BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A06

Length=572
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO99748.1|  unnamed protein product                                109   2e-33   Coffea canephora [robusta coffee]
ref|XP_009598426.1|  PREDICTED: GATA transcription factor 8-like        109   1e-32   Nicotiana tomentosiformis
dbj|BAC98491.1|  AG-motif binding protein-1                             109   1e-32   Nicotiana tabacum [American tobacco]
ref|XP_009760862.1|  PREDICTED: GATA transcription factor 8-like        110   4e-32   Nicotiana sylvestris
ref|XP_006350222.1|  PREDICTED: GATA transcription factor 8-like ...    109   3e-31   Solanum tuberosum [potatoes]
ref|XP_009802378.1|  PREDICTED: GATA transcription factor 8-like        109   5e-31   Nicotiana sylvestris
ref|XP_009605437.1|  PREDICTED: GATA transcription factor 8-like        106   6e-31   Nicotiana tomentosiformis
ref|XP_011076972.1|  PREDICTED: GATA transcription factor 8-like        102   2e-30   Sesamum indicum [beniseed]
ref|XP_009628969.1|  PREDICTED: LOW QUALITY PROTEIN: GATA transcr...    122   8e-30   
ref|XP_004236632.1|  PREDICTED: GATA transcription factor 8             106   1e-29   Solanum lycopersicum
ref|XP_004239665.1|  PREDICTED: GATA transcription factor 8-like ...    115   3e-27   Solanum lycopersicum
ref|XP_004239666.1|  PREDICTED: GATA transcription factor 8-like ...    115   3e-27   Solanum lycopersicum
ref|XP_004239667.2|  PREDICTED: GATA transcription factor 8-like ...    116   3e-27   Solanum lycopersicum
ref|XP_011084325.1|  PREDICTED: GATA transcription factor 8           92.0    6e-27   Sesamum indicum [beniseed]
ref|XP_006345791.1|  PREDICTED: GATA transcription factor 8-like ...    114   6e-27   Solanum tuberosum [potatoes]
dbj|BAC98495.1|  AG-motif binding protein-5                             107   4e-24   Nicotiana tabacum [American tobacco]
ref|XP_002273502.1|  PREDICTED: GATA transcription factor 8-like      83.2    7e-24   Vitis vinifera
emb|CBI31452.3|  unnamed protein product                              82.8    2e-23   Vitis vinifera
gb|EYU39843.1|  hypothetical protein MIMGU_mgv1a010405mg              70.1    3e-20   Erythranthe guttata [common monkey flower]
gb|KDO44680.1|  hypothetical protein CISIN_1g016706mg                 65.5    3e-18   Citrus sinensis [apfelsine]
ref|XP_006436435.1|  hypothetical protein CICLE_v10032018mg           65.1    3e-18   
gb|EYU39605.1|  hypothetical protein MIMGU_mgv1a011769mg              63.9    2e-17   Erythranthe guttata [common monkey flower]
ref|XP_004142426.1|  PREDICTED: GATA transcription factor 9-like      60.5    5e-17   Cucumis sativus [cucumbers]
ref|XP_008446884.1|  PREDICTED: GATA transcription factor 8           61.2    2e-16   Cucumis melo [Oriental melon]
ref|XP_007143712.1|  hypothetical protein PHAVU_007G095300g           59.3    4e-16   Phaseolus vulgaris [French bean]
ref|XP_006606248.1|  PREDICTED: GATA transcription factor 8-like ...  58.2    5e-16   Glycine max [soybeans]
gb|KDP44375.1|  hypothetical protein JCGZ_20055                       59.3    5e-16   Jatropha curcas
ref|XP_002534043.1|  GATA transcription factor, putative              58.2    5e-16   Ricinus communis
ref|XP_007009854.1|  Plant-specific GATA-type zinc finger transcr...  57.0    5e-16   
ref|XP_003556234.1|  PREDICTED: GATA transcription factor 8-like ...  58.2    1e-15   Glycine max [soybeans]
ref|XP_007009853.1|  Plant-specific GATA-type zinc finger transcr...  55.8    2e-15   
ref|XP_003536350.1|  PREDICTED: GATA transcription factor 8-like ...  55.5    6e-15   
ref|XP_004496271.1|  PREDICTED: GATA transcription factor 8-like ...  59.7    6e-15   Cicer arietinum [garbanzo]
gb|KHN17141.1|  GATA transcription factor 9                           55.5    9e-15   Glycine soja [wild soybean]
gb|KJB73559.1|  hypothetical protein B456_011G238800                  53.1    1e-14   Gossypium raimondii
gb|KHG18876.1|  GATA transcription factor 8 -like protein             52.8    3e-14   Gossypium arboreum [tree cotton]
ref|XP_010092608.1|  GATA transcription factor 9                      58.9    7e-14   Morus notabilis
ref|XP_006574762.1|  PREDICTED: GATA transcription factor 8-like ...  52.0    7e-14   Glycine max [soybeans]
ref|XP_003548072.1|  PREDICTED: GATA transcription factor 8-like ...  55.1    7e-14   Glycine max [soybeans]
emb|CDP19135.1|  unnamed protein product                              57.8    8e-14   Coffea canephora [robusta coffee]
ref|XP_003519961.2|  PREDICTED: GATA transcription factor 8-like ...  52.0    9e-14   Glycine max [soybeans]
ref|XP_010032183.1|  PREDICTED: GATA transcription factor 8-like ...  63.9    2e-13   Eucalyptus grandis [rose gum]
ref|XP_010683872.1|  PREDICTED: GATA transcription factor 8           60.1    5e-13   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009770305.1|  PREDICTED: GATA transcription factor 8-like      70.1    2e-11   Nicotiana sylvestris
gb|KJB60582.1|  hypothetical protein B456_009G313700                  53.1    5e-11   Gossypium raimondii
gb|KHG25368.1|  GATA transcription factor 8 -like protein             52.4    2e-10   Gossypium arboreum [tree cotton]
gb|EPS57112.1|  hypothetical protein M569_17713                       47.4    8e-09   Genlisea aurea
ref|XP_010264666.1|  PREDICTED: GATA transcription factor 8-like      52.0    1e-08   Nelumbo nucifera [Indian lotus]
ref|XP_010253699.1|  PREDICTED: GATA transcription factor 8-like      49.3    2e-07   Nelumbo nucifera [Indian lotus]
ref|XP_010554544.1|  PREDICTED: GATA transcription factor 8-like      43.1    2e-07   Tarenaya hassleriana [spider flower]
gb|ACJ02090.1|  AG-motif binding protein                              59.3    2e-07   Garcinia mangostana [mangosteen]
ref|XP_002311088.1|  zinc finger family protein                       53.9    2e-05   Populus trichocarpa [western balsam poplar]
dbj|BAP90356.1|  GATA type zinc finger domain                         53.5    2e-05   Populus nigra [black poplar]
ref|XP_006378769.1|  hypothetical protein POPTR_0010s23010g           53.5    2e-05   
ref|XP_011031733.1|  PREDICTED: GATA transcription factor 8-like      53.5    2e-05   Populus euphratica
ref|XP_011041012.1|  PREDICTED: GATA transcription factor 8-like      53.5    2e-05   Populus euphratica
dbj|BAH20385.1|  AT3G54810                                            37.4    2e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010427201.1|  PREDICTED: GATA transcription factor 8-like ...  37.7    2e-05   Camelina sativa [gold-of-pleasure]
emb|CDY67017.1|  BnaCnng53150D                                        38.1    2e-05   Brassica napus [oilseed rape]
ref|XP_007218229.1|  hypothetical protein PRUPE_ppa007936mg           52.8    4e-05   Prunus persica
ref|XP_007151876.1|  hypothetical protein PHAVU_004G083100g           52.8    4e-05   Phaseolus vulgaris [French bean]
ref|XP_009345388.1|  PREDICTED: GATA transcription factor 8-like      52.8    4e-05   Pyrus x bretschneideri [bai li]
ref|XP_010032187.1|  PREDICTED: GATA transcription factor 8-like ...  52.0    6e-05   Eucalyptus grandis [rose gum]
ref|XP_008233316.1|  PREDICTED: GATA transcription factor 8           52.4    6e-05   Prunus mume [ume]
ref|XP_006591215.1|  PREDICTED: VHS domain-containing protein At3...  51.6    8e-05   
ref|XP_002876270.1|  BME3/BME3-ZF                                     37.0    8e-05   
ref|NP_191041.1|  GATA transcription factor 8                         37.4    9e-05   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009344766.1|  PREDICTED: GATA transcription factor 8-like      51.6    1e-04   Pyrus x bretschneideri [bai li]
emb|CDX73447.1|  BnaC08g25560D                                        37.4    1e-04   
ref|XP_006591214.1|  PREDICTED: VHS domain-containing protein At3...  50.8    1e-04   
ref|XP_010504307.1|  PREDICTED: GATA transcription factor 8           36.6    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_010427202.1|  PREDICTED: GATA transcription factor 8-like ...  36.6    1e-04   Camelina sativa [gold-of-pleasure]
ref|XP_004149904.1|  PREDICTED: GATA transcription factor 4-like      37.0    2e-04   Cucumis sativus [cucumbers]
ref|XP_008367332.1|  PREDICTED: GATA transcription factor 8-like      50.4    3e-04   Malus domestica [apple tree]
ref|XP_008347480.1|  PREDICTED: GATA transcription factor 8-like      50.1    3e-04   
ref|XP_009116158.1|  PREDICTED: GATA transcription factor 8           37.4    3e-04   Brassica rapa
emb|CDY02894.1|  BnaC04g25920D                                        37.4    4e-04   
emb|CDX78264.1|  BnaA09g34590D                                        37.4    4e-04   
ref|XP_006403533.1|  hypothetical protein EUTSA_v10010544mg           37.7    6e-04   Eutrema salsugineum [saltwater cress]
ref|XP_006291493.1|  hypothetical protein CARUB_v10017647mg           35.8    9e-04   Capsella rubella



