BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A07

Length=441
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDP02163.1|  unnamed protein product                              53.1    9e-15   Coffea canephora [robusta coffee]
emb|CDP05586.1|  unnamed protein product                              51.6    2e-13   Coffea canephora [robusta coffee]
ref|XP_011085797.1|  PREDICTED: uncharacterized protein LOC105167690  51.2    6e-13   
ref|XP_004232265.1|  PREDICTED: uncharacterized protein LOC101267183  49.7    4e-12   Solanum lycopersicum
gb|EYU34697.1|  hypothetical protein MIMGU_mgv1a009803mg              50.4    5e-12   Erythranthe guttata [common monkey flower]
ref|XP_009615124.1|  PREDICTED: uncharacterized protein LOC104107880  49.7    1e-11   Nicotiana tomentosiformis
ref|XP_006338516.1|  PREDICTED: uncharacterized protein LOC102605895  47.4    3e-11   Solanum tuberosum [potatoes]
emb|CDP05576.1|  unnamed protein product                              48.9    2e-08   Coffea canephora [robusta coffee]
ref|XP_008443466.1|  PREDICTED: uncharacterized protein LOC103487052  43.5    5e-08   Cucumis melo [Oriental melon]
ref|XP_011003736.1|  PREDICTED: uncharacterized protein LOC105110399  42.7    2e-07   Populus euphratica
ref|XP_006383193.1|  hypothetical protein POPTR_0005s12450g           41.2    9e-07   Populus trichocarpa [western balsam poplar]
emb|CBI34984.3|  unnamed protein product                              39.7    1e-06   Vitis vinifera
emb|CDP05577.1|  unnamed protein product                              52.4    1e-06   Coffea canephora [robusta coffee]
gb|KDP37233.1|  hypothetical protein JCGZ_06289                       39.3    2e-06   Jatropha curcas
emb|CAN73131.1|  hypothetical protein VITISV_030259                   39.7    4e-06   Vitis vinifera
ref|XP_002280785.1|  PREDICTED: uncharacterized protein LOC100262740  39.3    5e-06   Vitis vinifera
ref|XP_010524315.1|  PREDICTED: uncharacterized protein LOC104802410  38.1    8e-06   Tarenaya hassleriana [spider flower]
ref|XP_002516040.1|  conserved hypothetical protein                   39.3    2e-05   Ricinus communis
ref|XP_009147424.1|  PREDICTED: uncharacterized protein LOC103870973  39.7    2e-05   Brassica rapa
ref|XP_009335772.1|  PREDICTED: uncharacterized protein LOC103928455  41.6    3e-05   Pyrus x bretschneideri [bai li]
ref|XP_008379804.1|  PREDICTED: uncharacterized protein LOC103442775  40.8    4e-05   Malus domestica [apple tree]
emb|CDY37527.1|  BnaA05g33920D                                        39.7    6e-05   Brassica napus [oilseed rape]
ref|XP_010091951.1|  hypothetical protein L484_010517                 40.0    9e-05   Morus notabilis
ref|XP_010087310.1|  hypothetical protein L484_000467                 40.0    9e-05   Morus notabilis
ref|XP_004147448.1|  PREDICTED: uncharacterized protein LOC101220065  38.9    1e-04   Cucumis sativus [cucumbers]
ref|XP_009758758.1|  PREDICTED: uncharacterized protein LOC104211408  50.4    1e-04   Nicotiana sylvestris
ref|XP_010463533.1|  PREDICTED: uncharacterized protein LOC104744220  39.3    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004164653.1|  PREDICTED: uncharacterized LOC101220065          38.9    1e-04   
ref|XP_010264858.1|  PREDICTED: uncharacterized protein LOC104602755  41.2    2e-04   Nelumbo nucifera [Indian lotus]
ref|NP_186785.1|  uncharacterized protein                             39.7    3e-04   Arabidopsis thaliana [mouse-ear cress]
emb|CDY49048.1|  BnaC05g48760D                                        39.7    3e-04   Brassica napus [oilseed rape]
gb|KFK37596.1|  hypothetical protein AALP_AA3G003700                  35.0    6e-04   Arabis alpina [alpine rockcress]
ref|XP_010499187.1|  PREDICTED: uncharacterized protein LOC104776...  39.3    7e-04   Camelina sativa [gold-of-pleasure]



