531021.1|  PREDICTED: proteasome subunit beta type-3          192   2e-57    
ref|XP_001359838.1|  GA11308                                            191   2e-57    
gb|EST06443.1|  putative PUP3-20S proteasome subunit beta3              191   2e-57    
gb|ETS63749.1|  hypothetical protein PaG_02065                          191   3e-57    
ref|XP_005818424.1|  proteasome subunit beta type 3                     191   3e-57    
emb|CBE67030.1|  CG11981-PA                                             190   4e-57    
ref|XP_004633741.1|  PREDICTED: proteasome subunit beta type-3          190   4e-57    
ref|XP_008909010.1|  hypothetical protein, variant                      189   5e-57    
ref|XP_005139393.1|  PREDICTED: LOW QUALITY PROTEIN: proteasome (...    191   5e-57    
ref|XP_011386832.1|  putative proteasome core particle subunit be...    190   6e-57    
ref|XP_007870227.1|  20S proteasome subunit beta 3                      190   6e-57    
ref|XP_001954770.1|  GF18436                                            190   6e-57    
gb|EPY87176.1|  proteasome subunit beta type-3                          194   6e-57    
ref|XP_005708496.1|  proteasome beta subunit                            189   9e-57    
ref|XP_002111242.1|  hypothetical protein TRIADDRAFT_50102              189   9e-57    
gb|KIP04077.1|  hypothetical protein PHLGIDRAFT_93948                   189   9e-57    
ref|XP_002429948.1|  proteasome subunit beta type, putative             189   1e-56    
gb|EFX67334.1|  hypothetical protein DAPPUDRAFT_231791                  189   1e-56    
gb|KDQ53836.1|  hypothetical protein JAAARDRAFT_182602                  189   1e-56    
gb|KII93673.1|  hypothetical protein PLICRDRAFT_49695                   189   1e-56    
ref|NP_649858.1|  proteasome beta3 subunit                              189   1e-56    
gb|KFR08355.1|  Proteasome subunit beta type-3                          188   2e-56    
ref|XP_002000340.1|  GI10178                                            188   2e-56    
ref|XP_001990482.1|  GH18224                                            188   2e-56    
ref|XP_002056309.1|  GJ10880                                            188   2e-56    
ref|XP_007881899.1|  hypothetical protein PFL1_06169                    188   3e-56    
gb|AFW70450.1|  hypothetical protein ZEAMMB73_290009                    188   3e-56    
gb|KFO34910.1|  Proteasome subunit beta type-3                          188   3e-56    
ref|XP_004368094.1|  20S proteasome subunit beta 3, putative            187   5e-56    
ref|XP_001874027.1|  20S proteasome subunit beta 3                      187   6e-56    
ref|XP_002069722.1|  GK11424                                            187   6e-56    
ref|XP_003062799.1|  predicted protein                                  187   6e-56    
gb|EDK40915.2|  hypothetical protein PGUG_05013                         187   6e-56    
ref|XP_001415971.1|  predicted protein                                  187   7e-56    
gb|KIM24960.1|  hypothetical protein M408DRAFT_331438                   187   7e-56    
gb|EJU05191.1|  20S proteasome subunit beta 3                           187   7e-56    
emb|CDI51430.1|  probable PUP3-20S proteasome subunit beta3             186   9e-56    
emb|CEL59602.1|  20S proteasome subunit beta 3                          187   9e-56    
emb|CDY70670.1|  BnaCnng69300D                                          185   1e-55    
ref|XP_009930841.1|  PREDICTED: proteasome subunit beta type-3          186   1e-55    
ref|XP_009023584.1|  hypothetical protein HELRODRAFT_185850             186   1e-55    
emb|CCU99687.1|  unnamed protein product                                186   1e-55    
emb|CBQ67918.1|  probable PUP3-20S proteasome subunit beta3             186   1e-55    
ref|XP_004200900.1|  Piso0_003510                                       186   2e-55    
ref|XP_007388022.1|  20S proteasome subunit beta 3                      186   2e-55    
gb|KIK07242.1|  hypothetical protein K443DRAFT_200353                   186   2e-55    
ref|XP_007003678.1|  hypothetical protein TREMEDRAFT_68051              186   3e-55    
gb|KIJ66203.1|  hypothetical protein HYDPIDRAFT_174366                  186   3e-55    
emb|CCF54255.1|  probable PUP3-20S proteasome subunit beta3             185   3e-55    
ref|XP_002421515.1|  macropain subunit, putative; multicatalytic ...    185   4e-55    
gb|KIK77617.1|  hypothetical protein PAXRUDRAFT_36767                   185   5e-55    
gb|AAO14683.1|AF508264_1  beta 3 subunit of 20S proteasome              185   5e-55    
emb|CEF96847.1|  Proteasome B-type subunit                              185   5e-55    
gb|EFA83482.1|  p21-activated protein kinase                            199   5e-55    
gb|KIM47479.1|  hypothetical protein M413DRAFT_439139                   185   5e-55    
ref|XP_001483058.1|  hypothetical protein PGUG_05013                    184   7e-55    
gb|KIY50514.1|  20S proteasome subunit beta 3                           184   7e-55    
gb|KJA28415.1|  hypothetical protein HYPSUDRAFT_33791                   184   8e-55    
gb|ACO11102.1|  Proteasome subunit beta type-3                          184   8e-55    
ref|XP_005430607.1|  PREDICTED: proteasome subunit beta type-3          184   9e-55    
gb|EDL09928.1|  mCG1283                                                 184   1e-54    
ref|XP_002474405.1|  predicted protein                                  184   1e-54    
gb|KDN51012.1|  hypothetical protein RSAG8_00641                        184   1e-54    
ref|XP_003031638.1|  hypothetical protein SCHCODRAFT_15691              184   1e-54    
ref|XP_711676.1|  hypothetical protein CaO19.1336                       184   1e-54    
ref|XP_007397961.1|  hypothetical protein PHACADRAFT_259498             184   1e-54    
gb|KIK30157.1|  hypothetical protein PISMIDRAFT_671280                  184   1e-54    
ref|XP_005061655.1|  PREDICTED: proteasome subunit beta type-3          184   2e-54    
gb|KIM88831.1|  hypothetical protein PILCRDRAFT_813813                  183   2e-54    
gb|ACO11008.1|  Proteasome subunit beta type-3                          183   2e-54    
gb|KIJ37723.1|  hypothetical protein M422DRAFT_781612                   183   2e-54    
gb|EMF10284.1|  N-terminal nucleophile aminohydrolase                   183   2e-54    
emb|CAJ83196.1|  proteasome (prosome macropain) subunit beta type 3     182   2e-54    
gb|KDR85748.1|  hypothetical protein GALMADRAFT_234809                  183   2e-54    
gb|EWY94556.1|  proteasome component PUP3                               181   3e-54    
ref|XP_002796904.1|  proteasome component PUP3                          183   3e-54    
emb|CCG83935.1|  protein of unknown function                            182   3e-54    
gb|ACO15581.1|  Proteasome subunit beta type-3                          182   3e-54    
ref|XP_009035183.1|  hypothetical protein AURANDRAFT_71184              191   3e-54    
gb|KIJ22008.1|  hypothetical protein PAXINDRAFT_165321                  182   4e-54    
gb|KDN37535.1|  putative PUP3-20S proteasome subunit beta3              182   4e-54    
gb|KGQ84851.1|  proteasome component PUP3                               182   5e-54    
gb|EJY87444.1|  Proteasome subunit beta type-3                          182   5e-54    
ref|XP_003383125.1|  PREDICTED: proteasome subunit beta type-3-like     182   6e-54    
gb|EGW05278.1|  Proteasome subunit beta type-3                          181   6e-54    
gb|EKD04743.1|  proteasome subunit beta type 3                          182   7e-54    
gb|KIK46250.1|  hypothetical protein CY34DRAFT_800585                   182   7e-54    
gb|KIW72067.1|  proteasome subunit beta type-3                          182   7e-54    
gb|KIV94470.1|  proteasome subunit beta type-3                          182   7e-54    
gb|KIW61914.1|  proteasome subunit beta type-3                          182   7e-54    
ref|XP_008194648.1|  PREDICTED: proteasome subunit beta type-3          182   7e-54    
ref|XP_003236876.1|  proteasome subunit beta                            182   7e-54    
gb|KIW26277.1|  proteasome subunit beta type-3                          182   7e-54    
emb|CEJ81669.1|  Putative Proteasome subunit beta type                  182   8e-54    
ref|XP_007306903.1|  20S proteasome subunit beta 3                      182   8e-54    
gb|KFO52580.1|  Proteasome subunit beta type-3                          181   8e-54    
ref|XP_711658.1|  hypothetical protein CaO19.8916                       182   8e-54    
ref|XP_008041394.1|  N-terminal nucleophile aminohydrolase              182   9e-54    
emb|CCX14240.1|  Similar to Proteasome component PUP3; acc. no. P...    181   9e-54    
gb|EGD96721.1|  proteasome subunit beta type-3                          181   1e-53    
ref|XP_006695754.1|  hypothetical protein CTHT_0054190                  181   1e-53    
gb|KIM70302.1|  hypothetical protein SCLCIDRAFT_1207617                 181   1e-53    
emb|CBY18118.1|  unnamed protein product                                181   1e-53    
ref|XP_009552532.1|  20S proteasome, regulatory subunit beta type       181   1e-53    
ref|XP_001939046.1|  proteasome subunit beta type-3                     181   1e-53    
emb|CCD58589.1|  proteasome subunit beta 3 (T01 family)                 181   1e-53    
emb|CCF41580.1|  proteasome component PUP3                              181   1e-53    
gb|EWG38002.1|  proteasome component PUP3                               181   1e-53    
gb|EFQ29355.1|  proteasome A-type and B-type                            181   1e-53    
ref|XP_002492139.1|  Beta 3 subunit of the 20S proteasome involve...    181   1e-53    
ref|XP_007262405.1|  20S proteasome subunit beta 3                      181   1e-53    
ref|XP_003054110.1|  predicted protein                                  181   1e-53    
ref|XP_458253.1|  DEHA2C13222p                                          181   1e-53    
gb|ABB92466.1|  rcPSMB3                                                 181   1e-53    
ref|XP_003427914.1|  PREDICTED: proteasome subunit beta type-3 is...    181   1e-53    
ref|XP_003850602.1|  proteasome core particle subunit beta 3            181   1e-53    
emb|CCD58588.1|  proteasome subunit beta 3 (T01 family)                 181   1e-53    
ref|XP_008031341.1|  hypothetical protein SETTUDRAFT_166162             181   2e-53    
gb|EMD36279.1|  20S proteasome subunit beta 3                           181   2e-53    
gb|ELU45815.1|  20S proteasome subunit beta 3                           187   2e-53    
emb|CCO26430.1|  20S proteasome subunit beta 3                          181   2e-53    
gb|KIO08534.1|  hypothetical protein M404DRAFT_23075                    181   2e-53    
gb|KIV78159.1|  proteasome subunit beta type-3                          181   2e-53    
gb|KEQ83381.1|  proteasome subunit beta type-3                          181   2e-53    
ref|XP_001401548.1|  proteasome component PUP3                          181   2e-53    
ref|XP_003335621.1|  proteasome component PUP3                          181   2e-53    
ref|XP_505745.1|  YALI0F22341p                                          181   2e-53    
gb|KEZ44625.1|  hypothetical protein SAPIO_CDS3666                      181   3e-53    
ref|XP_007763601.1|  20S proteasome subunit beta 3                      180   3e-53    
ref|XP_008632929.1|  PREDICTED: proteasome subunit beta type-3          180   3e-53    
gb|AAW25726.1|  SJCHGC01130 protein                                     179   3e-53    
ref|XP_007702070.1|  hypothetical protein COCSADRAFT_38618              180   3e-53    
gb|KIW42643.1|  proteasome subunit beta type-3                          180   4e-53    
gb|AAW25822.1|  unknown                                                 179   4e-53    
gb|EME39641.1|  hypothetical protein DOTSEDRAFT_75329                   180   4e-53    
ref|XP_001731296.1|  hypothetical protein MGL_1479                      180   4e-53    
gb|EDL11064.1|  mCG13639                                                180   4e-53    
ref|XP_003710932.1|  proteasome component PUP3                          180   5e-53    
ref|XP_002160822.2|  PREDICTED: proteasome subunit beta type-3-like     179   5e-53    
ref|XP_002565785.1|  Pc22g18820                                         180   5e-53    
gb|EHK16581.1|  hypothetical protein TRIVIDRAFT_183933                  180   5e-53    
gb|EHK40665.1|  beta subunit Pup3 of the 20S proteasome                 180   5e-53    
emb|CAX72789.1|  proteasome (prosome, macropain) subunit, beta ty...    180   5e-53    
ref|XP_009225804.1|  proteasome component PUP3                          179   5e-53    
ref|XP_007288366.1|  proteasome subunit beta type-3                     180   6e-53    
ref|XP_007581421.1|  putative proteasome component pup3 protein         179   6e-53    
ref|XP_001271634.1|  proteasome component Pup3, putative                179   6e-53    
gb|KFH45773.1|  Proteasome subunit beta type-like protein               179   7e-53    
gb|KIY63673.1|  20S proteasome subunit beta 3                           179   8e-53    
gb|AAP06451.1|  similar to NM_011971 proteasome (prosome, macropa...    179   8e-53    
gb|ACO12842.1|  Proteasome subunit beta type-3                          179   8e-53    
gb|ABB92465.1|  rcPSMB3                                                 179   8e-53    
ref|XP_007312582.1|  hypothetical protein SERLADRAFT_454981             179   9e-53    
gb|KFY87716.1|  hypothetical protein V498_07050                         179   9e-53    
ref|XP_003744177.1|  PREDICTED: proteasome subunit beta type-3-like     179   9e-53    
gb|EKV19776.1|  hypothetical protein PDIG_01170                         179   1e-52    



>ref|XP_011069394.1| PREDICTED: proteasome subunit beta type-3-A [Sesamum indicum]
Length=204

 Score =   313 bits (802),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIH KLF+GLAGLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHDKLFIGLAGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>emb|CDP10945.1| unnamed protein product [Coffea canephora]
Length=204

 Score =   313 bits (802),  Expect = 2e-105, Method: Compositional matrix adjust.
 Identities = 148/156 (95%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYRIHDKLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG+EDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGEEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>gb|KCW71243.1| hypothetical protein EUGRSUZ_F04339 [Eucalyptus grandis]
Length=262

 Score =   313 bits (802),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 149/170 (88%), Positives = 159/170 (94%), Gaps = 0/170 (0%)
 Frame = +2

Query  62   LSPASRFLSSACLRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIH  241
            L  A R  + A   MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H
Sbjct  45   LDAARRIDTPAGSPMSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVH  104

Query  242  GKLFLGLAGLATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQ  421
             KLFLGL+GLATD QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQ
Sbjct  105  DKLFLGLSGLATDAQTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQ  164

Query  422  PVIAGLGDEDKPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            PVIAGLGDEDKPFICTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  165  PVIAGLGDEDKPFICTMDSIGAKELAKDFVVAGTASESLYGACESMFKPD  214



>ref|XP_010063943.1| PREDICTED: proteasome subunit beta type-3-A [Eucalyptus grandis]
Length=204

 Score =   311 bits (796),  Expect = 2e-104, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H KLFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVHDKLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>ref|XP_010243518.1| PREDICTED: proteasome subunit beta type-3 [Nelumbo nucifera]
Length=204

 Score =   310 bits (794),  Expect = 3e-104, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPD  156



>ref|XP_009616684.1| PREDICTED: proteasome subunit beta type-3-A [Nicotiana tomentosiformis]
Length=204

 Score =   310 bits (793),  Expect = 6e-104, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLFIGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLY+LREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYELREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_009798221.1| PREDICTED: proteasome subunit beta type-3-A [Nicotiana sylvestris]
Length=204

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_010527680.1| PREDICTED: proteasome subunit beta type-3-A-like [Tarenaya hassleriana]
Length=204

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH +LF+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYRIHDRLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_010539660.1| PREDICTED: proteasome subunit beta type-3-A-like isoform X1 [Tarenaya 
hassleriana]
Length=204

 Score =   309 bits (791),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|KDP32966.1| hypothetical protein JCGZ_12997 [Jatropha curcas]
Length=204

 Score =   308 bits (790),  Expect = 1e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHHRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAIFKPD  156



>ref|XP_002285871.1| PREDICTED: proteasome subunit beta type-3-A [Vitis vinifera]
 emb|CBI18992.3| unnamed protein product [Vitis vinifera]
Length=204

 Score =   308 bits (790),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRR GVQLQTVATDF++IY+IH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRFGVQLQTVATDFQKIYRIHDRVFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>gb|KDP32836.1| hypothetical protein JCGZ_12128 [Jatropha curcas]
Length=204

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KLFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CT DSIGAKELAKDFVVAGTASESLYGACE++FKPD
Sbjct  121  CTTDSIGAKELAKDFVVAGTASESLYGACESLFKPD  156



>ref|XP_009769699.1| PREDICTED: proteasome subunit beta type-3-A-like [Nicotiana sylvestris]
Length=204

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLFIGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETF+SLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFSSLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>gb|ADR70868.1| 20S proteasome beta subunit C2 [Hevea brasiliensis]
Length=204