>emb|CDO99748.1| unnamed protein product [Coffea canephora]
Length=341

 Score =   109 bits (272),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 83/129 (64%), Positives = 98/129 (76%), Gaps = 5/129 (4%)
 Frame = +2

Query  185  GGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
            G VGSGDC NFPS+WDE LPD+D +F+   S+SASDLSAELSVPYEDIVQLEWLS FVE+
Sbjct  33   GLVGSGDCKNFPSLWDEALPDTDTLFTGNTSNSASDLSAELSVPYEDIVQLEWLSTFVED  92

Query  365  SFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSP  544
            SFS GG+TL K+N  +N K     +FQ +    S +    SSSSSS+SSCSGGK +PLSP
Sbjct  93   SFSGGGMTLSKDNSSVN-KDNPCNQFQTS----SPVSVLESSSSSSSSSCSGGKTIPLSP  147

Query  545  SQRGAQRAR  571
            + RG QRAR
Sbjct  148  NHRGPQRAR  156


 Score = 60.5 bits (145),  Expect(2) = 2e-33, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M  NFVDEIDCGSFFDHIDDLI+FPPENE
Sbjct  1    MGPNFVDEIDCGSFFDHIDDLIEFPPENE  29



>ref|XP_009598426.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
 ref|XP_009598427.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=343

 Score =   109 bits (273),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 6/130 (5%)
 Frame = +2

Query  185  GGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
             G+ S DC +FP+IW++PLPDSD +FS +H +SASD SAELSVPYEDIVQLEWLSAFVE+
Sbjct  31   AGLSSTDCKDFPTIWNDPLPDSDSLFSGSHRNSASDFSAELSVPYEDIVQLEWLSAFVED  90

Query  365  SFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPL-S  541
            SFS GGLTLGK+N+PLN K  S+ KFQ +    S +    SSSS S+SSCS  K +PL S
Sbjct  91   SFSGGGLTLGKDNFPLN-KETSEAKFQTS----SPVSVLESSSSCSSSSCSVEKTVPLSS  145

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  146  PCHRGPQRAR  155


 Score = 57.0 bits (136),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M SN VDEIDCGSFFDHIDDLI+FP ENE
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIEFPLENE  29



>dbj|BAC98491.1| AG-motif binding protein-1 [Nicotiana tabacum]
Length=343

 Score =   109 bits (272),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 82/130 (63%), Positives = 98/130 (75%), Gaps = 6/130 (5%)
 Frame = +2

Query  185  GGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
             G+ S DC +FP+IW++PLPDSD +FS +H +SASD SAELSVPYEDIVQLEWLSAFVE+
Sbjct  31   AGLSSTDCKDFPTIWNDPLPDSDSLFSGSHRNSASDFSAELSVPYEDIVQLEWLSAFVED  90

Query  365  SFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPL-S  541
            SFS GGLTLGK+N+PLN K  S+ KFQ +S    +  SSSSSSSS +      K +PL S
Sbjct  91   SFSGGGLTLGKDNFPLN-KETSEAKFQTSSPVSVLESSSSSSSSSCSVE----KTVPLSS  145

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  146  PCHRGPQRAR  155


 Score = 57.0 bits (136),  Expect(2) = 1e-32, Method: Compositional matrix adjust.
 Identities = 25/29 (86%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M SN VDEIDCGSFFDHIDDLI+FP ENE
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIEFPLENE  29



>ref|XP_009760862.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009760863.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=332

 Score =   110 bits (274),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 86/135 (64%), Positives = 99/135 (73%), Gaps = 8/135 (6%)
 Frame = +2

Query  167  PRRMSCGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWL  346
            P    CGG  S DC  FPSIWD+P   SDP+FS ++++S SDLSAELSVPYEDIVQLEWL
Sbjct  25   PSENECGGFSSTDCKEFPSIWDQP---SDPLFSGSYNNSPSDLSAELSVPYEDIVQLEWL  81

Query  347  SAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGK  526
            S FVE+SFS GGLTLGKEN P+N K  S  KFQ++    S +    SS SSS+SSCSGGK
Sbjct  82   STFVEDSFSAGGLTLGKENAPIN-KETSHSKFQSS----SPVSVLESSGSSSSSSCSGGK  136

Query  527  AMPLSPSQRGAQRAR  571
             +PLSP  RG QRAR
Sbjct  137  TIPLSPCHRGPQRAR  151


 Score = 54.7 bits (130),  Expect(2) = 4e-32, Method: Compositional matrix adjust.
 Identities = 24/29 (83%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M SN VDEIDCGSFFD IDDLI+FP ENE
Sbjct  1    MGSNMVDEIDCGSFFDQIDDLIEFPSENE  29



>ref|XP_006350222.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006350223.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
Length=344

 Score =   109 bits (273),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 99/130 (76%), Gaps = 1/130 (1%)
 Frame = +2

Query  182  CGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVE  361
            CGG+ + DC +FPSIW++PLPDSDP+FS ++S+SASD SAELSVPYEDIVQLEWLS FVE
Sbjct  30   CGGLDAVDCKDFPSIWNDPLPDSDPLFSGSYSNSASDFSAELSVPYEDIVQLEWLSTFVE  89

Query  362  ESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLS  541
            +SFS GGLTLGKE+  +  K  SD KF  +S    +  SSSSSSSS++SS  G    PLS
Sbjct  90   DSFSCGGLTLGKEHCSVK-KESSDSKFLTSSPVSVLESSSSSSSSSTSSSGPGKTLPPLS  148

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  149  PCTRGPQRAR  158


 Score = 52.4 bits (124),  Expect(2) = 3e-31, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M S+FVDEIDC SFFDH++DLI+F PENE
Sbjct  1    MGSDFVDEIDCSSFFDHMEDLIEFSPENE  29



>ref|XP_009802378.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
 ref|XP_009802379.1| PREDICTED: GATA transcription factor 8-like [Nicotiana sylvestris]
Length=338

 Score =   109 bits (273),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +2

Query  182  CGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVE  361
            CG + S DC NFPSI +EPLPDSDP+F ++H +S SD S+EL VPYEDIVQLEWLS FVE
Sbjct  30   CGDLDSTDCKNFPSICNEPLPDSDPLFFSSHRNSPSDFSSELLVPYEDIVQLEWLSTFVE  89

Query  362  ESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLS  541
            +SFS GGLT+GKE++P+N +P  +K   ++   +    SSSSSSS +  +       PLS
Sbjct  90   DSFSCGGLTMGKEHFPVNKEPSHNKFLSSSPVSVLESSSSSSSSSGAVKTTP-----PLS  144

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  145  PCHRGTQRAR  154


 Score = 51.6 bits (122),  Expect(2) = 5e-31, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M S+ VDEIDC SFFDH+DDLI+F PENE
Sbjct  1    MGSSLVDEIDCASFFDHMDDLIEFSPENE  29



>ref|XP_009605437.1| PREDICTED: GATA transcription factor 8-like [Nicotiana tomentosiformis]
Length=339

 Score =   106 bits (265),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 74/130 (57%), Positives = 92/130 (71%), Gaps = 5/130 (4%)
 Frame = +2

Query  182  CGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVE  361
            CG + S DC NFPSI ++PLPDS P+F ++H +S SD SAEL VPYEDIVQLEWLS FVE
Sbjct  30   CGDLDSTDCKNFPSICNDPLPDSGPLFFSSHRNSPSDFSAELLVPYEDIVQLEWLSTFVE  89

Query  362  ESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLS  541
            +SFS GGLT+GKE++P+N +P   K   ++      +    SSSSSS+SS +G    PLS
Sbjct  90   DSFSCGGLTMGKEHFPVNKEPSHSKFLSSS-----PVSVLESSSSSSSSSGAGKTTPPLS  144

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  145  PCHRGTQRAR  154


 Score = 54.3 bits (129),  Expect(2) = 6e-31, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 25/29 (86%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M SN VDEIDC SFFDHIDDL++F PENE
Sbjct  1    MASNLVDEIDCASFFDHIDDLVEFSPENE  29



>ref|XP_011076972.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
 ref|XP_011076974.1| PREDICTED: GATA transcription factor 8-like [Sesamum indicum]
Length=328

 Score =   102 bits (254),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 76/127 (60%), Positives = 92/127 (72%), Gaps = 7/127 (6%)
 Frame = +2

Query  191  VGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESF  370
            + SGDC +F ++W++ LPD+DP FS +H   ASDLSAELSVPYEDIVQLEWLS FVE+SF
Sbjct  36   ISSGDCEDFTNMWNDALPDADPFFSGSHVDCASDLSAELSVPYEDIVQLEWLSTFVEDSF  95

Query  371  SDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPSQ  550
            S GGLT+GKEN  ++ +  S   F+ +         S   SSSS+SSCSGGK MPLSPS 
Sbjct  96   SGGGLTIGKENLSIDVE-SSRNPFRTS------SPVSVLESSSSSSSCSGGKTMPLSPSH  148

Query  551  RGAQRAR  571
            RG QRAR
Sbjct  149  RGTQRAR  155


 Score = 56.6 bits (135),  Expect(2) = 2e-30, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 28/29 (97%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M+SNFVDEIDCGSFFD +DDLI+FPP+N+
Sbjct  1    MESNFVDEIDCGSFFDQMDDLIEFPPDND  29