>emb|CDP02163.1| unnamed protein product [Coffea canephora]
Length=340

 Score = 53.1 bits (126),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKVT  190
            MGLF+YT+AGGGFI+IGAWE+F SS E ++ T
Sbjct  1    MGLFTYTIAGGGFILIGAWESFVSSSECIRNT  32


 Score = 53.1 bits (126),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 46/77 (60%), Positives = 57/77 (74%), Gaps = 5/77 (6%)
 Frame = +1

Query  220  SISGHN-----TPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEV  384
            +ISG N     T K+   SSS T L+ SVLSFLFI+NSLISISDA++S+D VG   QLEV
Sbjct  43   AISGINNSSTQTKKAPPFSSSVTCLSISVLSFLFILNSLISISDALNSKDHVGFAFQLEV  102

Query  385  ISISLLFILYSVVGFFS  435
            I+I+LLF LYS +G F+
Sbjct  103  IAIALLFFLYSTLGLFT  119



>emb|CDP05586.1| unnamed protein product [Coffea canephora]
Length=202

 Score = 51.6 bits (122),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/71 (59%), Positives = 52/71 (73%), Gaps = 0/71 (0%)
 Frame = +1

Query  226  SGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLF  405
            S   T K+   SSS T L+ SVLSF FI+NSLISISDA++S+D VG   QLEVI+I+LLF
Sbjct  50   SSTQTKKAPLSSSSVTCLSTSVLSFFFILNSLISISDALNSKDHVGFAFQLEVIAIALLF  109

Query  406  ILYSVVGFFSR  438
             LYS +G F+ 
Sbjct  110  FLYSTLGLFAH  120


 Score = 50.1 bits (118),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 21/32 (66%), Positives = 27/32 (84%), Gaps = 0/32 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKVT  190
            MGLF+YT+A GGFI+IGAWE+F SS E ++ T
Sbjct  1    MGLFTYTIACGGFILIGAWESFVSSSECIQNT  32



>ref|XP_011085797.1| PREDICTED: uncharacterized protein LOC105167690 [Sesamum indicum]
 ref|XP_011085798.1| PREDICTED: uncharacterized protein LOC105167690 [Sesamum indicum]
Length=337

 Score = 51.2 bits (121),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 36/65 (55%), Positives = 52/65 (80%), Gaps = 0/65 (0%)
 Frame = +1

Query  232  HNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFIL  411
            + TPK+   SS+ TFL  SVLSFL I+NS +S+SDA++S+D+ G  +QLEVI+I+ LF+L
Sbjct  49   NRTPKAPSFSSTVTFLLISVLSFLSILNSFVSMSDAVNSKDNTGFALQLEVITIAFLFLL  108

Query  412  YSVVG  426
            Y+V+G
Sbjct  109  YAVLG  113


 Score = 48.9 bits (115),  Expect(2) = 6e-13, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLF+YTVAGGG I+IGAWE+  SS E LK
Sbjct  1    MGLFTYTVAGGGLILIGAWESLISSSEYLK  30



>ref|XP_004232265.1| PREDICTED: uncharacterized protein LOC101267183 [Solanum lycopersicum]
Length=336

 Score = 49.7 bits (117),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLFSYTVAGGGFI+IGAWE+  SS   LK
Sbjct  1    MGLFSYTVAGGGFILIGAWESLVSSSGALK  30


 Score = 47.4 bits (111),  Expect(2) = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  259  SSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSR  438
            SSS TF+   +LSFLF+++SL+S  DA++S+D++G V+QL+VI+ISLLF LYSV+G  +R
Sbjct  57   SSSVTFVLILILSFLFVLDSLLSFFDALNSKDNIGSVLQLQVIAISLLFFLYSVLGLMTR  116



>gb|EYU34697.1| hypothetical protein MIMGU_mgv1a009803mg [Erythranthe guttata]
Length=331

 Score = 50.4 bits (119),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 39/67 (58%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  241  PKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSV  420
            P ++  SS+ TFL  SVLS LFIVNS IS+SDA++S+DDVG  +QLEVI+I  LF+LYS+
Sbjct  48   PGTSSFSSTVTFLLISVLSILFIVNSFISLSDAVASDDDVGFALQLEVIAIGFLFLLYSL  107