 Score =   308 bits (789),  Expect = 2e-103, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAVFKPD  156



>ref|XP_004149805.1| PREDICTED: proteasome subunit beta type-3-A-like [Cucumis sativus]
 gb|KGN47703.1| hypothetical protein Csa_6G382910 [Cucumis sativus]
Length=204

 Score =   308 bits (788),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF++IY+IH KLFLGL+GL TD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYRIHDKLFLGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>gb|KCW71242.1| hypothetical protein EUGRSUZ_F04339 [Eucalyptus grandis]
Length=262

 Score =   310 bits (794),  Expect = 3e-103, Method: Compositional matrix adjust.
 Identities = 148/170 (87%), Positives = 158/170 (93%), Gaps = 0/170 (0%)
 Frame = +2

Query  62   LSPASRFLSSACLRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIH  241
            L  A R  + A   MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF++IYK+H
Sbjct  45   LDAARRIDTPAGSPMSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKVH  104

Query  242  GKLFLGLAGLATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQ  421
             KLFLGL+GLATD QTLYQRLVFRHKLYQLREERDMKPETFA+LVS+ILYEKRFGPYFCQ
Sbjct  105  DKLFLGLSGLATDAQTLYQRLVFRHKLYQLREERDMKPETFANLVSSILYEKRFGPYFCQ  164

Query  422  PVIAGLGDEDKPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            PVIAGLGDEDKPFICTMDSIGAK LAKDFVVAGTASESLYGACE+MFKPD
Sbjct  165  PVIAGLGDEDKPFICTMDSIGAKYLAKDFVVAGTASESLYGACESMFKPD  214



>ref|XP_010521275.1| PREDICTED: proteasome subunit beta type-3-A isoform X1 [Tarenaya 
hassleriana]
Length=204

 Score =   307 bits (787),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_010539661.1| PREDICTED: proteasome subunit beta type-3-A-like isoform X2 [Tarenaya 
hassleriana]
Length=204

 Score =   307 bits (786),  Expect = 5e-103, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_009601797.1| PREDICTED: proteasome subunit beta type-3-A-like [Nicotiana tomentosiformis]
Length=167

 Score =   306 bits (783),  Expect = 6e-103, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   LTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>gb|KJB29135.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=189

 Score =   306 bits (784),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFK  565
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFK  154



>gb|AFK48891.1| unknown [Lotus japonicus]
Length=204

 Score =   307 bits (786),  Expect = 7e-103, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFA+ASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAVASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS+ILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEAMFKPD
Sbjct  121  CTMDCIGAKELAKDFVVAGSASESLYGACEAMFKPD  156



>ref|XP_002520338.1| proteasome subunit beta type, putative [Ricinus communis]
 gb|EEF42124.1| proteasome subunit beta type, putative [Ricinus communis]
Length=204

 Score =   306 bits (785),  Expect = 8e-103, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDM PETFASLVSA+LYEKRFGPYFCQPVIAGL DE+KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMNPETFASLVSALLYEKRFGPYFCQPVIAGLSDENKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELA+DFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDSIGAKELARDFVVAGTASESLYGACESMFKPD  156



>ref|XP_010268988.1| PREDICTED: proteasome subunit beta type-3-like [Nelumbo nucifera]
Length=204

 Score =   306 bits (785),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL FRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLFFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPD  156



>emb|CAC43324.1| putative beta 3 proteasome subunit [Nicotiana tabacum]
Length=178

 Score =   305 bits (782),  Expect = 9e-103, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH K+F+GL+GL TDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKVFIGLSGLGTDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   LTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>gb|KJB29134.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=178

 Score =   305 bits (782),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFK  565
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFK  154



>gb|KJB64503.1| hypothetical protein B456_010G052100 [Gossypium raimondii]
Length=204

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK +
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKEN  156



>gb|KJB29133.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=204

 Score =   306 bits (784),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFK  565
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFK  154



>gb|KJB29136.1| hypothetical protein B456_005G088700 [Gossypium raimondii]
Length=223

 Score =   307 bits (786),  Expect = 1e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFK  565
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFK  154



>ref|NP_001237278.1| uncharacterized protein LOC100306084 [Glycine max]
 gb|ACU14087.1| unknown [Glycine max]
 gb|KHN47019.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKP+TFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLLFRHKLYQLREERDMKPQTFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>ref|XP_007019135.1| Proteasome beta subunit C1 [Theobroma cacao]
 gb|EOY16360.1| Proteasome beta subunit C1 [Theobroma cacao]
Length=204

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK D
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKED  156



>ref|XP_010521276.1| PREDICTED: proteasome subunit beta type-3-A isoform X2 [Tarenaya 
hassleriana]
Length=204

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIYKIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_004493306.1| PREDICTED: proteasome subunit beta type-3-A-like [Cicer arietinum]
Length=204

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFK D
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKAD  156



>ref|NP_564149.1| proteasome beta subunit C1 [Arabidopsis thaliana]
 ref|XP_010498627.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 ref|XP_010459893.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 ref|XP_010477418.1| PREDICTED: proteasome subunit beta type-3-A [Camelina sativa]
 sp|Q9XI05.2|PSB3A_ARATH RecName: Full=Proteasome subunit beta type-3-A; AltName: Full=20S 
proteasome beta subunit C-1; AltName: Full=Proteasome component 
T [Arabidopsis thaliana]
 gb|AAL38246.1| proteasome subunit [Arabidopsis thaliana]
 gb|AAM47947.1| proteasome subunit [Arabidopsis thaliana]
 dbj|BAE98543.1| 20S proteasome beta subunit PBC2 like protein [Arabidopsis thaliana]
 gb|AEE30146.1| proteasome beta subunit C1 [Arabidopsis thaliana]
Length=204

 Score =   306 bits (783),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|AFK33992.1| unknown [Lotus japonicus]
Length=204

 Score =   305 bits (782),  Expect = 2e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+RI+K+H KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVQLQTVATDFQRIFKVHDKLFIALSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEAMFKPD
Sbjct  121  CTMDCIGAKELAKDFVVAGSASESLYGACEAMFKPD  156



>ref|XP_010428822.1| PREDICTED: proteasome subunit beta type-3-B [Camelina sativa]
 ref|XP_010471937.1| PREDICTED: proteasome subunit beta type-3-B isoform X1 [Camelina 
sativa]
Length=204

 Score =   305 bits (782),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_006302830.1| hypothetical protein CARUB_v10020962mg [Capsella rubella]
 gb|EOA35728.1| hypothetical protein CARUB_v10020962mg [Capsella rubella]
Length=204

 Score =   305 bits (782),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_010416685.1| PREDICTED: proteasome subunit beta type-3-B-like isoform X1 [Camelina 
sativa]
Length=204

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_008352621.1| PREDICTED: proteasome subunit beta type-3-A [Malus domestica]
Length=204

 Score =   305 bits (781),  Expect = 3e-102, Method: Compositional matrix adjust.
 Identities = 145/156 (93%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_006838497.1| hypothetical protein AMTR_s00002p00168080 [Amborella trichopoda]
 gb|ERN01066.1| hypothetical protein AMTR_s00002p00168080 [Amborella trichopoda]
Length=204

 Score =   305 bits (781),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIHG+LF+GLAGLATD 
Sbjct  1    MQIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHGRLFIGLAGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG +DKPFI
Sbjct  61   QTLYQRLIFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGKDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELA+DFVV GTASESLYGACE+M+KPD
Sbjct  121  CTMDSIGAKELAEDFVVGGTASESLYGACESMYKPD  156



>gb|ADR70867.1| 20S proteasome beta subunit C1 [Hevea brasiliensis]
Length=204

 Score =   305 bits (780),  Expect = 4e-102, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKFHDRLFMGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DE+KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDENKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEA+FKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAVFKPD  156



>gb|KHG23898.1| Proteasome subunit beta type-3-A -like protein [Gossypium arboreum]
Length=227

 Score =   305 bits (782),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 144/154 (94%), Positives = 152/154 (99%), Gaps = 0/154 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQT+ATDF+RIYK+H +LFLGL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTIATDFQRIYKVHDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFK  565
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFK  154



>ref|XP_007223461.1| hypothetical protein PRUPE_ppa011601mg [Prunus persica]
 gb|EMJ24660.1| hypothetical protein PRUPE_ppa011601mg [Prunus persica]
Length=204

 Score =   305 bits (780),  Expect = 5e-102, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_006595528.1| PREDICTED: uncharacterized protein LOC100527027 isoform X1 [Glycine 
max]
 gb|KHN33974.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   305 bits (780),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIALSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>gb|KJB59983.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
 gb|KJB59984.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
Length=204

 Score =   305 bits (780),  Expect = 6e-102, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK D
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKED  156



>ref|XP_010670575.1| PREDICTED: proteasome subunit beta type-3-A [Beta vulgaris subsp. 
vulgaris]
Length=204

 Score =   304 bits (779),  Expect = 7e-102, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RIY+IH +LF+GL+GL TD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIYQIHDRLFIGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLY LREERDMKPETFA+LVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYHLREERDMKPETFANLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M+KPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYKPD  156



>ref|XP_006416271.1| hypothetical protein EUTSA_v10008793mg [Eutrema salsugineum]
 gb|ESQ34624.1| hypothetical protein EUTSA_v10008793mg [Eutrema salsugineum]
Length=204

 Score =   304 bits (779),  Expect = 8e-102, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVG+NCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGRNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_002890456.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
 gb|AAD41426.1|AC007727_15 Identical to gb|Y13173 Arabidopsis thaliana mRNA for proteasome 
subunit. EST gb|T76747 comes from this gene [Arabidopsis 
thaliana]
 gb|AAK06878.1|AF344327_1 putative 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
 gb|EFH66715.1| predicted protein [Arabidopsis lyrata subsp. lyrata]
Length=204

 Score =   304 bits (778),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_009149692.1| PREDICTED: proteasome subunit beta type-3-A [Brassica rapa]
 emb|CDY08181.1| BnaA06g15450D [Brassica napus]
 emb|CDY04667.1| BnaC05g17050D [Brassica napus]
Length=204

 Score =   304 bits (778),  Expect = 9e-102, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|AFK33863.1| unknown [Medicago truncatula]
Length=206

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>emb|CDY00398.1| BnaC07g14280D [Brassica napus]
Length=204

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|NP_565156.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 ref|NP_001031294.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 sp|O81153.1|PSB3B_ARATH RecName: Full=Proteasome subunit beta type-3-B; AltName: Full=20S 
proteasome beta subunit C-2 [Arabidopsis thaliana]
 gb|AAK60320.1|AF385730_1 At1g77440/T5M16_3 [Arabidopsis thaliana]
 gb|AAC32069.1| 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
 gb|AAL87388.1| At1g77440/T5M16_3 [Arabidopsis thaliana]
 gb|AEE35977.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
 gb|AEE35978.1| 20S proteasome beta subunit C2 [Arabidopsis thaliana]
Length=204

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_003624868.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES81086.1| proteasome beta type-3 subunit [Medicago truncatula]
Length=204

 Score =   304 bits (778),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>ref|XP_009128227.1| PREDICTED: proteasome subunit beta type-3-A [Brassica rapa]
Length=204

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFKRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_008219606.1| PREDICTED: proteasome subunit beta type-3-A [Prunus mume]
Length=204

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+G++GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGISGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_010471938.1| PREDICTED: proteasome subunit beta type-3-B isoform X2 [Camelina 
sativa]
Length=204

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|NP_001237990.1| uncharacterized protein LOC100499664 [Glycine max]
 gb|ACU13164.1| unknown [Glycine max]
 gb|KHN05192.1| Proteasome subunit beta type-3-A [Glycine soja]
Length=204

 Score =   303 bits (777),  Expect = 1e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIALSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_010416686.1| PREDICTED: proteasome subunit beta type-3-B-like isoform X2 [Camelina 
sativa]
Length=204

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>ref|XP_008338662.1| PREDICTED: proteasome subunit beta type-3-A [Malus domestica]
Length=204

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFAS VSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASXVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>emb|CDY01316.1| BnaA07g10890D [Brassica napus]
Length=206

 Score =   303 bits (776),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/158 (89%), Positives = 153/158 (97%), Gaps = 0/158 (0%)
 Frame = +2

Query  98   LRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLAT  277
            + M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLAT
Sbjct  1    MSMQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLAT  60

Query  278  DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKP  457
            DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKP
Sbjct  61   DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKP  120

Query  458  FICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            FICTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  FICTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  158



>gb|EYU31766.1| hypothetical protein MIMGU_mgv1a013986mg [Erythranthe guttata]
Length=204

 Score =   303 bits (775),  Expect = 2e-101, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF++IY+IH KLF+GLAGLATD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYRIHDKLFIGLAGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL+QRLVFRHKLY+LREERDMKPETFASLVSAI YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLHQRLVFRHKLYKLREERDMKPETFASLVSAIQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+M++PD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMYRPD  156



>ref|XP_006434244.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 ref|XP_006472814.1| PREDICTED: proteasome subunit beta type-3-A-like [Citrus sinensis]
 gb|ESR47484.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|KDO80553.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=204

 Score =   303 bits (775),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTA ESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTAGESLYGACEAMFKPD  156



>gb|AFK44934.1| unknown [Medicago truncatula]
Length=204

 Score =   303 bits (775),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDM+PETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMRPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>ref|XP_002887683.1| hypothetical protein ARALYDRAFT_895633 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH63942.1| hypothetical protein ARALYDRAFT_895633 [Arabidopsis lyrata subsp. 
lyrata]
Length=204

 Score =   303 bits (775),  Expect = 3e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|AAM62756.1| putative 20S proteasome beta subunit PBC2 [Arabidopsis thaliana]
Length=204

 Score =   302 bits (774),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYN SA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNVSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_002307450.1| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
 ref|XP_011003432.1| PREDICTED: proteasome subunit beta type-3-A [Populus euphratica]
 gb|EEE94446.1| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
Length=204

 Score =   302 bits (774),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH K+F+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKVFVGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEA+FKPD
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEALFKPD  156



>ref|XP_009376873.1| PREDICTED: proteasome subunit beta type-3-A [Pyrus x bretschneideri]
Length=204

 Score =   302 bits (774),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSISEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_006390090.1| hypothetical protein EUTSA_v10019145mg [Eutrema salsugineum]
 gb|ESQ27376.1| hypothetical protein EUTSA_v10019145mg [Eutrema salsugineum]
Length=204

 Score =   302 bits (774),  Expect = 4e-101, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSAILYEKRFGPY CQPVIAGLG+++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPDTFASLVSAILYEKRFGPYLCQPVIAGLGEDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_006304134.1| hypothetical protein CARUB_v10010099mg, partial [Capsella rubella]
 gb|EOA37032.1| hypothetical protein CARUB_v10010099mg, partial [Capsella rubella]
Length=251

 Score =   304 bits (778),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  48   MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  107

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLGD++KPFI
Sbjct  108  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGDDNKPFI  167

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  168  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  203



>ref|XP_009112575.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   302 bits (773),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_006434245.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|ESR47485.1| hypothetical protein CICLE_v10002515mg [Citrus clementina]
 gb|KDO80555.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
 gb|KDO80556.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=185

 Score =   301 bits (771),  Expect = 5e-101, Method: Compositional matrix adjust.
 Identities = 144/156 (92%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTA ESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTAGESLYGACEAMFKPD  156



>ref|XP_009110172.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   302 bits (773),  Expect = 6e-101, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|KFK44279.1| hypothetical protein AALP_AA1G237600 [Arabis alpina]
Length=204

 Score =   300 bits (769),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL QRL FRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLNQRLAFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMFKPD  156



>gb|KFK42138.1| hypothetical protein AALP_AA2G216100 [Arabis alpina]
Length=204

 Score =   300 bits (769),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREER+MKPETFASLVSA+LYEKRFGPY CQPVIAGLG+++KPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERNMKPETFASLVSAVLYEKRFGPYLCQPVIAGLGEDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>sp|O65084.1|PSB3_PICMA RecName: Full=Proteasome subunit beta type-3; AltName: Full=20S 
proteasome alpha subunit C; AltName: Full=20S proteasome 
subunit beta-3 [Picea mariana]
 gb|AAC32146.1| probable proteasome subunit [Picea mariana]
 gb|ABK23292.1| unknown [Picea sitchensis]
Length=204

 Score =   300 bits (769),  Expect = 2e-100, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYVGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQR  FRHKLYQLREER+M+PETFASLVSA+LYEKRFGPYFCQPVIAGLG++DKPFI
Sbjct  61   QTLYQRFAFRHKLYQLREERNMRPETFASLVSALLYEKRFGPYFCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTA+ESLYGACE+M+KPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTAAESLYGACESMYKPD  156



>gb|ACJ85972.1| unknown [Medicago truncatula]
Length=204

 Score =   300 bits (768),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREE DMKPETFASLVS++ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREECDMKPETFASLVSSMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>gb|KHG25919.1| Proteasome subunit beta type-3-A -like protein [Gossypium arboreum]
Length=274

 Score =   302 bits (774),  Expect = 4e-100, Method: Compositional matrix adjust.
 Identities = 143/156 (92%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+ VSA+LYEKRFGPYFCQPVIAGLGDEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANHVSALLYEKRFGPYFCQPVIAGLGDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACE+MFK D
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACESMFKED  156