>ref|XP_009628969.1| PREDICTED: LOW QUALITY PROTEIN: GATA transcription factor 8-like 
[Nicotiana tomentosiformis]
Length=320

 Score =   122 bits (306),  Expect = 8e-30, Method: Compositional matrix adjust.
 Identities = 89/135 (66%), Positives = 102/135 (76%), Gaps = 5/135 (4%)
 Frame = +2

Query  167  PRRMSCGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWL  346
            P    CGG+ S DC  FPSIWD+PLPDSDP+FS ++++S SDLSAELSVPYEDIVQLEWL
Sbjct  25   PSENECGGLSSTDCKEFPSIWDQPLPDSDPLFSGSYNNSPSDLSAELSVPYEDIVQLEWL  84

Query  347  SAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGK  526
            S FVE+SFS  GLTLGKEN P+N K  S  KFQ++    S +    SSSSSS+SSCSGGK
Sbjct  85   STFVEDSFSGRGLTLGKENAPIN-KETSHSKFQSS----SPVSVLESSSSSSSSSCSGGK  139

Query  527  AMPLSPSQRGAQRAR  571
              PLSP  RG QRAR
Sbjct  140  TFPLSPCHRGPQRAR  154


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 30/42 (71%), Gaps = 0/42 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            M SNFVDEIDCGSFFD IDDLI+FP ENE         ++FP
Sbjct  1    MGSNFVDEIDCGSFFDQIDDLIEFPSENECGGLSSTDCKEFP  42



>ref|XP_004236632.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
 ref|XP_010319208.1| PREDICTED: GATA transcription factor 8 [Solanum lycopersicum]
Length=337

 Score =   106 bits (264),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 83/130 (64%), Positives = 97/130 (75%), Gaps = 1/130 (1%)
 Frame = +2

Query  182  CGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVE  361
            CGGV + DC +FPSIW++PLPDSDP FS ++S+SASD SAELSVP EDIVQLEWLS FVE
Sbjct  30   CGGVDAVDCNDFPSIWNDPLPDSDPFFSGSYSNSASDFSAELSVPLEDIVQLEWLSTFVE  89

Query  362  ESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLS  541
            +SFS GGLTLGKE+  +  K  SD KF  +S    +  SSSSSSSS++SS  G    PLS
Sbjct  90   DSFSCGGLTLGKEHCSVK-KESSDSKFLTSSPVSVLESSSSSSSSSTSSSGPGKTLPPLS  148

Query  542  PSQRGAQRAR  571
            P  RG QRAR
Sbjct  149  PCPRGPQRAR  158


 Score = 50.4 bits (119),  Expect(2) = 1e-29, Method: Compositional matrix adjust.
 Identities = 21/28 (75%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPEN  177
            M S+FVDEIDC SFFDH++DLI+F PEN
Sbjct  1    MGSDFVDEIDCSSFFDHMEDLIEFSPEN  28



>ref|XP_004239665.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
lycopersicum]
Length=341

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            G+ S DC +FPSIW++PLPDSD +FS +H +SASDLSAELSVPYEDIVQLEWLS FVE+S
Sbjct  46   GLSSTDCKDFPSIWNDPLPDSDSLFSGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDS  105

Query  368  FSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS  547
            FS GGLTLGKEN P+  +P S  KFQ +     V    SSSSSSS+ S SG K +PLSP 
Sbjct  106  FSGGGLTLGKENIPVEKEPSSQGKFQTS---SPVSVLESSSSSSSSFSSSGEKTLPLSPC  162

Query  548  QRGAQRAR  571
             RG QRAR
Sbjct  163  HRGPQRAR  170


 Score = 56.2 bits (134),  Expect = 2e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  91   SMDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            +M SN VDEIDCGSFFDHIDDLIDFP E+E         + FP
Sbjct  14   TMGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFP  56



>ref|XP_004239666.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321318.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
 ref|XP_010321319.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
lycopersicum]
Length=327

 Score =   115 bits (289),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            G+ S DC +FPSIW++PLPDSD +FS +H +SASDLSAELSVPYEDIVQLEWLS FVE+S
Sbjct  32   GLSSTDCKDFPSIWNDPLPDSDSLFSGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDS  91

Query  368  FSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS  547
            FS GGLTLGKEN P+  +P S  KFQ +     V    SSSSSSS+ S SG K +PLSP 
Sbjct  92   FSGGGLTLGKENIPVEKEPSSQGKFQTS---SPVSVLESSSSSSSSFSSSGEKTLPLSPC  148

Query  548  QRGAQRAR  571
             RG QRAR
Sbjct  149  HRGPQRAR  156


 Score = 55.8 bits (133),  Expect = 4e-06, Method: Compositional matrix adjust.
 Identities = 27/42 (64%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            M SN VDEIDCGSFFDHIDDLIDFP E+E         + FP
Sbjct  1    MGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFP  42



>ref|XP_004239667.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
lycopersicum]
Length=410

 Score =   116 bits (290),  Expect = 3e-27, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            G+ S DC +FPSIW++PLPDSD +FS +H +SASDLSAELSVPYEDIVQLEWLS FVE+S
Sbjct  115  GLSSTDCKDFPSIWNDPLPDSDSLFSGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDS  174

Query  368  FSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS  547
            FS GGLTLGKEN P+  +P S  KFQ +     V    SSSSSSS+ S SG K +PLSP 
Sbjct  175  FSGGGLTLGKENIPVEKEPSSQGKFQTS---SPVSVLESSSSSSSSFSSSGEKTLPLSPC  231

Query  548  QRGAQRAR  571
             RG QRAR
Sbjct  232  HRGPQRAR  239


 Score = 56.2 bits (134),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 27/43 (63%), Positives = 30/43 (70%), Gaps = 0/43 (0%)
 Frame = +1

Query  91   SMDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            +M SN VDEIDCGSFFDHIDDLIDFP E+E         + FP
Sbjct  83   TMGSNVVDEIDCGSFFDHIDDLIDFPLESENVGLSSTDCKDFP  125



>ref|XP_011084325.1| PREDICTED: GATA transcription factor 8 [Sesamum indicum]
Length=333

 Score = 92.0 bits (227),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 77/128 (60%), Positives = 94/128 (73%), Gaps = 7/128 (5%)
 Frame = +2

Query  191  VGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESF  370
            V S D   F S+W++ LP+SDP FS +H +S+SDLSAELSVPYEDIVQLEWLS F+E+SF
Sbjct  38   VSSVDSKAFSSMWNDALPESDPFFSGSHGNSSSDLSAELSVPYEDIVQLEWLSTFMEDSF  97

Query  371  SDGGLTLGKENYPLNPKPE-SDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS  547
            S  G+T+GKEN  L P+ E SD +FQ +S    +  SSSSS+SSS+      KAMPLSPS
Sbjct  98   SGQGMTVGKEN--LCPEMEPSDNQFQTSSPISVLESSSSSSTSSSSE----AKAMPLSPS  151

Query  548  QRGAQRAR  571
             RG QRAR
Sbjct  152  HRGPQRAR  159


 Score = 55.5 bits (132),  Expect(2) = 6e-27, Method: Compositional matrix adjust.
 Identities = 23/29 (79%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M  NF+DEIDCG+FFD IDDLI+FPPENE
Sbjct  1    MGPNFMDEIDCGNFFDQIDDLIEFPPENE  29



>ref|XP_006345791.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Solanum 
tuberosum]
 ref|XP_006345792.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Solanum 
tuberosum]
 ref|XP_006345793.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Solanum 
tuberosum]
 ref|XP_006345794.1| PREDICTED: GATA transcription factor 8-like isoform X4 [Solanum 
tuberosum]
Length=328

 Score =   114 bits (286),  Expect = 6e-27, Method: Compositional matrix adjust.
 Identities = 84/128 (66%), Positives = 97/128 (76%), Gaps = 3/128 (2%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            G+ S DC +FPSIW++PLPDSD +FS +H +SASDLSAELSVPYEDIVQLEWLS FVE+S
Sbjct  32   GLSSTDCKDFPSIWNDPLPDSDSLFSGSHRNSASDLSAELSVPYEDIVQLEWLSTFVEDS  91

Query  368  FSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMPLSPS  547
            FS GGLTLGKEN P+  +P S  KFQ +     V    SSSSSSS+ S SG K +PLSP 
Sbjct  92   FSGGGLTLGKENIPVEKEPLSQGKFQTS---SPVSVLESSSSSSSSFSSSGEKTLPLSPC  148

Query  548  QRGAQRAR  571
             RG QRAR
Sbjct  149  HRGPQRAR  156


 Score = 57.8 bits (138),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            M SN VDEIDCGSFFDHIDDLIDFP ENE         + FP
Sbjct  1    MGSNVVDEIDCGSFFDHIDDLIDFPLENENVGLSSTDCKDFP  42



>dbj|BAC98495.1| AG-motif binding protein-5 [Nicotiana tabacum]
Length=342

 Score =   107 bits (266),  Expect = 4e-24, Method: Compositional matrix adjust.
 Identities = 83/136 (61%), Positives = 97/136 (71%), Gaps = 6/136 (4%)
 Frame = +2

Query  167  PRRMSCGGVGSGDCANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWL  346
            P      G+ S DC +FPSIW++PLPDSD +FS +H +SASD SAELSVPYEDIVQLEWL
Sbjct  25   PLENESAGLSSTDCKDFPSIWNDPLPDSDSLFSGSHRNSASDFSAELSVPYEDIVQLEWL  84