Query  421  VGFFSRS  441
            +G  S +
Sbjct  108  LGILSNT  114


 Score = 46.6 bits (109),  Expect(2) = 5e-12, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKVT  190
            MGLF+YTVAGG  I++GAWE+  S+ E+LK T
Sbjct  1    MGLFTYTVAGGALILLGAWESVISASESLKQT  32



>ref|XP_009615124.1| PREDICTED: uncharacterized protein LOC104107880 [Nicotiana tomentosiformis]
Length=330

 Score = 49.7 bits (117),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLFSYTVAGGGFI++GAWE+  SS   LK
Sbjct  1    MGLFSYTVAGGGFILVGAWESLISSSAALK  30


 Score = 46.2 bits (108),  Expect(2) = 1e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 49/60 (82%), Gaps = 0/60 (0%)
 Frame = +1

Query  259  SSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSR  438
            SS  TF++  +LSFLFI+NSL+S  DA++S+D +G V+QL+VI+ISLLF+LYSV+G  + 
Sbjct  52   SSLITFVSILILSFLFILNSLLSFFDALNSKDQIGSVLQLQVIAISLLFLLYSVLGLMTH  111



>ref|XP_006338516.1| PREDICTED: uncharacterized protein LOC102605895 [Solanum tuberosum]
Length=336

 Score = 47.4 bits (111),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 22/30 (73%), Positives = 24/30 (80%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLF YTVAGGGFI+IGAWE+  SS   LK
Sbjct  1    MGLFGYTVAGGGFILIGAWESLVSSSGALK  30


 Score = 47.0 bits (110),  Expect(2) = 3e-11, Method: Compositional matrix adjust.
 Identities = 34/60 (57%), Positives = 50/60 (83%), Gaps = 0/60 (0%)
 Frame = +1

Query  259  SSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSR  438
            SSS TF+   +LSFLF+++SL+S  DA++S+D++G V+QL+VI+ISLLF LYSV+G  +R
Sbjct  57   SSSITFVLILILSFLFVLDSLLSFFDALNSKDNIGSVLQLQVIAISLLFFLYSVLGLMTR  116



>emb|CDP05576.1| unnamed protein product [Coffea canephora]
Length=200

 Score = 48.9 bits (115),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 20/32 (63%), Positives = 26/32 (81%), Gaps = 0/32 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKVT  190
            MGLF+YT+ GGGF++IGAWE F SS E ++ T
Sbjct  1    MGLFTYTITGGGFMLIGAWELFVSSSECIQNT  32


 Score = 35.8 bits (81),  Expect(2) = 2e-08, Method: Compositional matrix adjust.
 Identities = 36/60 (60%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  226  SGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLF  405
            S   T K+   SSS T L+ SVL FLFI+NSLISISDA++S+D V    QLEVI+I+LLF
Sbjct  50   SSTQTKKAPLSSSSVTCLSISVLFFLFILNSLISISDALNSKDHVSFAFQLEVIAIALLF  109



>ref|XP_008443466.1| PREDICTED: uncharacterized protein LOC103487052 [Cucumis melo]
Length=327

 Score = 43.5 bits (101),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 38/88 (43%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +1

Query  163  IVQRNLEGDatatvtagtaSISGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdai  342
            I   N +  +++  T  T S S H+T K+   SSS +F+   +LSFL I+NSL+S  DA+
Sbjct  28   IANSNPDASSSSLNTVQTPSQSPHSTAKTAPSSSSLSFIFAFLLSFLVILNSLVSFFDAV  87

Query  343  sseddVGVVIQLEVISISLLFILYSVVG  426
            +S D VG  +QL V++I+ LF+LYS++G
Sbjct  88   NSSDRVGSTLQLPVLAIASLFLLYSILG  115


 Score = 40.0 bits (92),  Expect(2) = 5e-08, Method: Compositional matrix adjust.
 Identities = 16/24 (67%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFAS  166
            MG F+ +VAGGGF++IGAWEA +S
Sbjct  1    MGFFTLSVAGGGFLLIGAWEALSS  24



>ref|XP_011003736.1| PREDICTED: uncharacterized protein LOC105110399 [Populus euphratica]
Length=325

 Score = 42.7 bits (99),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 19/25 (76%), Positives = 22/25 (88%), Gaps = 0/25 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASS  169
            MGLFS T+AG GFI+IGAWE+ ASS
Sbjct  1    MGLFSMTLAGSGFILIGAWESIASS  25