>gb|EPS70809.1| proteasome subunit beta type, partial [Genlisea aurea]
Length=204

 Score =   300 bits (767),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            + IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT++TDF++IY IH KLF+GL+GLATD 
Sbjct  1    LQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTISTDFQKIYTIHDKLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLY+LREER+MKPETFASLVS+ILYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYELREERNMKPETFASLVSSILYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACE+MFKPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACESMFKPD  156



>dbj|BAJ98022.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ95982.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   300 bits (767),  Expect = 5e-100, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG+ D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGENDQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_006359316.1| PREDICTED: proteasome subunit beta type-3-A-like [Solanum tuberosum]
Length=204

 Score =   299 bits (766),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRR GVQLQT+ATDF+RIYKIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRFGVQLQTIATDFQRIYKIHEKLFIGLSGLATDT  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL QRL+FRHKLY+LRE+RDMKPETFASLVSA+LYEKRFGPY CQPVIAGLGD+DKPFI
Sbjct  61   QTLQQRLMFRHKLYELREDRDMKPETFASLVSAMLYEKRFGPYLCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_007161473.1| hypothetical protein PHAVU_001G072000g [Phaseolus vulgaris]
 gb|ESW33467.1| hypothetical protein PHAVU_001G072000g [Phaseolus vulgaris]
Length=204

 Score =   299 bits (766),  Expect = 6e-100, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH KLF+ L+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKLFIALSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL QRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLNQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+MFKPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMFKPD  156



>ref|XP_009379033.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009379034.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009347267.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
 ref|XP_009347269.1| PREDICTED: proteasome subunit beta type-3-A-like [Pyrus x bretschneideri]
Length=204

 Score =   299 bits (766),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 142/156 (91%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLSDEDRPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_009103286.1| PREDICTED: proteasome subunit beta type-3-A-like [Brassica rapa]
Length=204

 Score =   299 bits (766),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M IFEYNGSA+VAM GKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+GL+GLATDV
Sbjct  1    MQIFEYNGSAVVAMGGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>ref|XP_004236827.1| PREDICTED: proteasome subunit beta type-3-A [Solanum lycopersicum]
Length=204

 Score =   299 bits (766),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRR GVQLQT+ATDF+RIYKIH KLF+GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRFGVQLQTIATDFQRIYKIHDKLFIGLSGLATDT  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL+QRL+FRHKLY+LRE+RDMKPETFASLVSA+LYEKRFGPY CQPVIAGLG++DKPFI
Sbjct  61   QTLHQRLMFRHKLYELREDRDMKPETFASLVSAMLYEKRFGPYLCQPVIAGLGEDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVV+GTASESLYGACEAM+KPD
Sbjct  121  CTMDSIGAKELAKDFVVSGTASESLYGACEAMYKPD  156



>gb|EMT19931.1| Proteasome subunit beta type-3 [Aegilops tauschii]
Length=204

 Score =   299 bits (766),  Expect = 7e-100, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL F+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++D+PFI
Sbjct  61   QTLYQRLAFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEKDQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_003570772.1| PREDICTED: proteasome subunit beta type-3-like [Brachypodium 
distachyon]
 ref|XP_010233916.1| PREDICTED: proteasome subunit beta type-3-like [Brachypodium 
distachyon]
Length=204

 Score =   299 bits (765),  Expect = 9e-100, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKVHEKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLGD D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGDNDQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_002438734.1| hypothetical protein SORBIDRAFT_10g025190 [Sorghum bicolor]
 gb|EER90101.1| hypothetical protein SORBIDRAFT_10g025190 [Sorghum bicolor]
Length=204

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_003563301.1| PREDICTED: proteasome subunit beta type-3 [Brachypodium distachyon]
Length=204

 Score =   299 bits (765),  Expect = 1e-99, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 154/156 (99%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL+LGL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVF+HKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++++PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEDNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_002453412.1| hypothetical protein SORBIDRAFT_04g005590 [Sorghum bicolor]
 gb|EES06388.1| hypothetical protein SORBIDRAFT_04g005590 [Sorghum bicolor]
Length=204

 Score =   298 bits (763),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD ++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_002300970.2| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
 gb|EEE80243.2| Proteasome subunit beta type 3-2 family protein [Populus trichocarpa]
Length=204

 Score =   298 bits (762),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKLFVGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGL D+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPVIAGLDDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPD
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPD  156



>ref|XP_008649041.1| PREDICTED: proteasome subunit beta type-3 [Zea mays]
 gb|AFW76218.1| hypothetical protein ZEAMMB73_756098 [Zea mays]
Length=204

 Score =   298 bits (762),  Expect = 2e-99, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_010929114.1| PREDICTED: proteasome subunit beta type-3 [Elaeis guineensis]
Length=204

 Score =   297 bits (761),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>gb|ABK95590.1| unknown [Populus trichocarpa]
Length=204

 Score =   297 bits (761),  Expect = 4e-99, Method: Compositional matrix adjust.
 Identities = 140/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KLF+GL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHDKLFVGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHK+YQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGL D+DKPFI
Sbjct  61   QTLYQRLVFRHKMYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPVIAGLDDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPD
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPD  156



>ref|XP_008347744.1| PREDICTED: proteasome subunit beta type-3-A-like [Malus domestica]
Length=204

 Score =   297 bits (760),  Expect = 5e-99, Method: Compositional matrix adjust.
 Identities = 141/156 (90%), Positives = 149/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFKRISQVHDRLFIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFTQPVIAGLSDEDRPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CT DSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTTDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_010942147.1| PREDICTED: proteasome subunit beta type-3 [Elaeis guineensis]
Length=204

 Score =   297 bits (760),  Expect = 6e-99, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_008806302.1| PREDICTED: proteasome subunit beta type-3 [Phoenix dactylifera]
Length=204

 Score =   296 bits (759),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+  PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDSVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>dbj|BAJ87014.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=204

 Score =   296 bits (759),  Expect = 7e-99, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVF+HKLYQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFI
Sbjct  61   QTLYQRLVFKHKLYQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_009417439.1| PREDICTED: proteasome subunit beta type-3 [Musa acuminata subsp. 
malaccensis]
Length=204

 Score =   296 bits (757),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGV LQTVATDF+RI+KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVNLQTVATDFQRIFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QT+YQRLVFRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLGD+D PFI
Sbjct  61   QTMYQRLVFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGDDDVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>dbj|BAD25149.1| Proteasome subunit beta type 3 [Oryza sativa Japonica Group]
 dbj|BAH01224.1| unnamed protein product [Oryza sativa Japonica Group]
Length=204

 Score =   296 bits (757),  Expect = 1e-98, Method: Compositional matrix adjust.
 Identities = 137/155 (88%), Positives = 150/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKP+ FASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQAFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKP  568
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKP  155



>ref|XP_008784796.1| PREDICTED: proteasome subunit beta type-3 [Phoenix dactylifera]
Length=204

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 137/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI+KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRIFKIHDKLYVGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL FRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLAFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>gb|AFW87307.1| proteasome subunit beta type [Zea mays]
Length=204

 Score =   296 bits (757),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 135/156 (87%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|NP_001058176.1| Os06g0643100 [Oryza sativa Japonica Group]
 sp|Q9LST7.1|PSB3_ORYSJ RecName: Full=Proteasome subunit beta type-3; AltName: Full=20S 
proteasome alpha subunit C; AltName: Full=20S proteasome 
subunit beta-3 [Oryza sativa Japonica Group]
 dbj|BAA96836.1| beta 3 subunit of 20S proteasome [Oryza sativa Japonica Group]
 dbj|BAD37365.1| 20S proteasome subunit beta type 3 [Oryza sativa Japonica Group]
 dbj|BAF20090.1| Os06g0643100 [Oryza sativa Japonica Group]
 gb|EEC81061.1| hypothetical protein OsI_23870 [Oryza sativa Indica Group]
 gb|EEE66098.1| hypothetical protein OsJ_22127 [Oryza sativa Japonica Group]
Length=204

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLG++++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGEDNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_009394944.1| PREDICTED: proteasome subunit beta type-3-like [Musa acuminata 
subsp. malaccensis]
Length=204

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQT+ATDF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVNLQTIATDFQRIFKIHDKLYIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKP+TFASLVSA+LYEKRFGPYFC PVIAGLGD+D PFI
Sbjct  61   QTLYQRLIFRHKLYQLREERDMKPQTFASLVSALLYEKRFGPYFCMPVIAGLGDDDAPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|NP_001140276.1| uncharacterized protein LOC100272320 [Zea mays]
 gb|ACF83488.1| unknown [Zea mays]
Length=204

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFRRVFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQL EERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLMEERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  156



>ref|XP_003608106.1| Proteasome subunit beta type [Medicago truncatula]
 gb|AES90303.1| proteasome beta type-3 subunit [Medicago truncatula]
 gb|AFK36937.1| unknown [Medicago truncatula]
Length=204

 Score =   295 bits (756),  Expect = 2e-98, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            M+IF++NGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH KL++GL+GLATD 
Sbjct  1    MTIFKHNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDKLYIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREE DMKPETFASLVSA+ YEKRFGPYFCQPVIAGLGD+DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREELDMKPETFASLVSAMQYEKRFGPYFCQPVIAGLGDDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD+IGAKELAKDFVVAGTASESLYGACE+MFKPD
Sbjct  121  CTMDAIGAKELAKDFVVAGTASESLYGACESMFKPD  156



>gb|EMS62704.1| Proteasome subunit beta type-3 [Triticum urartu]
Length=204

 Score =   295 bits (755),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL F+HKLYQLR ERDMKPETFASLVSA+LYEKRFGPYFCQP+IAGLG++D+PFI
Sbjct  61   QTLYQRLGFKHKLYQLRGERDMKPETFASLVSALLYEKRFGPYFCQPIIAGLGEKDQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_010095417.1| Proteasome subunit beta type-3-A [Morus notabilis]
 gb|EXB60109.1| Proteasome subunit beta type-3-A [Morus notabilis]
Length=693

 Score =   311 bits (796),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 146/156 (94%), Positives = 153/156 (98%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF++IYKIH +L+LGL+GLATD 
Sbjct  1    MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQKIYKIHDRLYLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSAVLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_006648378.1| PREDICTED: proteasome subunit beta type-3-like [Oryza brachyantha]
Length=204

 Score =   295 bits (755),  Expect = 3e-98, Method: Compositional matrix adjust.
 Identities = 135/155 (87%), Positives = 151/155 (97%), Gaps = 0/155 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKP+TFASLVSA+LYE+RFGPYFCQPVIAGLGD D+PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPQTFASLVSALLYERRFGPYFCQPVIAGLGDNDEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKP  568
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKP  155



>ref|NP_001141963.1| uncharacterized protein LOC100274112 [Zea mays]
 gb|ACF87384.1| unknown [Zea mays]
Length=204

 Score =   295 bits (754),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD++ PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M++P+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYRPN  156



>ref|XP_004290891.1| PREDICTED: proteasome subunit beta type-3-A [Fragaria vesca subsp. 
vesca]
Length=204

 Score =   295 bits (754),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 138/156 (88%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNG A++AMVGKNCFAIASDRRLGVQLQT+ATDF++IY++  +LFLGL+GLATD 
Sbjct  1    MSIFEYNGGAIIAMVGKNCFAIASDRRLGVQLQTIATDFKKIYRVSDRLFLGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL+QRL+F+HKLYQLREERDMKPETFASLVSAILYEKRFGPYF QPVIAGLGD DKPFI
Sbjct  61   QTLFQRLMFKHKLYQLREERDMKPETFASLVSAILYEKRFGPYFIQPVIAGLGDGDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD
Sbjct  121  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  156



>ref|XP_004951671.1| PREDICTED: proteasome subunit beta type-3-like [Setaria italica]
Length=204

 Score =   295 bits (754),  Expect = 5e-98, Method: Compositional matrix adjust.
 Identities = 134/156 (86%), Positives = 152/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF+R++K+H KL++GL+GLATD 
Sbjct  1    MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKVHDKLYIGLSGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLG+ ++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGENNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GT+SESLYGACE+M+KP+
Sbjct  121  CTMDCIGAKELAKDFVVSGTSSESLYGACESMYKPN  156



>gb|AFW70451.1| proteasome subunit beta type [Zea mays]
Length=305

 Score =   298 bits (763),  Expect = 6e-98, Method: Compositional matrix adjust.
 Identities = 136/156 (87%), Positives = 150/156 (96%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGVQLQT+ATDF R++K+H KL++GL+GLATD 
Sbjct  102  MSIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTIATDFRRVFKVHDKLYIGLSGLATDA  161

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQL EERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD D+PFI
Sbjct  162  QTLYQRLVFRHKLYQLMEERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDNDEPFI  221

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  222  CTMDCIGAKELAKDFVVSGTASESLYGACESMYKPN  257



>gb|EAY84744.1| hypothetical protein OsI_06114 [Oryza sativa Indica Group]
 gb|EAZ21982.1| hypothetical protein OsJ_05637 [Oryza sativa Japonica Group]
Length=213

 Score =   293 bits (749),  Expect = 3e-97, Method: Compositional matrix adjust.
 Identities = 135/157 (86%), Positives = 150/157 (96%), Gaps = 0/157 (0%)
 Frame = +2

Query  98   LRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLAT  277
            + + IFEYNGSA+VAMVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLAT
Sbjct  8    VSLQIFEYNGSAVVAMVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLAT  67

Query  278  DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKP  457
            D QTLYQRLVFRHKLYQLREERDMKP+ FASLVSA+LYEKRFGPYFCQPVIAGLGD D+P
Sbjct  68   DAQTLYQRLVFRHKLYQLREERDMKPQAFASLVSALLYEKRFGPYFCQPVIAGLGDNDEP  127

Query  458  FICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKP  568
            FICTMD IGAKELAKDFVV+GTASESLYGACE+M+KP
Sbjct  128  FICTMDCIGAKELAKDFVVSGTASESLYGACESMYKP  164



>ref|XP_004965763.1| PREDICTED: proteasome subunit beta type-3-like [Setaria italica]
Length=204

 Score =   290 bits (743),  Expect = 2e-96, Method: Compositional matrix adjust.
 Identities = 132/156 (85%), Positives = 151/156 (97%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA++AMVGKNCFAIASDRRLGVQLQT+ATDF+R++KIH KL++GL+GL TD 
Sbjct  1    MSIFEYNGSAVMAMVGKNCFAIASDRRLGVQLQTIATDFQRVFKIHDKLYIGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPY CQPVIAGLG++++PFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYLCQPVIAGLGEDNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD +GAKELAKDFVV+GTASESLYGACE+M+KP+
Sbjct  121  CTMDCLGAKELAKDFVVSGTASESLYGACESMYKPN  156



>gb|KJB64504.1| hypothetical protein B456_010G052100 [Gossypium raimondii]
Length=191

 Score =   280 bits (717),  Expect = 1e-92, Method: Compositional matrix adjust.
 Identities = 133/143 (93%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LFLGL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFLGLSGLATDAQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVVAGTASESLYGACE+MFK +
Sbjct  121  DFVVAGTASESLYGACESMFKEN  143



>emb|CDY38347.1| BnaA02g18400D [Brassica napus]
Length=191

 Score =   280 bits (716),  Expect = 2e-92, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFKRISKIHDRLFIGLSGLATDVQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACEAM+KPD
Sbjct  121  DFVVSGTASESLYGACEAMYKPD  143



>gb|AAG51672.1|AC010704_16 putative 20S proteasome beta subunit PBC2; 7006-8626 [Arabidopsis 
thaliana]
Length=191

 Score =   279 bits (713),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH  LF+GL+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDHLFIGLSGLATDVQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSAILYEKRFGP+ CQPVIAGLGD++KPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPFLCQPVIAGLGDDNKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACEAMFKPD
Sbjct  121  DFVVSGTASESLYGACEAMFKPD  143



>gb|KJB59985.1| hypothetical protein B456_009G283900 [Gossypium raimondii]
Length=191

 Score =   279 bits (713),  Expect = 4e-92, Method: Compositional matrix adjust.
 Identities = 131/143 (92%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++FLGL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFLGLSGLATDAQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFA+LVSA+LYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFANLVSALLYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVVAGTASESLYGACE+MFK D
Sbjct  121  DFVVAGTASESLYGACESMFKED  143



>emb|CDY67773.1| BnaAnng25130D [Brassica napus]
Length=191

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 129/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDVQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG++DKPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDDKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACEAM+KPD
Sbjct  121  DFVVSGTASESLYGACEAMYKPD  143



>ref|XP_011027490.1| PREDICTED: proteasome subunit beta type-3-A [Populus euphratica]
Length=204

 Score =   277 bits (709),  Expect = 2e-91, Method: Compositional matrix adjust.
 Identities = 139/156 (89%), Positives = 147/156 (94%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAMVGKNCFAIASDRRLGV LQTVATDF+RIYKIH KL LGL+GL TD 
Sbjct  1    MSIFEYNGSAIVAMVGKNCFAIASDRRLGVNLQTVATDFQRIYKIHHKLLLGLSGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFA+LVSA+LYEKRFGPYFCQP+IAGL  +DKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFANLVSAVLYEKRFGPYFCQPIIAGLDGDDKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMD IGAKELAKDFVVAG+ASESLYGACEA FKPD
Sbjct  121  CTMDFIGAKELAKDFVVAGSASESLYGACEAFFKPD  156