Query  347  SAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGK  526
            S FVE+SFS GGLTLGKEN+PL  K  S+ KFQ +S    +  SSSSSSSS +      K
Sbjct  85   STFVEDSFSGGGLTLGKENFPLY-KETSEAKFQTSSPVSVLESSSSSSSSSCSVE----K  139

Query  527  AMPL-SPSQRGAQRAR  571
             +PL SP  RG QRAR
Sbjct  140  TVPLSSPCHRGPQRAR  155


 Score = 59.3 bits (142),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 28/42 (67%), Positives = 29/42 (69%), Gaps = 0/42 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENElrrcrlrrlrQFP  219
            M SN VDEIDCGSFFDHIDDLIDFP ENE         + FP
Sbjct  1    MGSNLVDEIDCGSFFDHIDDLIDFPLENESAGLSSTDCKDFP  42



>ref|XP_002273502.1| PREDICTED: GATA transcription factor 8-like [Vitis vinifera]
Length=340

 Score = 83.2 bits (204),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 71/132 (54%), Positives = 86/132 (65%), Gaps = 11/132 (8%)
 Frame = +2

Query  185  GGVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            GG+  GDC +FPSIW    +PLP  D +FS  +S+S SDLSAELSVPYEDIVQLEWLS F
Sbjct  32   GGLMGGDCNSFPSIWTNASDPLPGPDSVFSGPNSNSNSDLSAELSVPYEDIVQLEWLSNF  91

Query  356  VEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMP  535
            VE+SFS G + L KE+  +  K     +FQ +          S   SSS+ S  GGK +P
Sbjct  92   VEDSFSGGSIGLNKEDGSIV-KDSPHHQFQTS-------SPVSVLESSSSCSGGGGKTIP  143

Query  536  LSPSQRGAQRAR  571
            LSP+ RGAQRAR
Sbjct  144  LSPNHRGAQRAR  155


 Score = 53.9 bits (128),  Expect(2) = 7e-24, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL++FPPE+
Sbjct  5    NFMDEIDCGSFFDHIDDLLEFPPED  29



>emb|CBI31452.3| unnamed protein product [Vitis vinifera]
Length=185

 Score = 82.8 bits (203),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 69/132 (52%), Positives = 84/132 (64%), Gaps = 11/132 (8%)
 Frame = +2

Query  185  GGVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            GG+  GDC +FPSIW    +PLP  D +FS  +S+S SDLSAELSVPYEDIVQLEWLS F
Sbjct  32   GGLMGGDCNSFPSIWTNASDPLPGPDSVFSGPNSNSNSDLSAELSVPYEDIVQLEWLSNF  91

Query  356  VEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMP  535
            VE+SFS G + L KE+  +  K     +FQ +S    +  SSS S           K +P
Sbjct  92   VEDSFSGGSIGLNKEDGSI-VKDSPHHQFQTSSPVSVLESSSSCSGGGG-------KTIP  143

Query  536  LSPSQRGAQRAR  571
            LSP+ RGAQRAR
Sbjct  144  LSPNHRGAQRAR  155


 Score = 52.4 bits (124),  Expect(2) = 2e-23, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 25/25 (100%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL++FPPE+
Sbjct  5    NFMDEIDCGSFFDHIDDLLEFPPED  29



>gb|EYU39843.1| hypothetical protein MIMGU_mgv1a010405mg [Erythranthe guttata]
Length=313

 Score = 70.1 bits (170),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 58/132 (44%), Positives = 78/132 (59%), Gaps = 12/132 (9%)
 Frame = +2

Query  191  VGSGDCANFPSIW-DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            V S    +FPS+W D+ LP+SD +FSA  +   S   +   VPYEDIVQLEWLS FVE+S
Sbjct  36   VNSDSSKDFPSMWNDDALPESDHLFSANAASDLSAELS---VPYEDIVQLEWLSTFVEDS  92

Query  368  FSDGGLTL-GKEN---YPLNPKPESDKKFQAAsspisvlesssssssssnsscsGGKAMP  535
            FS GG+T+  KEN   +   P   +  +FQ +    S +    S+SSSS+++  G     
Sbjct  93   FSGGGMTIAAKENLREHKNEPTSHTTYQFQTS----SPVSVLESTSSSSSTTSVGQTTAH  148

Query  536  LSPSQRGAQRAR  571
            L P+ RG QRAR
Sbjct  149  LPPTHRGPQRAR  160


 Score = 54.7 bits (130),  Expect(2) = 3e-20, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M+ NF+DEIDCG+FFD IDDLI+FPP+NE
Sbjct  1    MEPNFMDEIDCGNFFDQIDDLIEFPPDNE  29



>gb|KDO44680.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
 gb|KDO44681.1| hypothetical protein CISIN_1g016706mg [Citrus sinensis]
Length=384

 Score = 65.5 bits (158),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  185  GGVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
             G+ + D  +FPSIW    + LP SD +FS + +  ++ LS    VPYEDIVQLEWLS F
Sbjct  32   AGLPNADSNSFPSIWPTQSDSLPGSDSVFSNSSTDLSTQLS----VPYEDIVQLEWLSNF  87

Query  356  VEESFSDGGLTLGK-ENYPLNPKPESDKKFQA  448
            VE+SFS G LT+ K E+  +     S  +FQ 
Sbjct  88   VEDSFSGGSLTMSKQESSTITKDDSSHNQFQT  119


 Score = 53.1 bits (126),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  4    TNFMDEIDCGSFFDHIDDLLDFPNED  29



>ref|XP_006436435.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436436.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006436437.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 ref|XP_006485699.1| PREDICTED: GATA transcription factor 8-like [Citrus sinensis]
 gb|ESR49675.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49676.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
 gb|ESR49677.1| hypothetical protein CICLE_v10032018mg [Citrus clementina]
Length=341

 Score = 65.1 bits (157),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 42/92 (46%), Positives = 56/92 (61%), Gaps = 8/92 (9%)
 Frame = +2

Query  185  GGVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
             G+ + D  +FPSIW    + LP SD +FS + +  ++ LS    VPYEDIVQLEWLS F
Sbjct  32   AGLPNADSNSFPSIWPTQSDSLPGSDSVFSNSSTDLSTQLS----VPYEDIVQLEWLSNF  87

Query  356  VEESFSDGGLTLGK-ENYPLNPKPESDKKFQA  448
            VE+SFS G LT+ K E+  +     S  +FQ 
Sbjct  88   VEDSFSGGSLTMSKQESSTITKDDSSHNQFQT  119


 Score = 53.1 bits (126),  Expect(2) = 3e-18, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  4    TNFMDEIDCGSFFDHIDDLLDFPNED  29



>gb|EYU39605.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39606.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39607.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
 gb|EYU39608.1| hypothetical protein MIMGU_mgv1a011769mg [Erythranthe guttata]
Length=271

 Score = 63.9 bits (154),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 43/64 (67%), Positives = 53/64 (83%), Gaps = 1/64 (2%)
 Frame = +2

Query  212  NFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTL  391
            +FP+ W+  LPD DP+FS +H  SASDLSAELSVPYEDIVQLEWLS F+E+SFS   +T+
Sbjct  45   DFPA-WNNDLPDCDPLFSGSHVSSASDLSAELSVPYEDIVQLEWLSNFMEDSFSCKDMTI  103

Query  392  GKEN  403
            GK+N
Sbjct  104  GKQN  107


 Score = 52.0 bits (123),  Expect(2) = 2e-17, Method: Compositional matrix adjust.
 Identities = 22/29 (76%), Positives = 26/29 (90%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M  NF+DEIDCG+FFD IDDLI+FPP+NE
Sbjct  1    MGPNFMDEIDCGNFFDQIDDLIEFPPDNE  29



>ref|XP_004142426.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 ref|XP_004166767.1| PREDICTED: GATA transcription factor 9-like [Cucumis sativus]
 gb|KGN52268.1| hypothetical protein Csa_5G622830 [Cucumis sativus]
Length=355

 Score = 60.5 bits (145),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/71 (54%), Positives = 46/71 (65%), Gaps = 7/71 (10%)
 Frame = +2

Query  200  GDCAN-FPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            GD AN FP+IW    E LP SD +FSA  +   S   +   VPYEDIVQL+WL+ FVE+S
Sbjct  40   GDSANSFPTIWPTHSESLPGSDSVFSANSNSDLSAELS---VPYEDIVQLDWLANFVEDS  96

Query  368  FSDGGLTLGKE  400
            F   GLT+ KE
Sbjct  97   FCGEGLTMNKE  107


 Score = 53.5 bits (127),  Expect(2) = 5e-17, Method: Compositional matrix adjust.
 Identities = 22/26 (85%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NFVDEIDCGSFFDHIDDL+DFP E+
Sbjct  4    NNFVDEIDCGSFFDHIDDLLDFPVED  29



>ref|XP_008446884.1| PREDICTED: GATA transcription factor 8 [Cucumis melo]
Length=353

 Score = 61.2 bits (147),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 41/87 (47%), Positives = 51/87 (59%), Gaps = 11/87 (13%)
 Frame = +2

Query  200  GDCAN-FPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEES  367
            GD  N FP+IW    E LP SD +FSA  +   S   +   VPYEDIVQL+WL+ FVE+S
Sbjct  40   GDSTNSFPTIWPTHSESLPGSDSVFSANSNSDLSAELS---VPYEDIVQLDWLANFVEDS  96