 Score = 38.9 bits (89),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 50/73 (68%), Gaps = 6/73 (8%)
 Frame = +1

Query  235  NTPKSTR------ISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISIS  396
             TPKS         SSSA ++  ++ S LFIVNSLIS+ +A++S D VG  +QL++++++
Sbjct  43   QTPKSAAQRNSNSSSSSANYITVTIFSLLFIVNSLISLFNAVNSRDQVGSALQLQILAVA  102

Query  397  LLFILYSVVGFFS  435
             LF+LYSV+G  S
Sbjct  103  ALFLLYSVLGLLS  115



>ref|XP_006383193.1| hypothetical protein POPTR_0005s12450g [Populus trichocarpa]
 gb|ERP60990.1| hypothetical protein POPTR_0005s12450g [Populus trichocarpa]
Length=325

 Score = 41.2 bits (95),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 21/25 (84%), Gaps = 0/25 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASS  169
            MGLFS T+AG GFI+IGAWE+  SS
Sbjct  1    MGLFSMTLAGSGFILIGAWESLTSS  25


 Score = 37.7 bits (86),  Expect(2) = 9e-07, Method: Compositional matrix adjust.
 Identities = 32/73 (44%), Positives = 49/73 (67%), Gaps = 6/73 (8%)
 Frame = +1

Query  235  NTPKSTR------ISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISIS  396
             TPKS         SSSA ++  ++ S LFIVNSLIS  +A++S D VG  +QL++++++
Sbjct  43   QTPKSATQRNSNSSSSSANYITVTIFSLLFIVNSLISFFNAVNSRDQVGSALQLQILAVA  102

Query  397  LLFILYSVVGFFS  435
             LF+LYSV+G  +
Sbjct  103  ALFLLYSVLGLLT  115



>emb|CBI34984.3| unnamed protein product [Vitis vinifera]
Length=682

 Score = 39.7 bits (91),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 44/60 (73%), Gaps = 0/60 (0%)
 Frame = +1

Query  259  SSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSR  438
            SS  TF + ++LSF FI NSL S+ DA++S+D VG  +QL+V++ + LF+LY+V+G   +
Sbjct  61   SSPLTFFSIALLSFFFICNSLYSLIDAVNSKDRVGSPLQLQVLATAFLFLLYAVLGLLMK  120


 Score = 38.9 bits (89),  Expect(2) = 1e-06, Method: Composition-based stats.
 Identities = 17/33 (52%), Positives = 23/33 (70%), Gaps = 0/33 (0%)
 Frame = +2

Query  89   STMGLFSYTVAGGGFIMIGAWEAFASSKETLKV  187
            S MG F+  +AG GFI+IG WE+  SS +T K+
Sbjct  11   SAMGFFTLVLAGVGFILIGMWESLLSSSQTPKL  43



>emb|CDP05577.1| unnamed protein product [Coffea canephora]
Length=161

 Score = 52.4 bits (124),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 22/32 (69%), Positives = 28/32 (88%), Gaps = 0/32 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKVT  190
            MGLF+YT+AGGGFI+IGAWE+F SS E ++ T
Sbjct  1    MGLFTYTIAGGGFILIGAWESFVSSSECIQNT  32


 Score = 26.6 bits (57),  Expect(2) = 1e-06, Method: Compositional matrix adjust.
 Identities = 29/52 (56%), Positives = 36/52 (69%), Gaps = 0/52 (0%)
 Frame = +1

Query  226  SGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLE  381
            S   T K+   SSS T ++ SVLSF FI+NSLI ISDA++S+D VG   QLE
Sbjct  50   SSTQTKKAPLSSSSVTCISISVLSFFFILNSLIFISDALNSKDHVGFAFQLE  101



>gb|KDP37233.1| hypothetical protein JCGZ_06289 [Jatropha curcas]
Length=331

 Score = 39.3 bits (90),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETL  181
            MGLFS T+AGG F++IGA+E+  SS   L
Sbjct  1    MGLFSLTMAGGAFLLIGAYESLTSSSSNL  29


 Score = 38.5 bits (88),  Expect(2) = 2e-06, Method: Compositional matrix adjust.
 Identities = 31/67 (46%), Positives = 47/67 (70%), Gaps = 1/67 (1%)
 Frame = +1