>emb|CDY71260.1| BnaAnng36740D [Brassica napus]
Length=191

 Score =   276 bits (705),  Expect = 8e-91, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 139/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH ++F+ L+GLATDVQTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRVFIALSGLATDVQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSAILYEKRFGPY CQPVIAGLG+++KPFICTMDSIGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSAILYEKRFGPYLCQPVIAGLGEDEKPFICTMDSIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACEAM+KPD
Sbjct  121  DFVVSGTASESLYGACEAMYKPD  143



>gb|AEC11048.1| 20S proteasome beta subunit pbc2, partial [Camellia sinensis]
Length=187

 Score =   275 bits (704),  Expect = 1e-90, Method: Compositional matrix adjust.
 Identities = 129/139 (93%), Positives = 136/139 (98%), Gaps = 0/139 (0%)
 Frame = +2

Query  155  NCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKLYQLR  334
            NCFAIASDRRLGVQLQT+ATDF+RIYKIH KL +GLAGLATD QT+YQRLVFRHKLYQLR
Sbjct  1    NCFAIASDRRLGVQLQTIATDFQRIYKIHDKLSIGLAGLATDSQTMYQRLVFRHKLYQLR  60

Query  335  EERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAKDFVV  514
            EERDMKP+TFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFICTMDSIGAKELAKDFVV
Sbjct  61   EERDMKPQTFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFICTMDSIGAKELAKDFVV  120

Query  515  AGTASESLYGACEAMFKPD  571
            AGTASESLYGACEAMFKPD
Sbjct  121  AGTASESLYGACEAMFKPD  139



>ref|XP_001770816.1| predicted protein [Physcomitrella patens]
 gb|EDQ64340.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   275 bits (703),  Expect = 2e-90, Method: Compositional matrix adjust.
 Identities = 126/156 (81%), Positives = 144/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSAL+AMVGKNCFAIASDRRLGV  QT+A DF+RI+KIH KL++GL+GLATDV
Sbjct  1    MSITSYNGSALIAMVGKNCFAIASDRRLGVNFQTIACDFQRIFKIHDKLYIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QT++QRL FRHKLYQLREER+M+PETFASLVSAILYEKRFGPYFC+P+IAGL D+  PFI
Sbjct  61   QTMHQRLQFRHKLYQLREERNMRPETFASLVSAILYEKRFGPYFCEPIIAGLNDDGTPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CT D IGAK+LAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTTDLIGAKQLAKDFVVSGTASESLYGACESMYKPD  156



>gb|AGV54396.1| proteasome subunit beta type-3-A isoform 1 [Phaseolus vulgaris]
Length=208

 Score =   274 bits (700),  Expect = 7e-90, Method: Compositional matrix adjust.
 Identities = 128/143 (90%), Positives = 138/143 (97%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQT+ATDF+RI++IH KLF+ L+GLATD QTL QRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTIATDFQRIFRIHDKLFIALSGLATDAQTLNQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGLGD+DKPFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLGDDDKPFICTMDCIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACE+MFKPD
Sbjct  121  DFVVSGTASESLYGACESMFKPD  143



>gb|EMT12457.1| Proteasome subunit beta type-3 [Aegilops tauschii]
Length=176

 Score =   271 bits (694),  Expect = 2e-89, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D QTLYQRLVF+HKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDAQTLYQRLVFKHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFICTMDCIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACE+M+KP+
Sbjct  121  DFVVSGTASESLYGACESMYKPN  143



>gb|EMS47536.1| Proteasome subunit beta type-3 [Triticum urartu]
Length=191

 Score =   271 bits (694),  Expect = 3e-89, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIHGKL++GL+GLA+D QTLYQRLVF+HKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHGKLYIGLSGLASDAQTLYQRLVFKHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKPETFASLVS++LYEKRFGPYFCQP+IAGLG +D+PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPETFASLVSSMLYEKRFGPYFCQPIIAGLGQDDEPFICTMDCIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACE+M+KP+
Sbjct  121  DFVVSGTASESLYGACESMYKPN  143



>ref|XP_006656285.1| PREDICTED: proteasome subunit beta type-3-like [Oryza brachyantha]
Length=191

 Score =   270 bits (691),  Expect = 9e-89, Method: Compositional matrix adjust.
 Identities = 123/143 (86%), Positives = 140/143 (98%), Gaps = 0/143 (0%)
 Frame = +2

Query  143  MVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQRLVFRHKL  322
            MVGKNCFAIASDRRLGVQLQTVATDF+R++KIH KL++GL+GLATD QTLYQRLVFRHKL
Sbjct  1    MVGKNCFAIASDRRLGVQLQTVATDFQRVFKIHDKLYIGLSGLATDAQTLYQRLVFRHKL  60

Query  323  YQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSIGAKELAK  502
            YQLREERDMKP+TFASLVSA+LYE+RFGPYFCQPVIAGLG++++PFICTMD IGAKELAK
Sbjct  61   YQLREERDMKPQTFASLVSALLYERRFGPYFCQPVIAGLGEDNEPFICTMDCIGAKELAK  120

Query  503  DFVVAGTASESLYGACEAMFKPD  571
            DFVV+GTASESLYGACE+M+KP+
Sbjct  121  DFVVSGTASESLYGACESMYKPN  143



>ref|XP_001771449.1| predicted protein [Physcomitrella patens]
 gb|EDQ63649.1| predicted protein [Physcomitrella patens]
Length=204

 Score =   270 bits (690),  Expect = 2e-88, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSAL+AMVGK+CFAIASDRRLGV  QT+A DF+RI+KIH  L++GL+GLATDV
Sbjct  1    MSITSYNGSALIAMVGKDCFAIASDRRLGVNFQTIACDFQRIFKIHDHLYIGLSGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QT++QRL FRHKLYQLREER+M+PETFASLVSA+LYEKRFGPYFC+P+IAGL D+  PFI
Sbjct  61   QTMHQRLNFRHKLYQLREERNMRPETFASLVSAMLYEKRFGPYFCEPIIAGLNDDGTPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CT D IGAK+LAKDFVV+GTASESLYGACE+M+KPD
Sbjct  121  CTTDLIGAKQLAKDFVVSGTASESLYGACESMYKPD  156



>ref|XP_002965476.1| hypothetical protein SELMODRAFT_266913 [Selaginella moellendorffii]
 ref|XP_002993203.1| hypothetical protein SELMODRAFT_272317 [Selaginella moellendorffii]
 gb|EFJ05723.1| hypothetical protein SELMODRAFT_272317 [Selaginella moellendorffii]
 gb|EFJ32896.1| hypothetical protein SELMODRAFT_266913 [Selaginella moellendorffii]
Length=204

 Score =   268 bits (685),  Expect = 1e-87, Method: Compositional matrix adjust.
 Identities = 123/156 (79%), Positives = 143/156 (92%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIF YNGSALVAMVGK+CFAIASDRRLGV  QT+ATDF+RI+KIH KL++GLAGLA+DV
Sbjct  1    MSIFTYNGSALVAMVGKDCFAIASDRRLGVNFQTIATDFQRIFKIHDKLYVGLAGLASDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL +RH L+QL+EERDM+PETF++ VSA LYEKRFGPYF QP+IAGLG ++KP+I
Sbjct  61   QTLYQRLKYRHNLFQLQEERDMRPETFSNFVSATLYEKRFGPYFVQPLIAGLGADNKPYI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            CTMDSIGA E +KDFVV GTASESLYGACE+M+KPD
Sbjct  121  CTMDSIGAIEHSKDFVVGGTASESLYGACESMYKPD  156



>ref|XP_008219607.1| PREDICTED: proteasome subunit beta type-3-A-like [Prunus mume]
Length=129

 Score =   249 bits (635),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 115/129 (89%), Positives = 125/129 (97%), Gaps = 0/129 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSAL+AMVGKNCFAIASDRRLGVQLQTVATDF+RI ++H +LF+G++GLATD 
Sbjct  1    MSIFEYNGSALIAMVGKNCFAIASDRRLGVQLQTVATDFKRINQVHDRLFIGISGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRL+FRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL DED+PFI
Sbjct  61   QTLYQRLMFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLSDEDRPFI  120

Query  464  CTMDSIGAK  490
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>gb|KDO80554.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=181

 Score =   251 bits (640),  Expect = 4e-81, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAK  490
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>gb|KDO80557.1| hypothetical protein CISIN_1g028737mg [Citrus sinensis]
Length=167

 Score =   248 bits (634),  Expect = 2e-80, Method: Compositional matrix adjust.
 Identities = 118/129 (91%), Positives = 124/129 (96%), Gaps = 0/129 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSALVAMVGKNCFAIASDRRLGVQLQT+ATDF+RI KIH +LF+GL+GLATD 
Sbjct  1    MSITEYNGSALVAMVGKNCFAIASDRRLGVQLQTIATDFQRISKIHDRLFIGLSGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQRLVFRHKLYQLREERDMKPETFASLVSA+LYEKRFGPYFCQPVIAGL DEDKPFI
Sbjct  61   QTLYQRLVFRHKLYQLREERDMKPETFASLVSALLYEKRFGPYFCQPVIAGLSDEDKPFI  120

Query  464  CTMDSIGAK  490
            CTMDSIGAK
Sbjct  121  CTMDSIGAK  129



>ref|XP_005850127.1| hypothetical protein CHLNCDRAFT_48590 [Chlorella variabilis]
 gb|EFN58025.1| hypothetical protein CHLNCDRAFT_48590 [Chlorella variabilis]
Length=204

 Score =   237 bits (604),  Expect = 2e-75, Method: Compositional matrix adjust.
 Identities = 106/156 (68%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNGSA+VAM GK C AI SD R GVQLQT+ATD++++YKIH +LF+GLAGL TD 
Sbjct  1    MSIFEYNGSAIVAMAGKECVAIGSDLRFGVQLQTLATDYKKVYKIHDQLFIGLAGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            +TL QR  F+H LY+LREERD+KP  F  LVSA LYE+RFGPYFCQPVIAGL  +  P++
Sbjct  61   ETLSQRFAFKHNLYKLREERDIKPSAFGQLVSATLYERRFGPYFCQPVIAGLEPDGSPYL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MDSIGA+E AKDF+VAGTA++SL G CE++++PD
Sbjct  121  CGMDSIGAQETAKDFMVAGTATDSLLGICESLWRPD  156



>ref|XP_005646581.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
 gb|EIE22037.1| N-terminal nucleophile aminohydrolase [Coccomyxa subellipsoidea 
C-169]
Length=205

 Score =   234 bits (597),  Expect = 3e-74, Method: Compositional matrix adjust.
 Identities = 107/157 (68%), Positives = 131/157 (83%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIFEYNG+A+VAM GK C AI SD R GVQ QT+ATD++++YKIH KLF+GLAGL TD 
Sbjct  1    MSIFEYNGAAIVAMAGKECVAIGSDLRFGVQFQTLATDYKKVYKIHDKLFIGLAGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  460
            QT++Q+L FRH LY+LREER++KP TF  LVS++LYEKRFGPYF  PVIAGL D+ + P+
Sbjct  61   QTMHQKLKFRHNLYKLREERNIKPSTFGELVSSMLYEKRFGPYFVSPVIAGLEDKTNVPY  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD+IGA E A DF+VAGTA +SLYG CE+MF+PD
Sbjct  121  ICGMDTIGAIETANDFMVAGTAPDSLYGMCESMFRPD  157



>ref|XP_011401184.1| Proteasome subunit beta type-3 [Auxenochlorella protothecoides]
 gb|KFM28171.1| Proteasome subunit beta type-3 [Auxenochlorella protothecoides]
Length=216

 Score =   231 bits (590),  Expect = 4e-73, Method: Compositional matrix adjust.
 Identities = 105/154 (68%), Positives = 129/154 (84%), Gaps = 0/154 (0%)
 Frame = +2

Query  110  IFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQT  289
            IFEYNGSA++AM GK C AIASD R GVQLQT+ATD +++YKIH +LFLGL+GLA+D +T
Sbjct  15   IFEYNGSAIIAMAGKECVAIASDLRFGVQLQTLATDHKKVYKIHDQLFLGLSGLASDAET  74

Query  290  LYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICT  469
            L QR  F+H LY+LREERD+KP  FA LVSA LYEKRFGPYFCQPVIAGL  +  P++C 
Sbjct  75   LSQRFKFKHTLYKLREERDIKPSAFAQLVSATLYEKRFGPYFCQPVIAGLEPDGTPYLCG  134

Query  470  MDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            MDSIGA E AKDF++AGTAS++L G CE++++PD
Sbjct  135  MDSIGAIETAKDFMIAGTASDALLGICESLWRPD  168



>gb|KIY94892.1| hypothetical protein MNEG_13071 [Monoraphidium neglectum]
Length=205

 Score =   230 bits (587),  Expect = 9e-73, Method: Compositional matrix adjust.
 Identities = 100/156 (64%), Positives = 130/156 (83%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI+ YNG+A++AM GK+C AI SD R GVQLQT+ TD++++++IH +LF+GL GLATD 
Sbjct  1    MSIYTYNGAAIIAMAGKDCVAIGSDLRFGVQLQTMTTDYKKVFQIHDRLFVGLGGLATDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL++RLVFRH +Y+LREERDMK  TF +L+S++LYEKRFGPYF  PV+AGL  + KPF+
Sbjct  61   QTLFERLVFRHNMYKLREERDMKASTFGNLLSSMLYEKRFGPYFASPVVAGLEPDGKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MDSIGA E A DF+V GT SESL+G CE+M++PD
Sbjct  121  CGMDSIGALETAADFIVTGTNSESLFGMCESMWRPD  156



>ref|XP_001696254.1| hypothetical protein CHLREDRAFT_187099 [Chlamydomonas reinhardtii]
 gb|EDP08231.1| predicted protein [Chlamydomonas reinhardtii]
Length=204

 Score =   219 bits (559),  Expect = 1e-68, Method: Compositional matrix adjust.
 Identities = 98/156 (63%), Positives = 122/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIF YNG+A+VAM GK C AI SD R GVQLQT+  D  ++YKIH KL+LGL+GL TD 
Sbjct  1    MSIFSYNGAAIVAMAGKECVAIGSDLRFGVQLQTMTCDTPKVYKIHDKLYLGLSGLQTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL+Q+L FRH LY+LREERDMKP TF  ++S  LYE+RFGPYF  PV+AGL  +  P++
Sbjct  61   TTLHQKLQFRHNLYKLREERDMKPSTFGHMLSNALYERRFGPYFAAPVVAGLEPDGTPYL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MD+IGA E AKDF++ GT+ ESLYG CE+M++PD
Sbjct  121  CGMDTIGAIESAKDFMITGTSPESLYGMCESMWRPD  156



>ref|XP_002946290.1| hypothetical protein VOLCADRAFT_78969 [Volvox carteri f. nagariensis]
 gb|EFJ53285.1| hypothetical protein VOLCADRAFT_78969 [Volvox carteri f. nagariensis]
Length=204

 Score =   218 bits (556),  Expect = 3e-68, Method: Compositional matrix adjust.
 Identities = 97/156 (62%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSIF YNGSA+VAM GK C AI SD R GVQ QT++ D  +++KIH KL+LGL+GL TD 
Sbjct  1    MSIFSYNGSAIVAMAGKECVAIGSDLRFGVQYQTISCDTPKVFKIHDKLYLGLSGLLTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL+Q+L+FRH LY+LREERDMKP TF  ++S  LYE+RFGPYF  PV+AGL  +  P++
Sbjct  61   QTLHQKLLFRHNLYKLREERDMKPSTFGHMLSNALYERRFGPYFAAPVVAGLEPDGTPYL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              MD+IGA E AKDF++ GT+ ESLYG CE+M++PD
Sbjct  121  SGMDTIGAIETAKDFMIGGTSPESLYGMCESMWRPD  156



>gb|EJK68962.1| hypothetical protein THAOC_09830 [Thalassiosira oceanica]
Length=204

 Score =   218 bits (556),  Expect = 4e-68, Method: Compositional matrix adjust.
 Identities = 99/156 (63%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AM GK+C AIASD RLG+  QTVA DF++++K++ +L +GLAGLATDV
Sbjct  1    MSILEYNGAAIIAMAGKDCVAIASDNRLGISYQTVAMDFKKVFKMNDRLMVGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL Q L FR  LY+LREER+M PE F +L+S +LYEKRFGPYFC+PVIAGL  + KPF+
Sbjct  61   QTLDQLLRFRMNLYELREEREMTPEVFTNLMSNMLYEKRFGPYFCEPVIAGLDPKGKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             TMD IGA+ +AKDF VAGT   ++YG CE ++KPD
Sbjct  121  GTMDLIGAQAMAKDFCVAGTCDGNMYGMCETLWKPD  156



>ref|XP_002679261.1| predicted protein [Naegleria gruberi]
 gb|EFC46517.1| predicted protein [Naegleria gruberi]
Length=205