Query  368  FSDGGLTLGKENYPLNPKPESDKKFQA  448
            F  G LT+ KE     PK  +  +FQ 
Sbjct  97   FCGGSLTMNKE----EPKDLTHNQFQT  119


 Score = 50.8 bits (120),  Expect(2) = 2e-16, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 24/26 (92%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NFVDEIDCGSFFD IDDL+DFP E+
Sbjct  4    NNFVDEIDCGSFFDQIDDLLDFPVED  29



>ref|XP_007143712.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
 gb|ESW15706.1| hypothetical protein PHAVU_007G095300g [Phaseolus vulgaris]
Length=354

 Score = 59.3 bits (142),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 36/84 (43%), Positives = 46/84 (55%), Gaps = 6/84 (7%)
 Frame = +2

Query  167  PRRMSCGGVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQL  337
            P   S     +G+C +  SIW    +  P SD +FS   +   S   +   VPYEDIVQL
Sbjct  35   PTLPSVAAAAAGNCNSLASIWPAGSDSFPGSDSVFSGNSASDLSAELS---VPYEDIVQL  91

Query  338  EWLSAFVEESFSDGGLTLGKENYP  409
            EWLS FVE+SF  G LT+ K + P
Sbjct  92   EWLSNFVEDSFCGGSLTMKKVDEP  115


 Score = 52.0 bits (123),  Expect(2) = 4e-16, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVED  29



>ref|XP_006606248.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=357

 Score = 58.2 bits (139),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = +2

Query  194  GSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
             +G+C +  SIW    +  P SD +FS   +   S   +   VPYEDIVQLEWLS FVE+
Sbjct  51   AAGNCNSLASIWPAESDSFPTSDSVFSGNTASDLSAELS---VPYEDIVQLEWLSNFVED  107

Query  365  SFSDGGLTLGKENYP  409
            SF  G LT+ K   P
Sbjct  108  SFCGGSLTMNKVEEP  122


 Score = 52.4 bits (124),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 23/34 (68%), Positives = 27/34 (79%), Gaps = 0/34 (0%)
 Frame = +1

Query  76   SFVGSSMDSNFVDEIDCGSFFDHIDDLIDFPPEN  177
            S V   +  NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    SIVEKMVGPNFMDEIDCGSFFDHIDDLLDFPVED  38



>gb|KDP44375.1| hypothetical protein JCGZ_20055 [Jatropha curcas]
Length=357

 Score = 59.3 bits (142),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 36/77 (47%), Positives = 45/77 (58%), Gaps = 8/77 (10%)
 Frame = +2

Query  182  CGGVGSGDCA--NFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWL  346
            C  + +   A  +FPSIW    + LP SD +FS   +   S   +   VPYEDIVQLEWL
Sbjct  40   CATINNNGIAGNSFPSIWSTQSDSLPGSDSVFSNNSASDLSAELS---VPYEDIVQLEWL  96

Query  347  SAFVEESFSDGGLTLGK  397
            S FVE+SFS G LT+  
Sbjct  97   SNFVEDSFSGGSLTINN  113


 Score = 51.6 bits (122),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP ++
Sbjct  5    ANFMDEIDCGSFFDHIDDLLDFPTDD  30



>ref|XP_002534043.1| GATA transcription factor, putative [Ricinus communis]
 gb|EEF28339.1| GATA transcription factor, putative [Ricinus communis]
Length=359

 Score = 58.2 bits (139),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 43/84 (51%), Positives = 57/84 (68%), Gaps = 5/84 (6%)
 Frame = +2

Query  212  NFPSIWD---EPLPDSDPIFsaahshsasd-lsaelsVPYEDIVQLEWLSAFVEESFSDG  379
            +FPSIW    + LP S  +FS+  +++++  LSAELSVPYEDIVQLEWLS FVE+SFS G
Sbjct  50   SFPSIWSTQSDSLPGSHSVFSSNTNNNSASDLSAELSVPYEDIVQLEWLSNFVEDSFSGG  109

Query  380  GLTLGK-ENYPLNPKPESDKKFQA  448
             LT+ K E+  +N       +FQ 
Sbjct  110  SLTMNKEESTSINKDSSHHHQFQT  133


 Score = 52.4 bits (124),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 20/26 (77%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP ++
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPTDD  30



>ref|XP_007009854.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
 gb|EOY18664.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 2 [Theobroma cacao]
Length=341

 Score = 57.0 bits (136),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +2

Query  185  GGVGSGDCA----NFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEW  343
             G+ + D A     FPSIW    E LP SD +FS   +   S   +   VPYEDIVQLEW
Sbjct  33   AGLSASDSAVNASAFPSIWTTHSESLPGSDSVFSNNSASDLSAELS---VPYEDIVQLEW  89

Query  344  LSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQA  448
            LS FV++S     LT+ KE      K  S  +FQ 
Sbjct  90   LSNFVDDSQCGASLTIKKEESSSITKDSSQHQFQT  124


 Score = 53.9 bits (128),  Expect(2) = 5e-16, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNED  30



>ref|XP_003556234.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=348

 Score = 58.2 bits (139),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 34/75 (45%), Positives = 43/75 (57%), Gaps = 6/75 (8%)
 Frame = +2

Query  194  GSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
             +G+C +  SIW    +  P SD +FS   +   S   +   VPYEDIVQLEWLS FVE+
Sbjct  42   AAGNCNSLASIWPAESDSFPTSDSVFSGNTASDLSAELS---VPYEDIVQLEWLSNFVED  98

Query  365  SFSDGGLTLGKENYP  409
            SF  G LT+ K   P
Sbjct  99   SFCGGSLTMNKVEEP  113


 Score = 51.6 bits (122),  Expect(2) = 1e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVED  29



>ref|XP_007009853.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
 gb|EOY18663.1| Plant-specific GATA-type zinc finger transcription factor family 
protein isoform 1 [Theobroma cacao]
Length=414

 Score = 55.8 bits (133),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 49/95 (52%), Gaps = 10/95 (11%)
 Frame = +2

Query  185  GGVGSGDCA----NFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEW  343
             G+ + D A     FPSIW    E LP SD +FS   +   S   +   VPYEDIVQLEW
Sbjct  106  AGLSASDSAVNASAFPSIWTTHSESLPGSDSVFSNNSASDLSAELS---VPYEDIVQLEW  162

Query  344  LSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQA  448
            LS FV++S     LT+ KE      K  S  +FQ 
Sbjct  163  LSNFVDDSQCGASLTIKKEESSSITKDSSQHQFQT  197


 Score = 53.5 bits (127),  Expect(2) = 2e-15, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  78   TNFIDEIDCGSFFDHIDDLLDFPNED  103



>ref|XP_003536350.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006589425.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006589426.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=347

 Score = 55.5 bits (132),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/76 (45%), Positives = 43/76 (57%), Gaps = 6/76 (8%)
 Frame = +2

Query  191  VGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVE  361
            V +G+  +  SIW    +  P SD +FS   +   S   +   VPYEDIVQLEWLS FVE
Sbjct  40   VSAGNSNSLASIWPSESDSFPASDSVFSGNSASDLSAELS---VPYEDIVQLEWLSNFVE  96

Query  362  ESFSDGGLTLGKENYP  409
            +SF  G LT+ K   P
Sbjct  97   DSFCGGSLTMNKVEEP  112


 Score = 52.0 bits (123),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 21/25 (84%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVED  29



>ref|XP_004496271.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Cicer 
arietinum]
 ref|XP_004496272.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Cicer 
arietinum]
Length=345

 Score = 59.7 bits (143),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 34/71 (48%), Positives = 43/71 (61%), Gaps = 6/71 (8%)
 Frame = +2

Query  194  GSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEE  364
             +G+C +  SIW       P SD +FS   +   S   +   VPYEDIVQLEWLS FVE+
Sbjct  42   SAGNCNSLASIWPSESHSFPASDSVFSGNSASDLSAELS---VPYEDIVQLEWLSNFVED  98

Query  365  SFSDGGLTLGK  397
            SFS+G LT+ K
Sbjct  99   SFSEGSLTMKK  109


 Score = 47.4 bits (111),  Expect(2) = 6e-15, Method: Compositional matrix adjust.
 Identities = 18/22 (82%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFP  168
            NF+DE+DCGSFFD IDDL+DFP
Sbjct  5    NFMDELDCGSFFDQIDDLLDFP  26



>gb|KHN17141.1| GATA transcription factor 9 [Glycine soja]
Length=339

 Score = 55.5 bits (132),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 43/77 (56%), Gaps = 6/77 (8%)
 Frame = +2

Query  188  GVGSGDCANFPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFV  358
             V +G+  +  SIW    +  P SD +FS   +   S   +   VPYEDIVQLEWLS FV
Sbjct  31   SVSAGNSNSLASIWPSESDSFPASDSVFSGNSASDLSAELS---VPYEDIVQLEWLSNFV  87

Query  359  EESFSDGGLTLGKENYP  409
            E+SF  G LT+ K   P
Sbjct  88   EDSFCGGSLTMNKVEEP  104


 Score = 51.2 bits (121),  Expect(2) = 9e-15, Method: Compositional matrix adjust.
 Identities = 20/22 (91%), Positives = 22/22 (100%), Gaps = 0/22 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFP  168
            NF+DEIDCGSFFDHIDDL+DFP
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFP  26



>gb|KJB73559.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73560.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
 gb|KJB73561.1| hypothetical protein B456_011G238800 [Gossypium raimondii]
Length=337

 Score = 53.1 bits (126),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNED  30


 Score = 53.1 bits (126),  Expect(2) = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/69 (48%), Positives = 40/69 (58%), Gaps = 6/69 (9%)
 Frame = +2