Query  238  TPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYS  417
             PKS   SSS  ++  +V SFLF ++SL S+ +AI+ +D +G  IQL+V++IS LF+LYS
Sbjct  53   NPKS-HSSSSFFYILIAVFSFLFAIDSLFSLFNAINMQDGIGSAIQLQVLAISALFLLYS  111

Query  418  VVGFFSR  438
            ++G  S 
Sbjct  112  ILGLVSN  118



>emb|CAN73131.1| hypothetical protein VITISV_030259 [Vitis vinifera]
Length=318

 Score = 39.7 bits (91),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  226  SGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLF  405
             G    +    SS  TF + ++LSF FI NSL S+ DA++S+D VG  +QL+V++ + LF
Sbjct  38   PGTRPGRKYPYSSPLTFFSIALLSFFFICNSLYSLIDAVNSKDRVGSPLQLQVLATAFLF  97

Query  406  ILYSVVGFFSR  438
            +LY+V+G   +
Sbjct  98   LLYAVLGLLXK  108


 Score = 37.0 bits (84),  Expect(2) = 4e-06, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKV  187
            MG F+  +AG GFI+IG WE+  SS +T K+
Sbjct  1    MGFFTLVLAGVGFILIGMWESLLSSSQTPKL  31



>ref|XP_002280785.1| PREDICTED: uncharacterized protein LOC100262740 [Vitis vinifera]
 ref|XP_010660975.1| PREDICTED: uncharacterized protein LOC100262740 [Vitis vinifera]
 ref|XP_010660976.1| PREDICTED: uncharacterized protein LOC100262740 [Vitis vinifera]
 ref|XP_010660977.1| PREDICTED: uncharacterized protein LOC100262740 [Vitis vinifera]
Length=318

 Score = 39.3 bits (90),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 29/71 (41%), Positives = 46/71 (65%), Gaps = 0/71 (0%)
 Frame = +1

Query  226  SGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLF  405
             G    +    SS  TF + ++LSF FI NSL S+ DA++S+D VG  +QL+V++ + LF
Sbjct  38   PGTRPGRKYPYSSPLTFFSIALLSFFFICNSLYSLIDAVNSKDRVGSPLQLQVLATAFLF  97

Query  406  ILYSVVGFFSR  438
            +LY+V+G   +
Sbjct  98   LLYAVLGLLMK  108


 Score = 37.0 bits (84),  Expect(2) = 5e-06, Method: Compositional matrix adjust.
 Identities = 16/31 (52%), Positives = 22/31 (71%), Gaps = 0/31 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLKV  187
            MG F+  +AG GFI+IG WE+  SS +T K+
Sbjct  1    MGFFTLVLAGVGFILIGMWESLLSSSQTPKL  31



>ref|XP_010524315.1| PREDICTED: uncharacterized protein LOC104802410 [Tarenaya hassleriana]
Length=326

 Score = 38.1 bits (87),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 16/26 (62%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MGL +Y VAGGGF ++GAWE+  SS 
Sbjct  1    MGLLAYAVAGGGFTVMGAWESLDSSN  26


 Score = 37.4 bits (85),  Expect(2) = 8e-06, Method: Compositional matrix adjust.
 Identities = 28/67 (42%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +1

Query  241  PKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSV  420
            PK  R SS A     ++ S LF+VNS+ S   +  S D VG V+QL++++I+ LF+ YS+
Sbjct  53   PKPVRSSSVAV----ALFSSLFVVNSIFSFFSSFGSHDRVGSVLQLQILAIAALFLGYSI  108

Query  421  VGFFSRS  441
            +GF   S
Sbjct  109  LGFLVNS  115



>ref|XP_002516040.1| conserved hypothetical protein [Ricinus communis]
 gb|EEF46460.1| conserved hypothetical protein [Ricinus communis]
Length=318

 Score = 39.3 bits (90),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 4/69 (6%)
 Frame = +1

Query  232  HNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFIL  411
               PK      S  ++  +V SFLFI++SLIS+ +AI S+D +G  +QL+V++I+ LF+L
Sbjct  41   EKNPKG----QSLIYIGITVFSFLFIIDSLISLFNAIDSKDTIGYALQLQVLAIAALFLL  96