 Score =   217 bits (552),  Expect = 2e-67, Method: Compositional matrix adjust.
 Identities = 99/157 (63%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+ +VAM GKNC AIA+D R G++ QTV TD ++I+KIH KLF+GL GLATDV
Sbjct  1    MSILEYNGAGIVAMTGKNCVAIAADTRYGIRQQTVGTDMQKIFKIHDKLFIGLNGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  460
            QT+ ++L FR  +Y L+EERD+KP +FA+L+S ILYEKRFGP+F +PVIAGL G E+KPF
Sbjct  61   QTVNEKLKFRMNMYNLKEERDIKPSSFANLMSNILYEKRFGPWFIEPVIAGLEGPENKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC  D IGA     +FVV+GT SE+LYG CE+++KPD
Sbjct  121  ICAQDLIGAPCFTDNFVVSGTCSEALYGMCESLYKPD  157



>emb|CEI98111.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=189

 Score =   214 bits (546),  Expect = 6e-67, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GLAGLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFKKIFKASEKTFIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  F+  +Y++REERD++P+TFA +VS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREERDVEPKTFAHMVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD IG    AKDFVVAGTA  +LYG CE++++PD
Sbjct  121  CSMDLIGCINFAKDFVVAGTAGPNLYGMCESLWEPD  156



>emb|CEG65349.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
 emb|CEI90725.1| Putative Proteasome subunit beta type [Rhizopus microsporus]
Length=204

 Score =   215 bits (547),  Expect = 1e-66, Method: Compositional matrix adjust.
 Identities = 96/156 (62%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GLAGLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFKKIFKASEKTFIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  F+  +Y++REERD++P+TFA +VS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREERDVEPKTFAHMVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD IG    AKDFVVAGTA  +LYG CE++++PD
Sbjct  121  CSMDLIGCINFAKDFVVAGTAGPNLYGMCESLWEPD  156



>gb|EWM23143.1| Proteasome, beta-type subunit, conserved site [Nannochloropsis 
gaditana]
Length=280

 Score =   214 bits (546),  Expect = 1e-65, Method: Compositional matrix adjust.
 Identities = 104/156 (67%), Positives = 125/156 (80%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI EYNG A+VAMVGKNC AIASD R GVQ QTVA +F +++K+  +LF+GL+GLATD+Q
Sbjct  77   SILEYNGGAVVAMVGKNCVAIASDLRYGVQAQTVACNFPKVHKMSDRLFVGLSGLATDIQ  136

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDK-PFI  463
            TL Q L FR  LY+LREERD+KPETF++L+S ILYEKRFGPYF +P++AGL  ED  PFI
Sbjct  137  TLEQLLRFRLNLYKLREERDIKPETFSALLSHILYEKRFGPYFVEPLVAGLRAEDNTPFI  196

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              MD IGA   AKDFVVAGT + +LYG CE+ FKPD
Sbjct  197  SGMDLIGAPVFAKDFVVAGTCAANLYGLCESFFKPD  232



>gb|KFB35883.1| hypothetical protein ZHAS_00002836 [Anopheles sinensis]
Length=205

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 96/157 (61%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE+I++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKIFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   L  DFVVAGT +E LYG CE ++KPD
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPD  157



>dbj|GAN06988.1| 20S proteasome subunit beta 3 [Mucor ambiguus]
Length=204

 Score =   209 bits (532),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++++K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKMFKASEKTFIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +P++AGLG ++KPFI
Sbjct  61   LTLADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPIVAGLGKDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MD IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  CAMDLIGCINFAKDFVVSGTAGSNLYGMCESLWEPD  156



>ref|XP_002297096.1| predicted protein [Thalassiosira pseudonana CCMP1335]
 gb|EED86564.1| predicted protein [Thalassiosira pseudonana CCMP1335]
Length=204

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AM GK+C  IASD R+G+  QTV+ DF++I++++ KLF+GLAGLA+DV
Sbjct  1    MSILEYNGAAIIAMSGKDCVGIASDNRMGISYQTVSMDFKKIFQMNEKLFVGLAGLASDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL Q L FR  LY+LREER+M P+ F +L+S +LYEKRFGPYF +PV+AGL + DKP++
Sbjct  61   QTLDQLLRFRMNLYELREEREMTPKVFTNLLSNMLYEKRFGPYFAEPVVAGLDENDKPYL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             TMD IGA    +DFVVAGT + +LYG CE ++K D
Sbjct  121  ATMDLIGATSSTEDFVVAGTCAGNLYGMCETLYKKD  156



>ref|XP_008877157.1| hypothetical protein, variant [Aphanomyces invadans]
 gb|ETV94396.1| hypothetical protein, variant [Aphanomyces invadans]
Length=189

 Score =   208 bits (529),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            Q++ Q L F+  +Y++REERDMK +T ++++S ++YEKRFGP+F +P++AGL D+++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREERDMKAKTLSAMISNMMYEKRFGPWFVEPIVAGLTDDNQPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G +   KD+V AGT  E+L+G CE++F+PD
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPD  156



>ref|XP_008877158.1| hypothetical protein H310_12029 [Aphanomyces invadans]
 gb|ETV94395.1| hypothetical protein H310_12029 [Aphanomyces invadans]
Length=204

 Score =   209 bits (531),  Expect = 2e-64, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            Q++ Q L F+  +Y++REERDMK +T ++++S ++YEKRFGP+F +P++AGL D+++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREERDMKAKTLSAMISNMMYEKRFGPWFVEPIVAGLTDDNQPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G +   KD+V AGT  E+L+G CE++F+PD
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPD  156



>ref|XP_002904370.1| proteasome subunit beta type-3, putative [Phytophthora infestans 
T30-4]
 ref|XP_008909009.1| hypothetical protein PPTG_14216 [Phytophthora parasitica INRA-310]
 gb|EEY54548.1| proteasome subunit beta type-3, putative [Phytophthora infestans 
T30-4]
 gb|ETI42173.1| hypothetical protein F443_12663 [Phytophthora parasitica P1569]
 gb|ETK82199.1| hypothetical protein L915_12386 [Phytophthora parasitica]
 gb|ETL88820.1| hypothetical protein L917_12140 [Phytophthora parasitica]
 gb|ETM42081.1| hypothetical protein L914_12222 [Phytophthora parasitica]
 gb|ETN05487.1| hypothetical protein PPTG_14216 [Phytophthora parasitica INRA-310]
 gb|ETO70792.1| hypothetical protein F444_12772 [Phytophthora parasitica P1976]
 gb|ETP11913.1| hypothetical protein F441_12625 [Phytophthora parasitica CJ01A1]
 gb|ETP40027.1| hypothetical protein F442_12574 [Phytophthora parasitica P10297]
Length=204

 Score =   208 bits (530),  Expect = 3e-64, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GK+C  IA D RLG+Q QTVA DF++++++  K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKDCVGIACDTRLGMQAQTVAMDFQKVFRVTDKTFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            Q++ Q L F+  +Y++ EERD+KP+T ++L+S ++YEKRFGP+F +PVIAGL +++KPF+
Sbjct  61   QSVSQLLKFKINMYKMNEERDIKPKTLSALLSNMMYEKRFGPWFVEPVIAGLTEDNKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G + + KDFVVAGT  E+LYG CE+M+KPD
Sbjct  121  SSMDCLGCEMMTKDFVVAGTMEEALYGMCESMYKPD  156



>emb|CEP10278.1| hypothetical protein [Parasitella parasitica]
Length=204

 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 92/156 (59%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKIFKASEKTFIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +PV+AGLG ++ PFI
Sbjct  61   LTLADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPVVAGLGKDNVPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MD IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  CAMDLIGCINFAKDFVVSGTAGSNLYGMCESLWEPD  156



>ref|XP_321394.2| AGAP001697-PA [Anopheles gambiae str. PEST]
 ref|XP_003435908.1| AGAP001697-PB [Anopheles gambiae str. PEST]
 gb|EAA00889.2| AGAP001697-PA [Anopheles gambiae str. PEST]
 gb|EGK97505.1| AGAP001697-PB [Anopheles gambiae str. PEST]
Length=205

 Score =   208 bits (529),  Expect = 4e-64, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   L  DFVVAGT +E LYG CE ++KPD
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPD  157



>ref|XP_001635037.1| predicted protein [Nematostella vectensis]
 gb|EDO42974.1| predicted protein [Nematostella vectensis]
Length=205

 Score =   208 bits (529),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 97/157 (62%), Positives = 126/157 (80%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AMVGKNC AIA+DRRLG+Q QTV+ DF++I+++  KLF+GL GLATDV
Sbjct  1    MSIMEYNGAAIIAMVGKNCVAIAADRRLGIQAQTVSCDFQKIFQMGEKLFVGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  460
            QT+  RL FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PVIAGL  + ++PF
Sbjct  61   QTISSRLKFRLNLYELREGRPIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTNEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I +MD IG     KDFVV+GT SE +YG CE+++ PD
Sbjct  121  ISSMDLIGCPMETKDFVVSGTCSEQMYGMCESLWVPD  157



>gb|AAT09074.1| proteasome beta subunit [Bigelowiella natans]
Length=204

 Score =   207 bits (528),  Expect = 5e-64, Method: Compositional matrix adjust.
 Identities = 95/156 (61%), Positives = 123/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNGSA+VAMVGK+C AIASD R G+Q QT+A D ++++++  KLF+GL+GL TDV
Sbjct  1    MSILQYNGSAIVAMVGKDCVAIASDMRYGIQQQTIACDMKKVFQMGDKLFIGLSGLLTDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL Q+  F+ K+Y LRE R M+P+ F+SLVS+ LYEKRFGPYF +PV+AGL  ++ PFI
Sbjct  61   QTLKQKFDFKLKMYSLRENRPMRPKVFSSLVSSTLYEKRFGPYFVEPVVAGLDAKEGPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              MD IGA   AKDFVV+GT S+ LYG CEA +KP+
Sbjct  121  AAMDLIGAPVFAKDFVVSGTTSDELYGVCEAFWKPN  156



>ref|XP_009536762.1| hypothetical protein PHYSODRAFT_288866 [Phytophthora sojae]
 gb|EGZ07196.1| hypothetical protein PHYSODRAFT_288866 [Phytophthora sojae]
Length=204

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 127/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GK+C  IA D RLG+Q QTVA DF++++++  K FLGLAGLATDV
Sbjct  1    MSILSYNGAAIIAMAGKDCVGIACDTRLGMQAQTVAMDFQKVFRVTDKTFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            Q++ Q L F+  +Y++ EER++KP+T ++L+S+++YEKRFGP+F +PVIAGL +++KPF+
Sbjct  61   QSVSQLLKFKLNMYKMNEEREIKPKTLSALLSSMMYEKRFGPWFVEPVIAGLTEDNKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G + + KDFVVAGT  E+LYG CE+M+KPD
Sbjct  121  SSMDCLGCEMMTKDFVVAGTMEEALYGMCESMYKPD  156



>gb|KDD73458.1| proteasome subunit protein, partial [Helicosporidium sp. ATCC 
50920]
Length=202

 Score =   207 bits (528),  Expect = 6e-64, Method: Compositional matrix adjust.
 Identities = 97/153 (63%), Positives = 119/153 (78%), Gaps = 0/153 (0%)
 Frame = +2

Query  110  IFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQT  289
            I EYNG A++AM GK C AIASD RLGVQLQ +ATD++++YKIH +LFLGL+GLATD  T
Sbjct  1    ISEYNGGAIIAMAGKECVAIASDLRLGVQLQHLATDYKKVYKIHDQLFLGLSGLATDATT  60

Query  290  LYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICT  469
            L     FR+ LY+LREERD+ P  FA LVS+ LY  RFG YFCQPVIAGL  +  P++C 
Sbjct  61   LSNLFKFRYNLYKLREERDISPPAFAQLVSSTLYSHRFGSYFCQPVIAGLQADGVPYLCG  120

Query  470  MDSIGAKELAKDFVVAGTASESLYGACEAMFKP  568
            MDSIGA E AKDF+VAGT+ +SL G CE+++KP
Sbjct  121  MDSIGAIETAKDFMVAGTSPDSLLGICESLWKP  153



>ref|XP_001651824.1| AAEL006174-PA [Aedes aegypti]
 gb|EAT42270.1| AAEL006174-PA [Aedes aegypti]
Length=205

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T++QRL+FR  LY++RE R+M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENREMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLNPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   +  DFVVAGT +E LYG CE ++KPD
Sbjct  121  ICNMDLIGCPNMPNDFVVAGTCAEQLYGMCETLWKPD  157



>gb|ETN62797.1| proteasome subunit beta type [Anopheles darlingi]
Length=205

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T+YQRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVYQRLIFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   L  DFVVAGT +E LYG CE ++KP+
Sbjct  121  ICNMDLIGCPNLPNDFVVAGTCAEQLYGMCETLWKPE  157



>gb|ABF18140.1| 20S proteasome regulatory subunit beta type PSMB3/PUP3 [Aedes 
aegypti]
Length=205

 Score =   207 bits (526),  Expect = 1e-63, Method: Compositional matrix adjust.
 Identities = 93/157 (59%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE++++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKVFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T++QRL+FR  LY++RE R+M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENREMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLNPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   +  DFVVAGT +E LYG CE ++KPD
Sbjct  121  ICNMDLIGCPNMPNDFVVAGTCAEQLYGMCETLWKPD  157



>emb|CCA14375.1| proteasome subunit beta type3 putative [Albugo laibachii Nc14]
Length=204

 Score =   206 bits (525),  Expect = 2e-63, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSA++AM GK+C  IA D RLG+Q QT++T+F++++++  K+FLGLAGLATDV
Sbjct  1    MSILSYNGSAIIAMAGKDCVGIACDTRLGLQAQTISTNFQKVFRVSDKIFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QT+ Q L F+  +Y++ EERD+KPET +S +SA++Y+KRFGP+F +PVIAGL  +++PF+
Sbjct  61   QTVSQLLKFKVNMYKMNEERDLKPETLSSYLSAMMYKKRFGPWFIEPVIAGLTADNQPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G +   KDFVVAGT  E+LYG CE+M++PD
Sbjct  121  SSMDCLGCEMKTKDFVVAGTMEEALYGMCESMYRPD  156



>emb|CDH60663.1| 20s proteasome subunit beta 3 [Lichtheimia corymbifera JMRC:FSU:9682]
Length=204

 Score =   205 bits (521),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 126/156 (81%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGKNC AIA+D+RLG Q  TV+T+F++I++   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKNCVAIAADKRLGQQFMTVSTEFQKIFRGAEKSFIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL +R  F+  +Y++REER+++P+T A +VS+ LYE+RFGPYF +PV+AGLG +++PFI
Sbjct  61   LTLAERFRFKINMYKMREEREIEPKTLAHMVSSTLYERRFGPYFVEPVVAGLGKDNQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPD  156



>ref|XP_002732675.1| PREDICTED: proteasome subunit beta type-3-like isoform X1 [Saccoglossus 
kowalevskii]
Length=205

 Score =   205 bits (521),  Expect = 8e-63, Method: Compositional matrix adjust.
 Identities = 95/157 (61%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSA+VAM GK+C AIA+DRR G+Q QTV+ DF++I+++  +L+LGL GLATDV
Sbjct  1    MSIMSYNGSAVVAMKGKDCVAIAADRRFGIQAQTVSMDFQKIFEMGPRLYLGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  460
            QT+  RL FR  LY LRE R +KP+TF S+VS +LYE+RFGPYF +P+IAGL  D  +PF
Sbjct  61   QTVSNRLKFRLNLYTLRENRKIKPKTFMSMVSNLLYERRFGPYFVEPIIAGLEPDTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVVAGT+SE LYG CE+++ PD
Sbjct  121  ICSLDLIGCPMVPEDFVVAGTSSEQLYGMCESLWLPD  157



>ref|XP_001843139.1| proteasome subunit beta type 3 [Culex quinquefasciatus]
 gb|EDS30763.1| proteasome subunit beta type 3 [Culex quinquefasciatus]
Length=205

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 118/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  +VAM GKNC AIA+D R GVQ QT+ATDFE+I++I+  ++LGL GL TD+
Sbjct  1    MSILAYNGGCVVAMKGKNCVAIATDHRFGVQAQTIATDFEKIFEINPHMYLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T++QRL+FR  LY++RE R M PE FA+++S  LYEKRFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHQRLLFRKNLYEVRENRQMTPERFAAMLSNFLYEKRFGPYFIEPVIAGLDPKSYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG      DFVVAGT +E LYG CE ++KPD
Sbjct  121  ICNMDLIGCPNKPNDFVVAGTCAEQLYGMCETLWKPD  157



>emb|CBJ32446.1| conserved unknown protein [Ectocarpus siliculosus]
Length=204

 Score =   204 bits (520),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AM GKNC  I SD RLG Q QTVATDFE+I+K+  KL +GL GLATDV
Sbjct  1    MSILEYNGAAILAMTGKNCVGICSDSRLGNQAQTVATDFEKIFKMGDKLMVGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             T+ + L FR  LY+LREER++KPETF++L+S ILY+KRFGPYF +P++AGL +++ PFI
Sbjct  61   ITMKELLTFRLNLYRLREEREIKPETFSALMSHILYQKRFGPYFVEPIVAGLKEDNTPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
               D IGA  +  DFVV GT + +LYG CE+ ++PD
Sbjct  121  SAFDLIGAPVVTDDFVVGGTCTNNLYGMCESFYRPD  156