Query  203  DCANFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFS  373
            + A FPSIW    E  P SD +FS   +   S   +   VPYEDIVQLEWLS FVE+S  
Sbjct  43   NAAAFPSIWTAHPESFPGSDSVFSNNSASDLSAELS---VPYEDIVQLEWLSNFVEDSNC  99

Query  374  DGGLTLGKE  400
               LT+ K+
Sbjct  100  GASLTIKKQ  108



>gb|KHG18876.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=337

 Score = 52.8 bits (125),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 21/26 (81%), Positives = 25/26 (96%), Gaps = 0/26 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            +NF+DEIDCGSFFDHIDDL+DFP E+
Sbjct  5    TNFIDEIDCGSFFDHIDDLLDFPNED  30


 Score = 52.0 bits (123),  Expect(2) = 3e-14, Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 6/65 (9%)
 Frame = +2

Query  215  FPSIW---DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGL  385
            FPSIW    E  P SD +FS   +   S   +   VPYEDIVQLEWLS FVE+S     L
Sbjct  47   FPSIWTAHSESFPGSDSVFSNNSASDLSAELS---VPYEDIVQLEWLSNFVEDSNCGASL  103

Query  386  TLGKE  400
            T+ K+
Sbjct  104  TIKKQ  108



>ref|XP_010092608.1| GATA transcription factor 9 [Morus notabilis]
 gb|EXB51749.1| GATA transcription factor 9 [Morus notabilis]
Length=351

 Score = 58.9 bits (141),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 53/94 (56%), Gaps = 11/94 (12%)
 Frame = +2

Query  188  GVGSGDCAN-FPSIWD----EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSA  352
            G+G    AN F SIW     E LP SD +FS   +   S   +   VPYEDIVQLEWLS 
Sbjct  34   GLGPKPEANPFTSIWSTTQSESLPSSDSVFSGKSASDLSAELS---VPYEDIVQLEWLSN  90

Query  353  FVEESFSDGGLTLGKE--NYPLNPKPESDKKFQA  448
            FVE+SFS G L + KE  +  LN K  S  +FQ 
Sbjct  91   FVEDSFSGGSLAINKEQDSSSLN-KESSHHQFQT  123


 Score = 44.7 bits (104),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 19/22 (86%), Positives = 21/22 (95%), Gaps = 1/22 (5%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDD-LIDF  165
            NF+DEIDCGSFFDHIDD L+DF
Sbjct  5    NFMDEIDCGSFFDHIDDLLVDF  26



>ref|XP_006574762.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
 ref|XP_006574763.1| PREDICTED: GATA transcription factor 8-like isoform X3 [Glycine 
max]
Length=333

 Score = 52.0 bits (123),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  209  ANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLT  388
            ANF S   + LP S  +FS       S   +   V Y+DIVQLEWLS FVE+SFS G +T
Sbjct  36   ANFWSAESDSLPASYTVFSDNSVTDLSAELS---VSYDDIVQLEWLSNFVEDSFSGGSIT  92

Query  389  LGKENYP  409
            + KE  P
Sbjct  93   MKKEEEP  99


 Score = 51.2 bits (121),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPEN  177
            M  NF+D+IDCGSFFDHIDDL++FP +N
Sbjct  1    MIGNFIDDIDCGSFFDHIDDLLEFPDDN  28



>ref|XP_003548072.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
 ref|XP_006599443.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Glycine 
max]
Length=333

 Score = 55.1 bits (131),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 31/63 (49%), Positives = 39/63 (62%), Gaps = 3/63 (5%)
 Frame = +2

Query  212  NFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTL  391
            NF S   + LP +D +FS       S   +   VPYEDI+QLEWLS FVE+SFS G +T+
Sbjct  44   NFWSAESDSLPATDTVFSDNSVTDLSAELS---VPYEDIMQLEWLSNFVEDSFSGGSMTM  100

Query  392  GKE  400
             KE
Sbjct  101  KKE  103


 Score = 48.5 bits (114),  Expect(2) = 7e-14, Method: Compositional matrix adjust.
 Identities = 18/25 (72%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFP  168
            M  NF+D+IDCG+FFDHIDDL++FP
Sbjct  1    MIGNFIDDIDCGNFFDHIDDLLEFP  25



>emb|CDP19135.1| unnamed protein product [Coffea canephora]
Length=93

 Score = 57.8 bits (138),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 26/29 (90%), Positives = 27/29 (93%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M  NFVDEIDCGSFFDHIDDLI+FPPENE
Sbjct  1    MGPNFVDEIDCGSFFDHIDDLIEFPPENE  29


 Score = 45.8 bits (107),  Expect(2) = 8e-14, Method: Compositional matrix adjust.
 Identities = 21/34 (62%), Positives = 24/34 (71%), Gaps = 2/34 (6%)
 Frame = +2

Query  167  PRRMSCGG--VGSGDCANFPSIWDEPLPDSDPIF  262
            P    CG   VGSGDC NFPS+WDE LPD+D +F
Sbjct  25   PPENECGNGLVGSGDCKNFPSLWDEALPDTDTLF  58



>ref|XP_003519961.2| PREDICTED: GATA transcription factor 8-like isoform X1 [Glycine 
max]
Length=416

 Score = 52.0 bits (123),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 32/67 (48%), Positives = 39/67 (58%), Gaps = 3/67 (4%)
 Frame = +2

Query  209  ANFPSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLT  388
            ANF S   + LP S  +FS       S   +   V Y+DIVQLEWLS FVE+SFS G +T
Sbjct  119  ANFWSAESDSLPASYTVFSDNSVTDLSAELS---VSYDDIVQLEWLSNFVEDSFSGGSIT  175

Query  389  LGKENYP  409
            + KE  P
Sbjct  176  MKKEEEP  182


 Score = 51.2 bits (121),  Expect(2) = 9e-14, Method: Compositional matrix adjust.
 Identities = 20/28 (71%), Positives = 25/28 (89%), Gaps = 0/28 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPEN  177
            M  NF+D+IDCGSFFDHIDDL++FP +N
Sbjct  84   MIGNFIDDIDCGSFFDHIDDLLEFPDDN  111



>ref|XP_010032183.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032184.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032185.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 ref|XP_010032186.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Eucalyptus 
grandis]
 gb|KCW51583.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51584.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
 gb|KCW51585.1| hypothetical protein EUGRSUZ_J01083 [Eucalyptus grandis]
Length=350

 Score = 63.9 bits (154),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 42/75 (56%), Positives = 47/75 (63%), Gaps = 6/75 (8%)
 Frame = +2

Query  185  GGVGSGDCANFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
             G+  G   + PSIW    EPLP SD +FS   S S S   +   VPYEDIVQLEWLS F
Sbjct  29   AGLPVGKPDSLPSIWSAQPEPLPGSDAVFSGNSSSSLSAELS---VPYEDIVQLEWLSTF  85

Query  356  VEESFSDGGLTLGKE  400
            VEESFS G LT+ KE
Sbjct  86   VEESFSGGSLTMSKE  100


 Score = 38.5 bits (88),  Expect(2) = 2e-13, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 20/25 (80%), Gaps = 3/25 (12%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFF   DD +DFP E+
Sbjct  5    NFIDEIDCGSFF---DDFLDFPSED  26



>ref|XP_010683872.1| PREDICTED: GATA transcription factor 8 [Beta vulgaris subsp. 
vulgaris]
Length=310

 Score = 60.1 bits (144),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 46/78 (59%), Positives = 55/78 (71%), Gaps = 4/78 (5%)
 Frame = +2

Query  218  PSIWDEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFSDGGLTLGK  397
            P  W E    + P+FSAA+S+SASDLSAELSVPYEDIVQLEWLS FVE+SF+ GGLTL K
Sbjct  50   PVFWSE----NSPVFSAANSNSASDLSAELSVPYEDIVQLEWLSTFVEDSFAGGGLTLEK  105

Query  398  ENYPLNPKPESDKKFQAA  451
                 + K     +FQ +
Sbjct  106  SQCTSSSKDSPRNQFQTS  123


 Score = 40.8 bits (94),  Expect(2) = 5e-13, Method: Compositional matrix adjust.
 Identities = 14/23 (61%), Positives = 20/23 (87%), Gaps = 0/23 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFP  168
            +  ++EIDCG+FFD IDDL++FP
Sbjct  4    TKLMEEIDCGNFFDQIDDLLEFP  26



>ref|XP_009770305.1| PREDICTED: GATA transcription factor 8-like, partial [Nicotiana 
sylvestris]
Length=272

 Score = 70.1 bits (170),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 60/86 (70%), Gaps = 6/86 (7%)
 Frame = +2

Query  317  YEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAAsspisvlesssssss  496
            YEDIVQLEWLS FVE+SFS GGLTLGKEN+PL  K  S+ KFQ +S    +  SSSSSSS
Sbjct  5    YEDIVQLEWLSTFVEDSFSGGGLTLGKENFPLY-KETSEAKFQTSSPVSVLESSSSSSSS  63

Query  497  ssnsscsGGKAMPL-SPSQRGAQRAR  571
            S +      K +PL SP  RG QRAR
Sbjct  64   SCSVE----KTVPLSSPCHRGPQRAR  85



>gb|KJB60582.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
 gb|KJB60583.1| hypothetical protein B456_009G313700 [Gossypium raimondii]
Length=337

 Score = 53.1 bits (126),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = +2

Query  203  DCANFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFS  373
            + A FPSIW    E LP SD +F    +   S       VPYEDIVQLEW+S FVE++  
Sbjct  38   NAAAFPSIWTTQPESLPLSDSVFLNNSASELSTELF---VPYEDIVQLEWMSKFVEDTQC  94