Query  412  YSVVGFFSR  438
            YS++G  S+
Sbjct  97   YSILGLLSK  105


 Score = 35.0 bits (79),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 15/20 (75%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWE  154
            MGLFS TVAG GF++IGA+E
Sbjct  1    MGLFSLTVAGAGFMLIGAYE  20



>ref|XP_009147424.1| PREDICTED: uncharacterized protein LOC103870973 [Brassica rapa]
Length=315

 Score = 39.7 bits (91),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 34.7 bits (78),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +1

Query  241  PKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSV  420
            PKST  SS+      ++LS LFI NS+ S   +I S D VG ++QL+++++++LF++Y+V
Sbjct  44   PKSTGSSSTPV----ALLSSLFIANSIYSFFSSIGSSDRVGSMLQLQILAVAVLFLVYAV  99

Query  421  V  423
            V
Sbjct  100  V  100



>ref|XP_009335772.1| PREDICTED: uncharacterized protein LOC103928455 [Pyrus x bretschneideri]
Length=333

 Score = 41.6 bits (96),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 29/69 (42%), Positives = 47/69 (68%), Gaps = 0/69 (0%)
 Frame = +1

Query  232  HNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFIL  411
             +  K+   SSS  +LA +V+S LFI+NSL+S  DA+ S D VG  +QL+V++++ LF+L
Sbjct  53   QSKAKTQSRSSSIYYLAAAVISLLFILNSLVSFFDALDSADGVGSAMQLQVLAVASLFLL  112

Query  412  YSVVGFFSR  438
            Y++ G   +
Sbjct  113  YAITGLLVK  121


 Score = 32.3 bits (72),  Expect(2) = 3e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKET  178
            MG  ++  AGGG I++GA+EA +SS + 
Sbjct  1    MGFLTFAAAGGGLILMGAYEAISSSIQN  28



>ref|XP_008379804.1| PREDICTED: uncharacterized protein LOC103442775 [Malus domestica]
 ref|XP_008357887.1| PREDICTED: uncharacterized protein LOC103421621 [Malus domestica]
Length=330

 Score = 40.8 bits (94),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 29/65 (45%), Positives = 46/65 (71%), Gaps = 0/65 (0%)
 Frame = +1

Query  244  KSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVV  423
            K+   SSS  +LA +V+S LFI+NSL+S  DA+ S D VG  +QL+V++++ LF+LY++ 
Sbjct  54   KTQSRSSSIYYLAAAVVSLLFILNSLVSFFDALDSADGVGSAMQLQVLAVASLFLLYAIT  113

Query  424  GFFSR  438
            G   +
Sbjct  114  GLLVK  118


 Score = 32.3 bits (72),  Expect(2) = 4e-05, Method: Compositional matrix adjust.
 Identities = 13/28 (46%), Positives = 20/28 (71%), Gaps = 0/28 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKET  178
            MG  ++  AGGG I++GA+EA +SS + 
Sbjct  1    MGFLTFAAAGGGLILMGAYEAISSSIQN  28



>emb|CDY37527.1| BnaA05g33920D [Brassica napus]
Length=315

 Score = 39.7 bits (91),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 33.5 bits (75),  Expect(2) = 6e-05, Method: Compositional matrix adjust.
 Identities = 26/61 (43%), Positives = 43/61 (70%), Gaps = 4/61 (7%)
 Frame = +1

Query  241  PKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSV  420
            PKST  SS    +  ++LS LFI NS+ S   +I S D VG ++QL+++++++LF++Y+V
Sbjct  44   PKSTGSSS----IPVALLSSLFIANSIYSFFSSIGSSDRVGSMLQLQILAVAVLFLVYAV  99

Query  421  V  423
            V
Sbjct  100  V  100



>ref|XP_010091951.1| hypothetical protein L484_010517 [Morus notabilis]
 gb|EXB47731.1| hypothetical protein L484_010517 [Morus notabilis]
Length=332

 Score = 40.0 bits (92),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  274  FLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVG  426
            FL  SV SFLFI+NSL S  DA+ S D VG  +QL+V++I+ LF+LY V G
Sbjct  60   FLCISVFSFLFILNSLFSFVDALKSRDRVGTALQLQVLAIAALFLLYGVAG  110


 Score = 32.3 bits (72),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASS  169
            MG F+  + G GFI IGAW+AF  S
Sbjct  1    MGFFTLAIGGLGFIFIGAWQAFTFS  25