>ref|XP_006679179.1| hypothetical protein BATDEDRAFT_88542 [Batrachochytrium dendrobatidis 
JAM81]
 gb|EGF80126.1| hypothetical protein BATDEDRAFT_88542 [Batrachochytrium dendrobatidis 
JAM81]
Length=204

 Score =   204 bits (519),  Expect = 1e-62, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSA++AM GKNC AIA+DRR GVQ  T+ TDF++I+ I  K +LGLAGLATDV
Sbjct  1    MSIMEYNGSAIIAMAGKNCVAIAADRRFGVQALTLGTDFQKIFPITDKTYLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  ++  +Y L EER++ P+TF+ +VS+  YEKRFGPYF +P++AGL  ++ PFI
Sbjct  61   TTLKDRFRYKVNMYHLEEEREISPKTFSHMVSSTQYEKRFGPYFVEPIVAGLEKDNTPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD+IG    AKDFVV GTAS+ + G CE++++PD
Sbjct  121  CSMDTIGCINFAKDFVVCGTASDQMNGMCESLWEPD  156



>ref|XP_004998595.1| proteasome subunit beta type-3 [Salpingoeca rosetta]
 gb|EGD72023.1| proteasome subunit beta type-3 [Salpingoeca rosetta]
Length=204

 Score =   204 bits (518),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNGSA+VAM GK C AIA+DRRLG Q QTV+TDF++++++  KLF+GL GL TD 
Sbjct  1    MSIMEYNGSAVVAMTGKECVAIAADRRLGAQAQTVSTDFQKVFQMGPKLFVGLPGLGTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             T+ QRL FR  +Y LREERD++P+T  +LVS+ LYE+RFGPYF +PV+AGL  +++P++
Sbjct  61   ITVSQRLKFRLNMYTLREERDIEPKTMINLVSSFLYERRFGPYFVEPVVAGLDSKNQPYV  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             + D IG      DFVV GT+SE LYG CE+++KPD
Sbjct  121  ASTDLIGCPMETSDFVVGGTSSEQLYGMCESLYKPD  156



>gb|KDQ16840.1| hypothetical protein BOTBODRAFT_53901 [Botryobasidium botryosum 
FD-172 SS1]
Length=204

 Score =   203 bits (517),  Expect = 3e-62, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG ++VAMVGKNC AIASD RLG Q  TVATDF++I+ +  ++FLGL GLATDV
Sbjct  1    MSIMSYNGGSVVAMVGKNCVAIASDLRLGSQALTVATDFQKIFPVTDRIFLGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL +R  FR  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGLG ++KPFI
Sbjct  61   LTLKERFRFRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFVEPVIAGLGKDNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
               D IG   L KDF V+GTAS+ ++G  E +++PD
Sbjct  121  AATDLIGCLTLPKDFAVSGTASDKMFGVAEGLWEPD  156



>gb|EPB88707.1| proteasome subunit beta type-3 [Mucor circinelloides f. circinelloides 
1006PhL]
Length=218

 Score =   203 bits (517),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 88/153 (58%), Positives = 121/153 (79%), Gaps = 0/153 (0%)
 Frame = +2

Query  113  FEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTL  292
             +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++++K   K F+GL GLATDV TL
Sbjct  1    MQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKMFKASEKTFIGLPGLATDVLTL  60

Query  293  YQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTM  472
              R  F+  +Y++REER+M+P+T A +VS+ LYEKRFGPYF +P++AGLG ++KPFIC M
Sbjct  61   ADRFRFKTNMYKMREEREMEPKTLAHMVSSTLYEKRFGPYFVEPIVAGLGKDNKPFICAM  120

Query  473  DSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            D IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  DLIGCINFAKDFVVSGTAGSNLYGMCESLWEPD  153



>ref|XP_001745472.1| hypothetical protein [Monosiga brevicollis MX1]
 gb|EDQ89443.1| predicted protein [Monosiga brevicollis MX1]
Length=211

 Score =   203 bits (516),  Expect = 4e-62, Method: Compositional matrix adjust.
 Identities = 90/155 (58%), Positives = 122/155 (79%), Gaps = 0/155 (0%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI EYNGSA+VAM GK C AIA+DRRLG Q QTVATDF++++++   LF+GL GLATDVQ
Sbjct  9    SIMEYNGSAMVAMTGKGCIAIAADRRLGAQAQTVATDFQKLFQMGPTLFVGLPGLATDVQ  68

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFIC  466
            T  QRL F+ KLY+LREERD++P+   +L+S++LYEKRFGPYF +P+IAGL  + +P++ 
Sbjct  69   TFSQRLTFKLKLYKLREERDIEPKALTNLISSMLYEKRFGPYFIEPLIAGLDKDGQPYVA  128

Query  467  TMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            + D IG      DFVV GT+S+ L+G CE+++KP+
Sbjct  129  STDVIGCPMETTDFVVGGTSSDQLFGMCESLYKPN  163



>dbj|GAM19772.1| hypothetical protein SAMD00019534_029470, partial [Acytostelium 
subglobosum LB1]
Length=204

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 87/156 (56%), Positives = 118/156 (76%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG A++ M GKNC AIASD R G+Q QT++ +F ++Y+I+ K F+G+AGL TD 
Sbjct  1    MSIMEYNGGAVIVMTGKNCVAIASDLRYGIQHQTISNNFPKVYRINEKCFVGIAGLVTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLYQ+L+FRH LY+LREERDM P+   +L++ +LYEKRFGPYF +PVI GL + +KPFI
Sbjct  61   QTLYQKLMFRHNLYKLREERDMTPQVLTNLIANMLYEKRFGPYFTEPVICGLDENNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              MD IGA     DF++ GT + ++YG CE +++ D
Sbjct  121  SGMDLIGALVSTDDFLLVGTMTPAMYGLCETLYRKD  156



>ref|XP_009824833.1| hypothetical protein H257_02748 [Aphanomyces astaci]
 gb|ETV86361.1| hypothetical protein H257_02748 [Aphanomyces astaci]
Length=204

 Score =   202 bits (515),  Expect = 5e-62, Method: Compositional matrix adjust.
 Identities = 85/156 (54%), Positives = 128/156 (82%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GKNC AIASD RLGVQ QT+ATDF+++++++ K FLGLAGLATDV
Sbjct  1    MSILAYNGAAVIAMAGKNCVAIASDTRLGVQGQTIATDFQKVFRLNDKTFLGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            Q++ Q L F+  +Y++REER++K +T ++L+S ++YEKRFGP+F +P++AGL ++++PF+
Sbjct  61   QSVSQLLRFKLNMYKMREEREIKAKTLSALISNLMYEKRFGPWFVEPLVAGLTEDNQPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             +MD +G +   KD+V AGT  E+L+G CE++F+PD
Sbjct  121  SSMDCLGCEMFTKDYVCAGTMEEALHGMCESLFRPD  156



>emb|CDS02721.1| Putative Proteasome subunit beta type [Absidia idahoensis var. 
thermophila]
Length=204

 Score =   202 bits (515),  Expect = 6e-62, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGKNC AIA+D+RLG Q  TV+T+F++I+K   K F+GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKNCVAIAADKRLGQQFMTVSTEFQKIFKGAEKSFIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL +R  F+  +Y++REER+++P+T A +VS+ LYE+RFGPYF +PV+AGL   ++PFI
Sbjct  61   LTLAERFRFKINMYKMREEREIEPKTLAHMVSSTLYERRFGPYFVEPVVAGLDKNNEPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPD  156



>gb|ESA23897.1| hypothetical protein GLOINDRAFT_341917 [Rhizophagus irregularis 
DAOM 181602]
Length=204

 Score =   202 bits (514),  Expect = 7e-62, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 120/156 (77%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG A+VAM GKNC AI SD+RLGVQL TV+T+F +++    K F+GL GLATD+
Sbjct  1    MSIMEYNGGAIVAMAGKNCVAIGSDKRLGVQLMTVSTEFPKVFPATDKTFIGLPGLATDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            +TL +R  F+  +Y+L EER+++P T A +VS+ LYE+RFGPYF +P+IAGL   ++PFI
Sbjct  61   RTLSERFRFKINMYKLSEEREIEPRTLAHMVSSTLYERRFGPYFVEPIIAGLDKNNQPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C MD IG    AKDFVV G+ ++SL+G CE++++PD
Sbjct  121  CGMDLIGCINFAKDFVVGGSTTDSLFGVCESLWEPD  156



>ref|XP_011428234.1| PREDICTED: proteasome subunit beta type-3-like [Crassostrea gigas]
Length=205

 Score =   202 bits (514),  Expect = 9e-62, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 127/157 (81%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AM G++C AIASDRR G+Q QTV+T+F++I+++  +L++GL GLATDV
Sbjct  1    MSILEYNGAAIIAMKGRDCVAIASDRRFGIQAQTVSTNFQKIFEMGPRLYIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT++QRL FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PVIAGL  +  +PF
Sbjct  61   QTVHQRLQFRLNLYELRENRRIKPKTFLSMVSNLLYERRFGPYFVEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I +MD IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  IASMDLIGCPMVTDDFVVSGTCSEQMYGMCESVWEPN  157



>gb|KFH62657.1| proteasome subunit beta type-3 [Mortierella verticillata NRRL 
6337]
Length=204

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG A+VAMVGKNC AIA D+RLGVQ  T++T+F++ ++   K ++GL GLATDV
Sbjct  1    MSIMEYNGGAVVAMVGKNCVAIACDKRLGVQAMTISTEFKKTFQATPKTYIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL ++  F+  +Y+L+EER+++P   A LVS+ LYE+RFGP+F +PVIAGL  E++PFI
Sbjct  61   QTLAEKFRFKVNMYRLKEEREIEPRALAHLVSSTLYERRFGPWFVEPVIAGLDKENRPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+ D IG    AKDFVV+GT S  LYG CE++++PD
Sbjct  121  CSTDLIGCINFAKDFVVSGTTSNQLYGMCESLWEPD  156



>gb|ELU08769.1| hypothetical protein CAPTEDRAFT_228896 [Capitella teleta]
Length=205

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSA+VAM GK+C AIA+DRR G+Q QTVA DF++IY+    L++GL GLATDV
Sbjct  1    MSILSYNGSAIVAMAGKDCVAIAADRRFGIQGQTVALDFQKIYEYGPNLYMGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE-DKPF  460
            QT+ QRL FR  +Y+LRE R MKP+T  S+VS +LYE+RFGPYF +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRVNMYELRENRKMKPQTMLSVVSNLLYERRFGPYFVEPVIAGLDPKTSKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I ++D IG   + +DFV+ GT +E LYG CEA+++PD
Sbjct  121  IASLDLIGCPMITEDFVINGTCAEQLYGMCEALWEPD  157



>ref|XP_010730943.1| PREDICTED: proteasome subunit beta type-3 [Larimichthys crocea]
Length=205

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDFE+I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFEKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTLEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_007258523.1| PREDICTED: proteasome subunit beta type-3-like [Astyanax mexicanus]
Length=205

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_418119.2| PREDICTED: proteasome subunit beta type-3 [Gallus gallus]
Length=205

 Score =   202 bits (513),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMITEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_780413.3| PREDICTED: proteasome subunit beta type-3-like [Strongylocentrotus 
purpuratus]
Length=205

 Score =   201 bits (511),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 94/157 (60%), Positives = 119/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNGSA+VAM+GK+C  IASDRR GVQ QTV+ + ++I+ +  +L+LGL+GLATD+
Sbjct  1    MSIMSYNGSAVVAMIGKDCVGIASDRRFGVQAQTVSMNAQKIFTMGPRLYLGLSGLATDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T+  RL FR  LY LRE RD+KPETF S+VS +LYE+RFGPYF +PVIAGL  +  KPF
Sbjct  61   TTVSNRLKFRLNLYTLRENRDVKPETFMSMVSNLLYERRFGPYFIEPVIAGLDPKTYKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC +D IG      DFVVAGT +E LYG CE+++ PD
Sbjct  121  ICNLDLIGCPMFTDDFVVAGTCTEQLYGMCESVWVPD  157



>ref|XP_646265.1| proteasome subunit beta type 3 [Dictyostelium discoideum AX4]
 sp|Q55D66.1|PSB3_DICDI RecName: Full=Proteasome subunit beta type-3 [Dictyostelium discoideum]
 gb|EAL72236.1| proteasome subunit beta type 3 [Dictyostelium discoideum AX4]
Length=205

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A + MVGKNC AIASD R G+Q QT++ DF ++Y+I+ K F+G++GL TD 
Sbjct  1    MSIMAYNGGACIVMVGKNCVAIASDLRFGIQQQTISNDFPKVYRINDKCFVGISGLVTDA  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGL-GDEDKPF  460
            QTLYQ+LVFRH LY+LREERDM P   ++L++ +LYEKRFGPYF +P+I GL G ++ PF
Sbjct  61   QTLYQKLVFRHNLYKLREERDMSPRVVSNLLTNMLYEKRFGPYFTEPLICGLEGPDNTPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I  MD IGA     DF+V GT + ++YG CE ++K D
Sbjct  121  ISGMDLIGASVATDDFLVVGTMTPAMYGVCETLYKKD  157



>gb|EIE91509.1| hypothetical protein RO3G_16220 [Rhizopus delemar RA 99-880]
Length=204

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI +YNG ++VAMVGK+C AIA+D+RLG Q  TV+T+F++I+K   K  +GL GLATDV
Sbjct  1    MSIMQYNGGSVVAMVGKDCVAIAADKRLGAQFMTVSTEFQKIFKATEKTLIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL  R  F+  +Y++REER+++P+  A +VS+ LYE+RFGPYF +PVIAGL   +KPFI
Sbjct  61   ITLADRFRFKTNMYKMREEREIEPKALAHMVSSTLYERRFGPYFVEPVIAGLDKHNKPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD IG    AKDFVV+GTA  +LYG CE++++PD
Sbjct  121  CSMDLIGCINFAKDFVVSGTAGPNLYGMCESLWEPD  156



>ref|XP_004085833.1| PREDICTED: proteasome subunit beta type-3 [Oryzias latipes]
Length=205

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKSFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>gb|ACI67569.1| Proteasome subunit beta type-3 [Salmo salar]
Length=205

 Score =   201 bits (510),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + KDFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTKDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_006799729.1| PREDICTED: proteasome subunit beta type-3-like [Neolamprologus 
brichardi]
Length=214

 Score =   201 bits (510),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  10   MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  69

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  70   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  129

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  130  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  166



>ref|XP_004538793.1| PREDICTED: proteasome subunit beta type-3-like [Maylandia zebra]
 ref|XP_005746092.1| PREDICTED: proteasome subunit beta type-3-like [Pundamilia nyererei]
 ref|XP_005919306.1| PREDICTED: proteasome subunit beta type-3-like [Haplochromis 
burtoni]
Length=205

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>gb|KFO73083.1| Proteasome subunit beta type-3, partial [Cuculus canorus]
Length=205

 Score =   200 bits (509),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  YNG A++AM GKNC AIA+DRR G+Q QTV TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQTVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFI  463
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  62   TVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFI  121

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  122  CSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_008292536.1| PREDICTED: proteasome subunit beta type-3 [Stegastes partitus]
Length=205

 Score =   200 bits (509),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTLEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_010583832.1| PREDICTED: proteasome subunit beta type-3 [Haliaeetus leucocephalus]
Length=205

 Score =   200 bits (508),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_003448021.2| PREDICTED: proteasome subunit beta type-3-like [Oreochromis niloticus]
Length=205

 Score =   200 bits (508),  Expect = 6e-61, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPD  157



>gb|ADO27744.1| proteasome subunit beta type-3 [Ictalurus furcatus]
Length=205

 Score =   200 bits (508),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK+C AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKDCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDQIGCPMITEDFVVSGTCAEQMYGMCESLWEPD  157



>ref|XP_007545257.1| PREDICTED: proteasome subunit beta type-3 [Poecilia formosa]
Length=205

 Score =   200 bits (508),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++++ +  +L++GLAGLATDV
Sbjct  1    MSIMNYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKVFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_005803095.1| PREDICTED: proteasome subunit beta type-3-like [Xiphophorus maculatus]
Length=205

 Score =   199 bits (507),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++++ +  +L++GLAGLATDV
Sbjct  1    MSIMNYNGGAVMAMRGKNCVAIAADRRYGIQAQMVTTDFQKVFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>gb|ACH70865.1| proteasome (prosome, macropain) subunit, beta type 3 [Salmo salar]
 gb|ACI68800.1| Proteasome subunit beta type-3 [Salmo salar]
Length=205

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|NP_001117722.1| proteasome subunit beta type-3 [Oncorhynchus mykiss]
 ref|XP_010887454.1| PREDICTED: proteasome subunit beta type-3 [Esox lucius]
 sp|O73817.1|PSB3_ONCMY RecName: Full=Proteasome subunit beta type-3; AltName: Full=Proteasome 
chain 13; AltName: Full=Proteasome component C10-II; 
AltName: Full=Proteasome theta chain [Oncorhynchus mykiss]
 gb|AAC14141.1| proteasome subunit C10-11 [Oncorhynchus mykiss]
 gb|ACO08798.1| Proteasome subunit beta type 3 [Oncorhynchus mykiss]
Length=205

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_005301900.1| PREDICTED: proteasome subunit beta type-3 [Chrysemys picta bellii]
Length=205