Query  374  DGGLTLGKEN  403
               LT  KE+
Sbjct  95   GASLTTKKED  104


 Score = 40.4 bits (93),  Expect(2) = 5e-11, Method: Compositional matrix adjust.
 Identities = 18/26 (69%), Positives = 22/26 (85%), Gaps = 3/26 (12%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFPPEN  177
            ++F+DEIDCGSFF   DDLIDFP E+
Sbjct  5    TDFIDEIDCGSFF---DDLIDFPNED  27



>gb|KHG25368.1| GATA transcription factor 8 -like protein [Gossypium arboreum]
Length=339

 Score = 52.4 bits (124),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/70 (46%), Positives = 39/70 (56%), Gaps = 6/70 (9%)
 Frame = +2

Query  203  DCANFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFVEESFS  373
            + A FPSIW    E LP SD +F    +   S       VPYEDIVQLEW+S FVE++  
Sbjct  38   NAAAFPSIWTTQPESLPFSDSVFLNNSASELSTELF---VPYEDIVQLEWMSKFVEDTQC  94

Query  374  DGGLTLGKEN  403
               LT  KE+
Sbjct  95   GASLTKKKED  104


 Score = 39.3 bits (90),  Expect(2) = 2e-10, Method: Compositional matrix adjust.
 Identities = 17/23 (74%), Positives = 20/23 (87%), Gaps = 3/23 (13%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFP  168
            ++F+DEIDCGSFF   DDLIDFP
Sbjct  5    TDFIDEIDCGSFF---DDLIDFP  24



>gb|EPS57112.1| hypothetical protein M569_17713, partial [Genlisea aurea]
Length=101

 Score = 47.4 bits (111),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 34/77 (44%), Positives = 49/77 (64%), Gaps = 5/77 (6%)
 Frame = +2

Query  167  PRRMSCGG----VGSGDCANFPSIWDEPLPDSDP-IFsaahshsasdlsaelsVPYEDIV  331
            P    C G     GS + +  P+IW++ + DSD  +F+AA +  +  L A+LS+P ED+ 
Sbjct  25   PVEDECAGGGFLAGSVNSSEIPAIWNDAVDDSDGGLFAAAAAPHSDGLFADLSIPDEDVA  84

Query  332  QLEWLSAFVEESFSDGG  382
            QLEWLS+FVE+SFS  G
Sbjct  85   QLEWLSSFVEDSFSTKG  101


 Score = 39.3 bits (90),  Expect(2) = 8e-09, Method: Compositional matrix adjust.
 Identities = 17/29 (59%), Positives = 22/29 (76%), Gaps = 0/29 (0%)
 Frame = +1

Query  94   MDSNFVDEIDCGSFFDHIDDLIDFPPENE  180
            M  + VDE++CG+ FD IDDLI FP E+E
Sbjct  1    MGPSLVDEMECGNLFDQIDDLIKFPVEDE  29



>ref|XP_010264666.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=333

 Score = 52.0 bits (123),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 39/79 (49%), Positives = 50/79 (63%), Gaps = 9/79 (11%)
 Frame = +2

Query  185  GGVGSGDCANFPSIWDEPLPDS-----DPIFsaahshsasdlsaelsVPYEDIVQLEWLS  349
            G V  GDC  F   W  P PD+     + +FS  +  S S+L+ ELSVPYEDI QLEWLS
Sbjct  32   GEVIGGDCNAF---WTAPPPDTLMGGPNAVFSGNNDSSRSELANELSVPYEDIAQLEWLS  88

Query  350  AFVEESFSDG-GLTLGKEN  403
             FVE+SFS G  +T+ K++
Sbjct  89   NFVEDSFSAGSSITIDKDS  107


 Score = 33.5 bits (75),  Expect(2) = 1e-08, Method: Compositional matrix adjust.
 Identities = 12/15 (80%), Positives = 13/15 (87%), Gaps = 0/15 (0%)
 Frame = +1

Query  124  CGSFFDHIDDLIDFP  168
            CG FFD IDDL+DFP
Sbjct  12   CGDFFDQIDDLLDFP  26



>ref|XP_010253699.1| PREDICTED: GATA transcription factor 8-like [Nelumbo nucifera]
Length=334

 Score = 49.3 bits (116),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 39/96 (41%), Positives = 56/96 (58%), Gaps = 7/96 (7%)
 Frame = +2

Query  179  SCGGVGSGDCANFPSIWDEPLPDS-----DPIFsaahshsasdlsaelsVPYEDIVQLEW  343
            S   + +G   N+ + W    PD+     D +FS     S+S+L+ ELSVPYE+I QLEW
Sbjct  26   STEDIEAGAGENYITSWTTVPPDTMIGAPDSVFSGYSDRSSSELATELSVPYEEIAQLEW  85

Query  344  LSAFVEESFSDG-GLTLGKENYPLNPKPESDKKFQA  448
            LS FVE+SFS G  +TL K+++  + K     +FQ 
Sbjct  86   LSNFVEDSFSAGSSVTLDKDSFN-DHKNNDSHRFQT  120


 Score = 32.3 bits (72),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 12/18 (67%), Positives = 14/18 (78%), Gaps = 0/18 (0%)
 Frame = +1

Query  124  CGSFFDHIDDLIDFPPEN  177
            CG FFD IDDL+DF  E+
Sbjct  12   CGDFFDQIDDLLDFSTED  29



>ref|XP_010554544.1| PREDICTED: GATA transcription factor 8-like [Tarenaya hassleriana]
Length=317

 Score = 43.1 bits (100),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 17/25 (68%), Positives = 23/25 (92%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            +F DE+DCG+FFD++DDLIDFP E+
Sbjct  5    SFADEMDCGNFFDNMDDLIDFPNED  29


 Score = 38.5 bits (88),  Expect(2) = 2e-07, Method: Compositional matrix adjust.
 Identities = 28/66 (42%), Positives = 37/66 (56%), Gaps = 6/66 (9%)
 Frame = +2

Query  188  GVGSGDCANFPSIWD---EPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFV  358
            G G GD   FPSIW    E  P SD +FS+ ++  +        VP+ +IVQLE  S FV
Sbjct  33   GFGMGDNDVFPSIWSAQPESWPGSDQLFSSKNNSDSPTELY---VPFANIVQLEQPSGFV  89

Query  359  EESFSD  376
            ++S SD
Sbjct  90   DDSCSD  95



>gb|ACJ02090.1| AG-motif binding protein [Garcinia mangostana]
Length=335

 Score = 59.3 bits (142),  Expect = 2e-07, Method: Compositional matrix adjust.
 Identities = 29/47 (62%), Positives = 35/47 (74%), Gaps = 1/47 (2%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENY-PLNPKPESDKKFQA  448
            VPYEDIVQLEWLS FVE+SFS G LT+ KE+Y  +N K  S ++F  
Sbjct  77   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKEDYSSINNKDSSPRQFHT  123



>ref|XP_002311088.1| zinc finger family protein [Populus trichocarpa]
 gb|EEE88455.1| zinc finger family protein [Populus trichocarpa]
Length=354

 Score = 53.9 bits (128),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/45 (60%), Positives = 30/45 (67%), Gaps = 0/45 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQ  445
            VPYEDIVQLEWLS FVE+SFS G LT+ KE   +    ES    Q
Sbjct  84   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKEESTIVNNKESPPHHQ  128


 Score = 50.1 bits (118),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  88   SSMDSNFVDEIDCGSFFDHIDDLIDFP  168
            ++  SNF+DEIDCGSFF+HIDDL++FP
Sbjct  5    TNTTSNFMDEIDCGSFFEHIDDLLEFP  31



>dbj|BAP90356.1| GATA type zinc finger domain [Populus nigra]
Length=352

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKE  400
            VPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  84   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113



>ref|XP_006378769.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 ref|XP_002316371.2| zinc finger family protein [Populus trichocarpa]
 gb|ERP56566.1| hypothetical protein POPTR_0010s23010g [Populus trichocarpa]
 gb|EEF02542.2| zinc finger family protein [Populus trichocarpa]
Length=352

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKE  400
            VPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  84   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  88   SSMDSNFVDEIDCGSFFDHIDDLIDFP  168
            ++  S F+DEIDCGSFFDHIDDL+DFP
Sbjct  5    TNTSSGFMDEIDCGSFFDHIDDLLDFP  31



>ref|XP_011031733.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=358

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKE  400
            VPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  84   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113


 Score = 49.7 bits (117),  Expect = 4e-04, Method: Compositional matrix adjust.
 Identities = 19/27 (70%), Positives = 25/27 (93%), Gaps = 0/27 (0%)
 Frame = +1

Query  88   SSMDSNFVDEIDCGSFFDHIDDLIDFP  168
            ++  SNF+DEIDCGSFF+HIDDL++FP
Sbjct  5    TNTTSNFMDEIDCGSFFEHIDDLLEFP  31



>ref|XP_011041012.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
 ref|XP_011041013.1| PREDICTED: GATA transcription factor 8-like [Populus euphratica]
Length=355

 Score = 53.5 bits (127),  Expect = 2e-05, Method: Compositional matrix adjust.
 Identities = 24/30 (80%), Positives = 26/30 (87%), Gaps = 0/30 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKE  400
            VPYEDIVQLEWLS FVE+SFS G LT+ KE
Sbjct  84   VPYEDIVQLEWLSNFVEDSFSGGSLTMKKE  113


 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 20/27 (74%), Positives = 24/27 (89%), Gaps = 0/27 (0%)
 Frame = +1