>ref|XP_010087310.1| hypothetical protein L484_000467 [Morus notabilis]
 gb|EXC35734.1| hypothetical protein L484_000467 [Morus notabilis]
Length=332

 Score = 40.0 bits (92),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 29/51 (57%), Positives = 37/51 (73%), Gaps = 0/51 (0%)
 Frame = +1

Query  274  FLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVG  426
            FL  SV SFLFI+NSL S  DA+ S D VG  +QL+V++I+ LF+LY V G
Sbjct  60   FLCISVFSFLFILNSLFSFIDALKSRDRVGTALQLQVLAIAALFLLYGVAG  110


 Score = 32.3 bits (72),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 0/25 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASS  169
            MG F+  + G GFI IGAW+AF  S
Sbjct  1    MGFFTLAIGGLGFIFIGAWQAFTFS  25



>ref|XP_004147448.1| PREDICTED: uncharacterized protein LOC101220065 [Cucumis sativus]
 gb|KGN59624.1| hypothetical protein Csa_3G829140 [Cucumis sativus]
Length=329

 Score = 38.9 bits (89),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFAS  166
            MG F+ +VAGGGF++IG+WEA +S
Sbjct  1    MGFFTLSVAGGGFLLIGSWEALSS  24


 Score = 33.1 bits (74),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  235  NTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILY  414
            +T K    SSS +F+   +LSFL I+NSL+S  DA++S D VG  +QL V++I+ LF+LY
Sbjct  52   STAKIASSSSSLSFIFAFLLSFLVILNSLVSFLDALNSSDRVGSTLQLPVLAIASLFLLY  111

Query  415  SVVGFF  432
            S++G  
Sbjct  112  SILGLL  117



>ref|XP_009758758.1| PREDICTED: uncharacterized protein LOC104211408 [Nicotiana sylvestris]
Length=330

 Score = 50.4 bits (119),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 23/30 (77%), Positives = 25/30 (83%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLFSYTVAGGGFI+IGAWE+  SS   LK
Sbjct  1    MGLFSYTVAGGGFILIGAWESLISSSAALK  30



>ref|XP_010463533.1| PREDICTED: uncharacterized protein LOC104744220 [Camelina sativa]
Length=316

 Score = 39.3 bits (90),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 32.3 bits (72),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 27/69 (39%), Positives = 48/69 (70%), Gaps = 4/69 (6%)
 Frame = +1

Query  223  ISGHNTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLL  402
            ISG + PKS   SSS   +  ++LS LFI NS+ +   +I S D VG +IQL+++++++L
Sbjct  40   ISG-SPPKSVGSSSS---IPVALLSSLFIANSIFTFFSSIGSHDRVGSMIQLQILAVAVL  95

Query  403  FILYSVVGF  429
            F++Y+++ +
Sbjct  96   FLVYAILTY  104



>ref|XP_004164653.1| PREDICTED: uncharacterized LOC101220065 [Cucumis sativus]
Length=329

 Score = 38.9 bits (89),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 15/24 (63%), Positives = 21/24 (88%), Gaps = 0/24 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFAS  166
            MG F+ +VAGGGF++IG+WEA +S
Sbjct  1    MGFFTLSVAGGGFLLIGSWEALSS  24


 Score = 32.7 bits (73),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 31/66 (47%), Positives = 46/66 (70%), Gaps = 0/66 (0%)
 Frame = +1

Query  235  NTPKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILY  414
            +T K    SSS +F+   +LSFL I+NSL+S  DA++S D VG  +QL V++I+ LF+LY
Sbjct  52   STAKIASSSSSLSFIFAFLLSFLVILNSLVSFLDALNSGDRVGSTLQLPVLAIASLFLLY  111

Query  415  SVVGFF  432
            S++G  
Sbjct  112  SILGLL  117



>ref|XP_010264858.1| PREDICTED: uncharacterized protein LOC104602755 [Nelumbo nucifera]
Length=333

 Score = 41.2 bits (95),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%), Gaps = 0/30 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSKETLK  184
            MGLF+Y +AGGG ++IGAWEA  SS   L 
Sbjct  1    MGLFTYCLAGGGLMLIGAWEALISSYAHLN  30