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+T  S+V+ +LYEKRFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTLMSMVANLLYEKRFGPYYTEPVIAGLDPVTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  157



>gb|ACO09022.1| Proteasome subunit beta type 3 [Osmerus mordax]
Length=205

 Score =   199 bits (506),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C A+A+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKQCVAVAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYEKRFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYEKRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>gb|KFM04559.1| Proteasome subunit beta type-3, partial [Aptenodytes forsteri]
Length=205

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQVVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFI  463
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  62   TVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFI  121

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  122  CSLDLIGCPMITNDFVVSGTCSEQMYGMCESLWEPD  157



>ref|NP_001188163.1| proteasome subunit beta type-3 [Ictalurus punctatus]
 gb|ADO28942.1| proteasome subunit beta type-3 [Ictalurus punctatus]
Length=205

 Score =   199 bits (505),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK+C AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKDCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMITEDFVVSGTCAEQMYGMCESLWEPD  157



>ref|XP_004361687.1| proteasome subunit beta type 3 [Dictyostelium fasciculatum]
 gb|EGG23836.1| proteasome subunit beta type 3 [Dictyostelium fasciculatum]
Length=201

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 85/151 (56%), Positives = 114/151 (75%), Gaps = 0/151 (0%)
 Frame = +2

Query  119  YNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQ  298
            YNG A++ M GKNC AIA+D R G+Q QTV+ +  ++Y+I+ K F+G++GL TD QTLYQ
Sbjct  3    YNGGAVIVMTGKNCVAIATDLRFGIQHQTVSNNHPKVYRINDKCFIGISGLVTDAQTLYQ  62

Query  299  RLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDS  478
            +LVFRH LY+LREERDM P+  ++LV  +LYEKRFGPYF +PVI GL  +DKPFI  MD 
Sbjct  63   KLVFRHNLYKLREERDMTPQVLSNLVGNMLYEKRFGPYFTEPVICGLDTQDKPFISGMDL  122

Query  479  IGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IGA    +DF++ GT + ++YG CE ++K D
Sbjct  123  IGASVYTEDFLLVGTMTPAMYGLCETLYKKD  153



>ref|XP_006022632.1| PREDICTED: proteasome subunit beta type-3 [Alligator sinensis]
Length=290

 Score =   201 bits (511),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 92/162 (57%), Positives = 125/162 (77%), Gaps = 1/162 (1%)
 Frame = +2

Query  89   SACLRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAG  268
            S+ + MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAG
Sbjct  81   SSAVTMSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAG  140

Query  269  LATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDE  448
            LATDVQT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL   
Sbjct  141  LATDVQTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPI  200

Query  449  D-KPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              +PFIC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  201  TYEPFICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  242



>ref|NP_001123295.1| proteasome subunit beta type-3 [Danio rerio]
 gb|AAH49010.1| Psmb3 protein [Danio rerio]
Length=205

 Score =   198 bits (504),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKECVAIASDRRFGIQAQLVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPRTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_011260355.1| PREDICTED: proteasome subunit beta type-3 [Camponotus floridanus]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   LF+ L GLATD 
Sbjct  1    MSILAYNGGAVIAMKGKNCVAIAADRRFGIQAQTIMCDFQKIFEMEPHLFISLPGLATDT  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ +RL FR  LY+L+E R + P+TF ++VS +LYEKRFGPYF +P+IAGL     +PF
Sbjct  61   QTVMERLRFRLNLYELKENRKIHPKTFTAMVSNLLYEKRFGPYFVEPIIAGLDPVTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG++ +A+DFVV GT +E LYG CE++++PD
Sbjct  121  ICNMDLIGSRNMAEDFVVGGTCTEQLYGMCESLYEPD  157



>ref|XP_003414726.1| PREDICTED: proteasome subunit beta type-3 [Loxodonta africana]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIASDRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIASDRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPD  157



>ref|XP_006259773.1| PREDICTED: proteasome subunit beta type-3 [Alligator mississippiensis]
Length=207

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/159 (56%), Positives = 123/159 (77%), Gaps = 1/159 (1%)
 Frame = +2

Query  98   LRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLAT  277
            + MSI  YNG A++AM GKNC A+A+D+R G+Q Q V TDF++I+ +  +L++GLAGLAT
Sbjct  1    MTMSIMSYNGGAVMAMKGKNCVAVAADKRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLAT  60

Query  278  DVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-K  454
            DVQT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +
Sbjct  61   DVQTVAQRLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITYE  120

Query  455  PFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            PFIC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  PFICSLDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  159



>gb|AFM87627.1| proteasome (prosome, macropain) subunit, beta type, 3 [Callorhinchus 
milii]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MS   YNG+A++AM GKNC AIASDRR G+Q Q V TDF++IY +  +L++GLAGLATDV
Sbjct  1    MSHMSYNGAAIMAMKGKNCVAIASDRRFGIQAQLVTTDFQKIYPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+  PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYVDPVIAGLHPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG      DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDVIGCPMETDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|NP_001279732.1| proteasome (prosome, macropain) subunit, beta type, 3 [Callorhinchus 
milii]
 gb|AFM90817.1| proteasome (prosome, macropain) subunit, beta type, 3 [Callorhinchus 
milii]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MS   YNG+A++AM GKNC AIASDRR G+Q Q V TDF++IY +  +L++GLAGLATDV
Sbjct  1    MSHMSYNGAAIMAMKGKNCVAIASDRRFGIQAQLVTTDFQKIYPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+  PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYVDPVIAGLHPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG      DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDVIGCPMETDDFVVSGTCSEQMYGMCESLWEPD  157



>gb|AFK10923.1| proteasome (prosome, macropain) subunit, beta type, 3 [Callorhinchus 
milii]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MS   YNG+A++AM GKNC AIASDRR G+Q Q V TDF++IY +  +L++GLAGLATDV
Sbjct  1    MSHMSYNGAAIMAMKGKNCVAIASDRRFGIQAQLVTTDFQKIYPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+  PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYVDPVIAGLHPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG      DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDVIGCPMETDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_001599218.1| PREDICTED: proteasome subunit beta type-3 isoform X1 [Nasonia 
vitripennis]
Length=205

 Score =   198 bits (504),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT++ +F++IY++   L+LGL GLATD 
Sbjct  1    MSILAYNGGAIIAMKGKNCVAIAADRRFGIQAQTISCNFQKIYEMGPHLYLGLPGLATDS  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ +RL FR  LY+L+E R + P+TF S++S +LYE+RFGPYF +P++AGL  E  +PF
Sbjct  61   QTVMERLRFRLNLYELKESRTIHPKTFGSMISNLLYERRFGPYFVEPIVAGLDPETFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG   L +DFVV GT SE LYG CEA+++P+
Sbjct  121  ICNMDLIGCLNLPEDFVVGGTCSEQLYGMCEALYEPN  157



>ref|XP_005711307.1| 20S core proteasome subunit beta [Chondrus crispus]
 emb|CDF41013.1| 20S core proteasome subunit beta [Chondrus crispus]
Length=204

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/156 (58%), Positives = 117/156 (75%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG  ++AM GK+C AIASD RLGVQL TVA D  RI+ +H KL+LGL GL TD+
Sbjct  1    MSILEYNGGCVIAMAGKDCVAIASDHRLGVQLTTVAMDATRIFPMHDKLYLGLTGLMTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
             TL Q   FR ++Y++RE R +KP+TF++LVS+ LY KRFGPYF +PVIAGL  ++KPF+
Sbjct  61   TTLDQLFRFRLEMYEMRENRKIKPKTFSNLVSSTLYGKRFGPYFSEPVIAGLDKDNKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C+MD +G    A DF VAGT +ESL G CE  ++P+
Sbjct  121  CSMDLLGCIAEADDFAVAGTCAESLLGTCETFYRPN  156



>ref|XP_003972178.1| PREDICTED: proteasome subunit beta type-3-like [Takifugu rubripes]
Length=205

 Score =   198 bits (503),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG     +DFVV+GT SE +YG CE+++ PD
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWGPD  157



>ref|NP_001016503.1| proteasome subunit beta type-3 [Xenopus (Silurana) tropicalis]
 gb|AAI57195.1| proteasome (prosome, macropain) subunit, beta type 3 [Xenopus 
(Silurana) tropicalis]
Length=205

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK+C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAIMAMRGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+V+ +LYE+RFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG     +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPD  157



>gb|ACO07526.1| Proteasome subunit beta type 3 [Oncorhynchus mykiss]
Length=205

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L +GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQVVTTDFQKIFPMGDRLHIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_003768326.1| PREDICTED: proteasome subunit beta type-3 [Sarcophilus harrisii]
Length=205

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPNTLMSMVANLLYEKRFGPYYTEPVIAGLHPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPD  157



>gb|KFP34344.1| Proteasome subunit beta type-3, partial [Colius striatus]
Length=205

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/156 (57%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  +NG A++AM GKNC AIA+DRR G+Q QTV TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSHNGGAVMAMKGKNCVAIAADRRFGIQAQTVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFI  463
            T+ QRL F+  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  62   TVAQRLKFKLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFI  121

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  122  CSLDLIGCPMITNDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_002599453.1| hypothetical protein BRAFLDRAFT_281217 [Branchiostoma floridae]
 gb|EEN55465.1| hypothetical protein BRAFLDRAFT_281217 [Branchiostoma floridae]
Length=205

 Score =   198 bits (503),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AMVGK+C AIA+DRR GVQ QTV+ DF++I+++  +LFLGL GLATDV
Sbjct  1    MSIMSYNGAAIIAMVGKDCVAIAADRRFGVQAQTVSMDFQKIFQMGDRLFLGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+  R+ FR  LY+LRE R +KP+TF S+VS +LYE+RFGPYF +PV+AGL  +  +PF
Sbjct  61   QTVSNRMKFRLNLYELREARQVKPKTFLSMVSNLLYERRFGPYFVEPVVAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I + D IG   + +DFVV+GT SE +YG CE++++P+
Sbjct  121  IASCDLIGCPMIPEDFVVSGTCSEQMYGMCESLWEPN  157



>gb|ACO08764.1| Proteasome subunit beta type 3 [Oncorhynchus mykiss]
Length=205

 Score =   197 bits (502),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM G+ C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGQQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_002508440.1| predicted protein [Micromonas sp. RCC299]
 gb|ACO69698.1| predicted protein [Micromonas sp. RCC299]
Length=207

 Score =   198 bits (503),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 94/159 (59%), Positives = 117/159 (74%), Gaps = 3/159 (2%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGV-QLQTVATDFERIYKIHGKLFLGLAGLATD  280
            MSI  YNG+A++AM GK C AIASD R G+ Q QT A D ++IYKIH  L++GL+GLATD
Sbjct  1    MSIMSYNGAAIIAMCGKECVAIASDLRFGINQQQTTAVDMKKIYKIHDHLYVGLSGLATD  60

Query  281  VQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED--K  454
              TL QR  FRH +Y+LRE R M+PETFA+LVS +LYEKRFGPY+ +P++AGL   +  K
Sbjct  61   QATLAQRFKFRHNMYELRESRKMRPETFANLVSTMLYEKRFGPYYAEPIVAGLDATNGYK  120

Query  455  PFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            PFI  MD IGA     +FVV G   ESL+G CE+M+KPD
Sbjct  121  PFITGMDLIGAMAPTDNFVVCGNNEESLFGVCESMYKPD  159



>gb|KJE95802.1| proteasome subunit beta type-3 [Capsaspora owczarzaki ATCC 30864]
Length=231

 Score =   199 bits (505),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 92/167 (55%), Positives = 124/167 (74%), Gaps = 1/167 (1%)
 Frame = +2

Query  74   SRFLSSACLRMSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLF  253
            SRF     + MSI  YNG++++AM GK C AIA+DRR G+Q QTV+TDF++ +K+  +LF
Sbjct  17   SRFCIEFSVAMSILAYNGASIIAMKGKGCVAIAADRRFGIQAQTVSTDFQKTFKMGDRLF  76

Query  254  LGLAGLATDVQTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIA  433
            +GLAGLATDVQT+  +L FR  +Y LREER + PETF ++V+ +LYEKRFGP+F +PVIA
Sbjct  77   IGLAGLATDVQTVASKLQFRVNMYHLREERSVAPETFMNIVANVLYEKRFGPFFIEPVIA  136

Query  434  GLGD-EDKPFICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            GL     +PF+   D IG  ++A DF V GTASE LYG CE+M++P+
Sbjct  137  GLDPVSGEPFVAATDLIGCPDVADDFAVVGTASEQLYGMCESMYEPN  183



>ref|XP_002183677.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
 gb|EEC44859.1| predicted protein [Phaeodactylum tricornutum CCAP 1055/1]
Length=204

 Score =   197 bits (502),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 93/156 (60%), Positives = 124/156 (79%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG+A++AM GK+C  IA+DRRLGVQLQTVATDF +++ +  K ++GLAGLATDV
Sbjct  1    MSILEYNGAAMIAMAGKDCVGIAADRRLGVQLQTVATDFNKVFAMGPKSYVGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTL   L FR  LY+L+EER+M P T + L+S +LYEKRFGPYF +P++AGL +++KPF+
Sbjct  61   QTLKNILEFRKNLYELKEEREMSPATLSHLLSTLLYEKRFGPYFVEPIVAGLNEKNKPFL  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
              MD IGA   A DFVV+GT + +LYG CE++++PD
Sbjct  121  SAMDLIGAPVQADDFVVSGTCTGNLYGMCESLYRPD  156



>ref|XP_006685609.1| proteasome-domain-containing protein [Candida tenuis ATCC 10573]
 ref|XP_006685610.1| hypothetical protein CANTEDRAFT_113576 [Candida tenuis ATCC 10573]
 gb|EGV64803.1| proteasome-domain-containing protein [Candida tenuis ATCC 10573]
 gb|EGV64804.1| hypothetical protein CANTEDRAFT_113576 [Candida tenuis ATCC 10573]
Length=205

 Score =   197 bits (502),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 90/150 (60%), Positives = 117/150 (78%), Gaps = 0/150 (0%)
 Frame = +2

Query  122  NGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQR  301
            NG + VAMVGK+C AIA D RLG Q   +A +FE+I+ I+ K+ LGL GLATDV TL + 
Sbjct  8    NGGSAVAMVGKDCVAIACDLRLGSQSLGLANNFEKIFTINDKVMLGLTGLATDVTTLNEV  67

Query  302  LVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFICTMDSI  481
              F++ LY+LREER ++P+TFA+LVS+ LYEKRFGPYFC PV+AGL  E+KPFIC  D I
Sbjct  68   FRFKNNLYELREERKIEPQTFANLVSSTLYEKRFGPYFCGPVVAGLNKENKPFICGFDLI  127

Query  482  GAKELAKDFVVAGTASESLYGACEAMFKPD  571
            G  + AKDF+V+GTASE LYG CE++++P+
Sbjct  128  GCIDFAKDFIVSGTASEQLYGMCESLYEPN  157



>ref|XP_001501618.2| PREDICTED: proteasome subunit beta type-3 [Equus caballus]
Length=205

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPN  157



>gb|AEB53189.1| proteasome subunit beta type 3 [Holothuria glaberrima]
Length=202

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 90/152 (59%), Positives = 121/152 (80%), Gaps = 1/152 (1%)
 Frame = +2

Query  119  YNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQ  298
            YNGSA+VAM GK+C AIASDRR G+Q QTV+ + ++I+++  +L++GL+GLATDVQT+  
Sbjct  3    YNGSAIVAMRGKDCVAIASDRRFGIQAQTVSMECQKIFEMAPRLYIGLSGLATDVQTVSN  62

Query  299  RLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFICTMD  475
            RL FR  LY LRE RD+KP+TF S+V+ +LYE+RFGPYF +PVIAGL  +  +PFIC +D
Sbjct  63   RLKFRLNLYTLRENRDIKPKTFMSMVANLLYERRFGPYFTEPVIAGLDPKTFEPFICNLD  122

Query  476  SIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             IG   + +DFVVAGT +E LYG CE+++KPD
Sbjct  123  LIGCPMITEDFVVAGTCTEQLYGMCESLWKPD  154



>ref|NP_587985.1| 20S proteasome component beta 3, Pup3 (predicted) [Schizosaccharomyces 
pombe 972h-]
 sp|Q9Y7T8.1|PSB3_SCHPO RecName: Full=Probable proteasome subunit beta type-3 [Schizosaccharomyces 
pombe 972h-]
 emb|CAB40016.1| 20S proteasome component beta 3, Pup3 (predicted) [Schizosaccharomyces 
pombe]
Length=204

 Score =   197 bits (501),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 121/156 (78%), Gaps = 0/156 (0%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG + VAM GKNC AIASD RLGVQ  ++  +F +++ +  K +LGL GLATDV
Sbjct  1    MSIMEYNGGSCVAMAGKNCVAIASDLRLGVQSISLTNNFPKVFAMGDKTYLGLTGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDEDKPFI  463
            QTLY+   ++  LY+ REER ++P+TFA+LVS+ LYEKRFGPYF  PV+AG+ +++ PFI
Sbjct  61   QTLYELFRYKVNLYKFREERQIQPKTFANLVSSTLYEKRFGPYFSFPVVAGVSNDNTPFI  120