 Score = 30.0 bits (66),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 31/56 (55%), Positives = 42/56 (75%), Gaps = 0/56 (0%)
 Frame = +1

Query  259  SSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVG  426
            SSS +F+A SV SF FI NSL+S+ DA+ + D VG  +QLE+I++  LF+LYS VG
Sbjct  59   SSSVSFIAVSVFSFFFIFNSLVSLIDALHANDGVGFALQLEIIALVSLFLLYSAVG  114



>ref|NP_186785.1| uncharacterized protein [Arabidopsis thaliana]
 ref|NP_001030617.1| uncharacterized protein [Arabidopsis thaliana]
 gb|AAF03491.1|AC010676_1 hypothetical protein [Arabidopsis thaliana]
 gb|AAS49094.1| At3g01360 [Arabidopsis thaliana]
 dbj|BAF01367.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE73655.1| uncharacterized protein AT3G01360 [Arabidopsis thaliana]
 gb|AEE73656.1| uncharacterized protein AT3G01360 [Arabidopsis thaliana]
Length=319

 Score = 39.7 bits (91),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 42/67 (63%), Gaps = 4/67 (6%)
 Frame = +1

Query  241  PKSTRISSSATFLAGSVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSV  420
            PKS   SS    +  ++LS LFI NS  S   +I S D VG +IQL+++++++LF+ Y++
Sbjct  50   PKSVGSSS----IPVALLSSLFIANSFFSFFSSIGSRDRVGSMIQLQIVAVAVLFLYYAI  105

Query  421  VGFFSRS  441
            + +   S
Sbjct  106  LTYLVNS  112



>emb|CDY49048.1| BnaC05g48760D [Brassica napus]
Length=315

 Score = 39.7 bits (91),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 31.2 bits (69),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/68 (37%), Positives = 43/68 (63%), Gaps = 6/68 (9%)
 Frame = +1

Query  238  TPKSTRISSSATFLAGS------VLSFLFIVNslisisdaisseddVGVVIQLEVISISL  399
            +P + +I+ S     GS      +LS LFI NS+ S   +I S D VG ++QL++++++ 
Sbjct  39   SPMTAQITPSPPKSVGSSSVPVALLSSLFIANSIYSFFSSIGSSDRVGSMLQLQMLAVAA  98

Query  400  LFILYSVV  423
            LF++Y+VV
Sbjct  99   LFLVYAVV  106



>gb|KFK37596.1| hypothetical protein AALP_AA3G003700 [Arabis alpina]
Length=306

 Score = 35.0 bits (79),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/26 (54%), Positives = 18/26 (69%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG  SY ++GGGF +IG WE+  SS 
Sbjct  1    MGFLSYAISGGGFAVIGIWESLDSSN  26


 Score = 34.3 bits (77),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 39/52 (75%), Gaps = 0/52 (0%)
 Frame = +1

Query  286  SVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSRS  441
            ++LS LFI+N++ S   +I S D VG +IQL+++SI++LF+LY+++ +   S
Sbjct  53   ALLSSLFIINAIFSFFTSIGSHDRVGSMIQLQILSIAILFLLYAILTYLVNS  104



>ref|XP_010499187.1| PREDICTED: uncharacterized protein LOC104776450 isoform X1 [Camelina 
sativa]
 ref|XP_010499896.1| PREDICTED: uncharacterized protein LOC104776450 isoform X2 [Camelina 
sativa]
Length=321

 Score = 39.3 bits (90),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 17/26 (65%), Positives = 20/26 (77%), Gaps = 0/26 (0%)
 Frame = +2

Query  95   MGLFSYTVAGGGFIMIGAWEAFASSK  172
            MG+ SY VAGGGF +IGAWE+  SS 
Sbjct  1    MGILSYAVAGGGFAVIGAWESLDSSN  26


 Score = 30.0 bits (66),  Expect(2) = 7e-04, Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 38/52 (73%), Gaps = 0/52 (0%)
 Frame = +1

Query  286  SVLSFLFIVNslisisdaisseddVGVVIQLEVISISLLFILYSVVGFFSRS  441
            ++LS LFI NS+ S   +I S D VG +IQL+++++++LF++Y+++ +   S
Sbjct  62   ALLSSLFIANSIFSFFSSIGSHDRVGSMIQLQILAVAVLFLVYAILTYLVNS  113



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 560109397860