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C  DSIG  + A+DF+V+GTA+E LYG CE++++P+
Sbjct  121  CGFDSIGCIDFAEDFIVSGTATEQLYGMCESVYEPN  156



>gb|KDR23887.1| Proteasome subunit beta type-3 [Zootermopsis nevadensis]
Length=205

 Score =   197 bits (502),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 88/157 (56%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A+VAM GKNC AIA+D+R G+Q QT+A DF++I+++   LF+GL GLATD 
Sbjct  1    MSIMSYNGGAIVAMKGKNCVAIAADKRFGIQAQTLALDFQKIFEMGPHLFIGLPGLATDT  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT++QRL FR  LY+L+E R + P+TFA++VS +LYE+RFGPYF +P+IAGL  +  +P+
Sbjct  61   QTVHQRLKFRLNLYELKENRHINPKTFAAMVSNLLYERRFGPYFIEPIIAGLDPKTFEPY  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            +C MD IG     +DFVV GT +E LYG CE +++PD
Sbjct  121  VCNMDLIGCPNEPEDFVVGGTCTEQLYGMCETLWEPD  157



>gb|ACI69598.1| Proteasome subunit beta type-3 [Salmo salar]
 gb|ADM16027.1| Proteasome subunit beta type-3 [Salmo salar]
Length=205

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT SE ++G CE++++PD
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCSEQMHGMCESLWEPD  157



>ref|XP_007177581.1| PREDICTED: proteasome subunit beta type-3 [Balaenoptera acutorostrata 
scammoni]
Length=205

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPD  157



>ref|XP_009052112.1| hypothetical protein LOTGIDRAFT_226791 [Lottia gigantea]
 gb|ESO97202.1| hypothetical protein LOTGIDRAFT_226791 [Lottia gigantea]
Length=205

 Score =   197 bits (501),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 124/157 (79%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG+A++AM GK+C AIA+DRR GVQ QTV+ DF++I+++   L++GL GLATDV
Sbjct  1    MSILAYNGAAIIAMNGKDCVAIAADRRFGVQAQTVSMDFDKIFEMGPHLYIGLPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR K+Y+LRE R ++P+TF S+VS +LYE+RFGPYF +PV+AGL  +  +PF
Sbjct  61   QTVSQRLNFRLKMYELRENRRIRPKTFMSMVSNLLYERRFGPYFVEPVVAGLDPKTHQPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I +MD IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  IASMDLIGCPMITDDFVVSGTCSEQMYGMCESLWEPN  157



>ref|XP_004378066.1| PREDICTED: proteasome subunit beta type-3 [Trichechus manatus 
latirostris]
 ref|XP_008064644.1| PREDICTED: proteasome subunit beta type-3 isoform X1 [Tarsius 
syrichta]
Length=205

 Score =   197 bits (501),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPD  157



>ref|XP_009554975.1| PREDICTED: proteasome subunit beta type-3 [Cuculus canorus]
Length=202

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 89/152 (59%), Positives = 120/152 (79%), Gaps = 1/152 (1%)
 Frame = +2

Query  119  YNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQTLYQ  298
            YNG A++AM GKNC AIA+DRR G+Q QTV TDF++I+ +  +L++GLAGLATDVQT+ Q
Sbjct  3    YNGGAVMAMKGKNCVAIAADRRFGIQAQTVTTDFQKIFPMGERLYIGLAGLATDVQTVAQ  62

Query  299  RLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPFICTMD  475
            RL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL     +PFIC++D
Sbjct  63   RLKFRLNLYELKEGRQIKPQTFMSMVSNLLYERRFGPYYTEPVIAGLDPITHEPFICSLD  122

Query  476  SIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
             IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  123  LIGCPMITDDFVVSGTCSEQMYGMCESLWEPD  154



>ref|XP_004434651.1| PREDICTED: proteasome subunit beta type-3 isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004434652.1| PREDICTED: proteasome subunit beta type-3 isoform 2 [Ceratotherium 
simum simum]
Length=205

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPNTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPN  157



>ref|XP_005368450.1| PREDICTED: proteasome subunit beta type-3 [Microtus ochrogaster]
Length=181

 Score =   196 bits (498),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPN  157



>ref|XP_004608774.1| PREDICTED: proteasome subunit beta type-3 [Sorex araneus]
Length=205

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFQPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_003222559.1| PREDICTED: proteasome subunit beta type-3 [Anolis carolinensis]
Length=205

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +LF+GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLFIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+T  S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPQTLMSMVSNLLYERRFGPYYTEPVIAGLDPITYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            +C++D IG      DFVV+GT SE +YG CE++++PD
Sbjct  121  VCSLDLIGCPMTTDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_007429906.1| PREDICTED: proteasome subunit beta type-3 [Python bivittatus]
Length=205

 Score =   197 bits (500),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 120/157 (76%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +LF+GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLFIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+VS +LYE+RFGPY+ +PVIAGL     +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPHTLMSMVSNLLYERRFGPYYTEPVIAGLDPVTYEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMITDDFVVSGTCTEQMYGMCESLWEPD  157



>gb|ETE71446.1| Proteasome subunit beta type-3, partial [Ophiophagus hannah]
Length=240

 Score =   198 bits (503),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 121/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  YNG A++AM GKNC AIA+DRR G+Q Q VATDF++I+ +  +LF+GLAGLATDVQ
Sbjct  37   SIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVATDFQKIFPMGDRLFIGLAGLATDVQ  96

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  463
            T+ QRL FR  LY+L+E R +KP+T  S+VS +LYE+RFGPY+ +PVIAGL     +PFI
Sbjct  97   TVAQRLKFRLNLYELKEGRQIKPQTLMSMVSNLLYERRFGPYYTEPVIAGLNPVTYEPFI  156

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  157  CSLDLIGCPMITDDFVVSGTCTEQMYGMCESLWEPD  192



>gb|AAH87457.1| Unknown (protein for MGC:99279) [Xenopus laevis]
Length=205

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK+C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAIMAMKGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+V+ +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVSQRLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFQPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG     +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|NP_036101.1| proteasome subunit beta type-3 [Mus musculus]
 ref|XP_006155927.1| PREDICTED: proteasome subunit beta type-3 [Tupaia chinensis]
 sp|Q9R1P1.1|PSB3_MOUSE RecName: Full=Proteasome subunit beta type-3; AltName: Full=Proteasome 
chain 13; AltName: Full=Proteasome component C10-II; 
AltName: Full=Proteasome theta chain [Mus musculus]
 pdb|3UNB|I Chain I, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|W Chain W, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|KK Chain k, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNB|YY Chain y, Mouse Constitutive 20s Proteasome In Complex With Pr-957
 pdb|3UNE|I Chain I, Mouse Constitutive 20s Proteasome
 pdb|3UNE|W Chain W, Mouse Constitutive 20s Proteasome
 pdb|3UNE|KK Chain k, Mouse Constitutive 20s Proteasome
 pdb|3UNE|YY Chain y, Mouse Constitutive 20s Proteasome
 pdb|3UNF|I Chain I, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNF|W Chain W, Mouse 20s Immunoproteasome In Complex With Pr-957
 pdb|3UNH|I Chain I, Mouse 20s Immunoproteasome
 pdb|3UNH|W Chain W, Mouse 20s Immunoproteasome
 gb|AAD50537.1|AF060092_1 proteasome subunit C10-II [Mus musculus]
 dbj|BAB22017.1| unnamed protein product [Mus musculus]
 dbj|BAB26979.1| unnamed protein product [Mus musculus]
 gb|AAH14783.1| Proteasome (prosome, macropain) subunit, beta type 3 [Mus musculus]
 gb|AAH98233.1| Proteasome (prosome, macropain) subunit, beta type 3 [Mus musculus]
 dbj|BAE31772.1| unnamed protein product [Mus musculus]
 gb|EDL16092.1| mCG13231, isoform CRA_b [Mus musculus]
 gb|ELW54866.1| Proteasome subunit beta type-3 [Tupaia chinensis]
Length=205

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPN  157



>ref|NP_001277537.1| proteasome (prosome, macropain) subunit, beta type, 3 [Panthera 
tigris altaica]
 ref|XP_003996811.1| PREDICTED: proteasome subunit beta type-3 [Felis catus]
 gb|AHJ25837.1| proteasome subunit beta type-3 [Panthera tigris altaica]
Length=205

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPN  157



>ref|NP_001239086.1| proteasome subunit beta type-3 [Canis lupus familiaris]
 ref|XP_003499622.1| PREDICTED: proteasome subunit beta type-3-like [Cricetulus griseus]
 ref|XP_004395130.1| PREDICTED: proteasome subunit beta type-3 [Odobenus rosmarus 
divergens]
 ref|XP_004655549.1| PREDICTED: proteasome subunit beta type-3 [Jaculus jaculus]
 ref|XP_004799054.1| PREDICTED: proteasome subunit beta type-3 [Mustela putorius furo]
 ref|XP_006971926.1| PREDICTED: proteasome subunit beta type-3 [Peromyscus maniculatus 
bairdii]
 ref|XP_007615527.1| PREDICTED: proteasome subunit beta type-3 [Cricetulus griseus]
 ref|XP_008843496.1| PREDICTED: proteasome subunit beta type-3 [Nannospalax galili]
Length=205

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPN  157



>emb|CAG06144.1| unnamed protein product, partial [Tetraodon nigroviridis]
Length=230

 Score =   197 bits (502),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDVQ
Sbjct  2    SIMSYNGGAVMAMRGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGERLYIGLAGLATDVQ  61

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  463
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PFI
Sbjct  62   TVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPFI  121

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG     +DFVV+GT SE +YG CE++++PD
Sbjct  122  CSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_006214288.1| PREDICTED: proteasome subunit beta type-3 [Vicugna pacos]
Length=205

 Score =   197 bits (500),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPHTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPN  157



>emb|CCA71352.1| probable PUP3-20S proteasome subunit beta3 [Piriformospora indica 
DSM 11827]
Length=205

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 91/157 (58%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI EYNG ++VAM GK+C AIASD RLG Q  T+AT+FE+++ +  ++ LG+AGLATDV
Sbjct  1    MSIMEYNGGSVVAMAGKDCVAIASDLRLGNQALTIATNFEKVFPVTERIMLGMAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGD-EDKPF  460
             TL  R  FR  +Y ++EER+++PETFA LVS+ LYE+RFGPYF +PVIAGLG   +KPF
Sbjct  61   LTLRDRFRFRVNMYTIKEEREIEPETFAHLVSSTLYERRFGPYFIEPVIAGLGKGTNKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            I + D IG    AKDFVVAGTA++ L+G  E++++PD
Sbjct  121  IASTDVIGCINFAKDFVVAGTATDKLFGVAESLWEPD  157



>ref|XP_001371633.2| PREDICTED: proteasome subunit beta type-3 [Monodelphis domestica]
Length=205

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLHPKTFEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPD  157



>ref|XP_004041889.1| PREDICTED: proteasome subunit beta type-3 [Gorilla gorilla gorilla]
Length=205

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPHTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCAEQMYGMCESLWEPN  157



>ref|NP_001088741.1| proteasome (prosome, macropain) subunit, beta type, 3 [Xenopus 
laevis]
 gb|AAH87395.1| LOC496005 protein [Xenopus laevis]
Length=205

 Score =   196 bits (499),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 90/157 (57%), Positives = 123/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GK+C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAIMAMKGKDCVAIAADRRFGVQAQMVTTDFQKIFPMGERLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP+TF S+V+ +LYE+RFGPY+ +PVIAGL  +  +PF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPKTFMSMVANLLYERRFGPYYIEPVIAGLDPKTFQPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG     +DFVV+GT SE +YG CE++++PD
Sbjct  121  ICSLDLIGCPMETEDFVVSGTCSEQMYGMCESLWEPD  157



>ref|NP_001138374.1| proteasome subunit beta type-3 [Sus scrofa]
Length=205

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYE+RFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYERRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT +E +YG CE++++PD
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCTEQMYGMCESLWEPD  157



>emb|CDQ68912.1| unnamed protein product [Oncorhynchus mykiss]
Length=219

 Score =   197 bits (500),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 90/156 (58%), Positives = 122/156 (78%), Gaps = 1/156 (1%)
 Frame = +2

Query  107  SIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDVQ  286
            SI  YNG A++AM GK C AIA+DRR GVQ Q V TDF++I+ +  +L++GLAGLATDVQ
Sbjct  16   SIMSYNGGAVMAMKGKQCVAIAADRRFGVQAQMVTTDFQKIFPMGDRLYIGLAGLATDVQ  75

Query  287  TLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPFI  463
            T+ QRL FR  LY+L+E R +KP+TF S+VS +LYE+RFGPY+ +PVIAGL  +  +PFI
Sbjct  76   TVSQRLKFRLNLYELKEGRQIKPKTFMSMVSNLLYERRFGPYYIEPVIAGLDPKTFEPFI  135

Query  464  CTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            C++D IG   + +DFVV+GT SE +YG CE++++PD
Sbjct  136  CSLDLIGCPMVTEDFVVSGTCSEQMYGMCESLWEPD  171



>ref|XP_004282754.1| PREDICTED: proteasome subunit beta type-3 [Orcinus orca]
 ref|XP_004322694.1| PREDICTED: proteasome subunit beta type-3 [Tursiops truncatus]
Length=205

 Score =   196 bits (499),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 122/157 (78%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSIMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   + +DFVV+GT +E +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTEDFVVSGTCTEQMYGMCESLWEPN  157



>ref|NP_058981.1| proteasome subunit beta type-3 [Rattus norvegicus]
 sp|P40112.1|PSB3_RAT RecName: Full=Proteasome subunit beta type-3; AltName: Full=Proteasome 
chain 13; AltName: Full=Proteasome component C10-II; 
AltName: Full=Proteasome theta chain [Rattus norvegicus]
 dbj|BAA04824.1| proteasome subunit RC10-II [Rattus sp.]
 gb|AAH84723.1| Proteasome (prosome, macropain) subunit, beta type 3 [Rattus 
norvegicus]
 gb|EDM05874.1| rCG33987, isoform CRA_a [Rattus norvegicus]
Length=205

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 121/157 (77%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MS+  YNG A++AM GKNC AIA+DRR G+Q Q V TDF++I+ +  +L++GLAGLATDV
Sbjct  1    MSVMSYNGGAVMAMKGKNCVAIAADRRFGIQAQMVTTDFQKIFPMGDRLYIGLAGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
            QT+ QRL FR  LY+L+E R +KP T  S+V+ +LYEKRFGPY+ +PVIAGL  +  KPF
Sbjct  61   QTVAQRLKFRLNLYELKEGRQIKPYTLMSMVANLLYEKRFGPYYTEPVIAGLDPKTFKPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC++D IG   +  DFVV+GT SE +YG CE++++P+
Sbjct  121  ICSLDLIGCPMVTDDFVVSGTCSEQMYGMCESLWEPN  157



>ref|XP_011184092.1| PREDICTED: proteasome subunit beta type-3 [Bactrocera cucurbitae]
 ref|XP_011203860.1| PREDICTED: proteasome subunit beta type-3 [Bactrocera dorsalis]
Length=205

 Score =   196 bits (498),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 89/157 (57%), Positives = 116/157 (74%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG  LVAM GKNC AIA+D R G+Q QT++TDFE++++++ + FLGL GL TD+
Sbjct  1    MSIMAYNGGCLVAMRGKNCVAIATDHRFGIQAQTISTDFEKVFQVNPRTFLGLVGLQTDI  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLGDED-KPF  460
             T++ R++FR KLY+ RE R+M PE F++++S  LYE RFGPYF +PVIAGL  +  +PF
Sbjct  61   LTVHDRIMFRKKLYEDRENREMTPEPFSAMISNFLYEHRFGPYFIEPVIAGLHPKTLEPF  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG      DFVVAGT SE LYG CE ++K D
Sbjct  121  ICNMDLIGCPNKPDDFVVAGTCSEQLYGMCETLWKED  157



>ref|XP_011297407.1| PREDICTED: proteasome subunit beta type-3 [Fopius arisanus]
Length=205

 Score =   196 bits (497),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 92/157 (59%), Positives = 117/157 (75%), Gaps = 1/157 (1%)
 Frame = +2

Query  104  MSIFEYNGSALVAMVGKNCFAIASDRRLGVQLQTVATDFERIYKIHGKLFLGLAGLATDV  283
            MSI  YNG A++AM GKNC AIA+DRR G+Q QT+  DF++I+++   LFLG+ GLATDV
Sbjct  1    MSILAYNGGAMIAMKGKNCVAIAADRRFGIQAQTITCDFQKIFEMGPHLFLGIPGLATDV  60

Query  284  QTLYQRLVFRHKLYQLREERDMKPETFASLVSAILYEKRFGPYFCQPVIAGLG-DEDKPF  460
            QT+ +RL FR  LY+L+E R M P+TFAS+VS +LYEKRFG YF +PVIAGL  D  +P+
Sbjct  61   QTVMERLRFRLNLYELKENRRMHPKTFASVVSNLLYEKRFGSYFVEPVIAGLDPDTFEPY  120

Query  461  ICTMDSIGAKELAKDFVVAGTASESLYGACEAMFKPD  571
            IC MD IG      DFVV GTA + LYG CE +++PD
Sbjct  121  ICNMDLIGCLNEPDDFVVGGTAEDQLYGMCETVYEPD  157



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515