Query  88   SSMDSNFVDEIDCGSFFDHIDDLIDFP  168
            ++  S F+DEIDCGSFFDHIDDL+DFP
Sbjct  5    TNTSSGFMDEIDCGSFFDHIDDLLDFP  31



>dbj|BAH20385.1| AT3G54810 [Arabidopsis thaliana]
Length=322

 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFP  168
            ++F +++DCG+FFD++DDL+DFP
Sbjct  4    TSFPEDLDCGNFFDNMDDLMDFP  26


 Score = 37.4 bits (85),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 27/65 (42%), Positives = 38/65 (58%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW    D     SDP+FS+  +  +S       VP+EDIV++E   +F
Sbjct  33   GFGIGDSDSFPTIWTTHHDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPPSF  89

Query  356  VEESF  370
            VEE+F
Sbjct  90   VEETF  94



>ref|XP_010427201.1| PREDICTED: GATA transcription factor 8-like isoform X1 [Camelina 
sativa]
Length=326

 Score = 37.7 bits (86),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPD----SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW  P       SDP+FS+  + ++        VP+EDIV+++   +F
Sbjct  33   GFGIGDSDSFPTIWTSPQDTWPAASDPLFSSNTTTNSDSSPELY-VPFEDIVKVDRPPSF  91

Query  356  VEESF  370
            VEES 
Sbjct  92   VEESL  96


 Score = 36.6 bits (83),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDL+DFP
Sbjct  6    FPEDLDCGNFFDNMDDLMDFP  26



>emb|CDY67017.1| BnaCnng53150D [Brassica napus]
Length=333

 Score = 38.1 bits (87),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDL+DFP
Sbjct  6    FAEDLDCGNFFDNMDDLLDFP  26


 Score = 36.6 bits (83),  Expect(2) = 2e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 36/65 (55%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW    D     SDP+F++  +  +S       VP+EDIV++E    F
Sbjct  33   GFGIGDSDSFPNIWTTHQDTWPAASDPLFASNTNSDSSPELY---VPFEDIVKVERPKCF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



>ref|XP_007218229.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
 gb|EMJ19428.1| hypothetical protein PRUPE_ppa007936mg [Prunus persica]
Length=351

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 34/47 (72%), Gaps = 1/47 (2%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS FVE+SFS G LT+ K +  +N K  S ++FQ +
Sbjct  79   VPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFIN-KDTSHRQFQTS  124



>ref|XP_007151876.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
 gb|ESW23870.1| hypothetical protein PHAVU_004G083100g [Phaseolus vulgaris]
Length=336

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 27/48 (56%), Positives = 33/48 (69%), Gaps = 1/48 (2%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPE-SDKKFQAA  451
            VPYEDIVQLEWLS FVE+SFS G LT+ +E      K + +  +FQ A
Sbjct  75   VPYEDIVQLEWLSNFVEDSFSGGSLTMQQEQPQCTNKEDITHAQFQTA  122



>ref|XP_009345388.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=351

 Score = 52.8 bits (125),  Expect = 4e-05, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS F E+SFS G LT+ K + P      S ++FQ +
Sbjct  79   VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNPFVNNESSHQQFQTS  125



>ref|XP_010032187.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Eucalyptus 
grandis]
Length=310

 Score = 52.0 bits (123),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 23/28 (82%), Positives = 24/28 (86%), Gaps = 0/28 (0%)
 Frame = +2

Query  317  YEDIVQLEWLSAFVEESFSDGGLTLGKE  400
            YEDIVQLEWLS FVEESFS G LT+ KE
Sbjct  33   YEDIVQLEWLSTFVEESFSGGSLTMSKE  60



>ref|XP_008233316.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
 ref|XP_008233317.1| PREDICTED: GATA transcription factor 8 [Prunus mume]
Length=351

 Score = 52.4 bits (124),  Expect = 6e-05, Method: Compositional matrix adjust.
 Identities = 27/47 (57%), Positives = 33/47 (70%), Gaps = 1/47 (2%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS FVE+SFS G LT+ K +  +N K  S  +FQ +
Sbjct  79   VPIEDIVQLEWLSNFVEDSFSGGSLTINKPDSFIN-KDTSHHQFQTS  124



>ref|XP_006591215.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X2 [Glycine max]
 ref|XP_006591216.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X3 [Glycine max]
Length=238

 Score = 51.6 bits (122),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL+DFP ++
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVKD  29



>ref|XP_002876270.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
 gb|EFH52529.1| BME3/BME3-ZF [Arabidopsis lyrata subsp. lyrata]
Length=319

 Score = 37.0 bits (84),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 13/22 (59%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFP  168
            +F +++DCG+FFD++DDL+DFP
Sbjct  5    SFPEDLDCGNFFDNMDDLMDFP  26


 Score = 35.8 bits (81),  Expect(2) = 8e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 35/65 (54%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPD----SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW          SDP+FS+  +  +S       VP+EDIV++E    F
Sbjct  33   GFGIGDSDSFPTIWTTHHDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPPTF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



>ref|NP_191041.1| GATA transcription factor 8 [Arabidopsis thaliana]
 ref|NP_850704.1| GATA transcription factor 8 [Arabidopsis thaliana]
 sp|Q9SV30.1|GATA8_ARATH RecName: Full=GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AAL06560.1|AF412107_1 AT3g54810/F28P10_210 [Arabidopsis thaliana]
 emb|CAB41103.1| putative protein [Arabidopsis thaliana]
 gb|AAL77730.1| AT3g54810/F28P10_210 [Arabidopsis thaliana]
 dbj|BAH20168.1| AT3G54810 [Arabidopsis thaliana]
 gb|AEE79293.1| GATA transcription factor 8 [Arabidopsis thaliana]
 gb|AEE79294.1| GATA transcription factor 8 [Arabidopsis thaliana]
Length=322

 Score = 37.4 bits (85),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 13/23 (57%), Positives = 22/23 (96%), Gaps = 0/23 (0%)
 Frame = +1

Query  100  SNFVDEIDCGSFFDHIDDLIDFP  168
            ++F +++DCG+FFD++DDL+DFP
Sbjct  4    TSFPEDLDCGNFFDNMDDLMDFP  26


 Score = 35.0 bits (79),  Expect(2) = 9e-05, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW    D     SDP+FS+  +  +S       VP+EDIV++E   +F
Sbjct  33   GFGIGDSDSFPTIWTTHHDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPPSF  89

Query  356  VEESF  370
            VEE+ 
Sbjct  90   VEETL  94



>ref|XP_009344766.1| PREDICTED: GATA transcription factor 8-like [Pyrus x bretschneideri]
Length=354

 Score = 51.6 bits (122),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/47 (53%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS F E+SFS G LT+ K +     K  S ++FQ +
Sbjct  82   VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDSSFINKESSHQQFQTS  128



>emb|CDX73447.1| BnaC08g25560D [Brassica napus]
Length=323

 Score = 37.4 bits (85),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F ++IDCG+FFD++DD++DFP
Sbjct  6    FPEDIDCGNFFDNMDDILDFP  26


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPD----SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G   GD  +FP+IW          SDP+FS+  +  +S       VP+EDIV++E  ++F
Sbjct  33   GFSIGDSDSFPNIWTNHQDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPASF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



>ref|XP_006591214.1| PREDICTED: VHS domain-containing protein At3g16270-like isoform 
X1 [Glycine max]
Length=270

 Score = 50.8 bits (120),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 20/25 (80%), Positives = 24/25 (96%), Gaps = 0/25 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFPPEN  177
            NF+DEIDCGSFFDHIDDL+DFP ++
Sbjct  5    NFMDEIDCGSFFDHIDDLLDFPVKD  29



>ref|XP_010504307.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
 ref|XP_010504308.1| PREDICTED: GATA transcription factor 8 [Camelina sativa]
Length=326

 Score = 36.6 bits (83),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDL+DFP
Sbjct  6    FPEDLDCGNFFDNMDDLMDFP  26


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW    D     SDP+FS+  + ++        VP+EDIV+++   +F
Sbjct  33   GFGIGDSDSFPTIWTSHQDTWPAASDPLFSSNTTTNSDSSPELY-VPFEDIVKVDRPPSF  91

Query  356  VEESF  370
            VEES 
Sbjct  92   VEESL  96



>ref|XP_010427202.1| PREDICTED: GATA transcription factor 8-like isoform X2 [Camelina 
sativa]
Length=326

 Score = 36.6 bits (83),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDL+DFP
Sbjct  6    FPEDLDCGNFFDNMDDLMDFP  26


 Score = 35.0 bits (79),  Expect(2) = 1e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 37/65 (57%), Gaps = 5/65 (8%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD  +FP+IW    D     SDP+FS+  + ++        VP+EDIV+++   +F
Sbjct  33   GFGIGDSDSFPTIWTSHQDTWPAASDPLFSSNTTTNSDSSPELY-VPFEDIVKVDRPPSF  91

Query  356  VEESF  370
            VEES 
Sbjct  92   VEESL  96



>ref|XP_004149904.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 ref|XP_004158598.1| PREDICTED: GATA transcription factor 4-like [Cucumis sativus]
 gb|KGN47830.1| hypothetical protein Csa_6G405920 [Cucumis sativus]
Length=327

 Score = 37.0 bits (84),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 30/76 (39%), Positives = 42/76 (55%), Gaps = 9/76 (12%)
 Frame = +2

Query  197  SGDCANFPSIWDEPL------PDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAFV  358
            + + A FP IW E        P  DP+  + ++   S LS +L VPY+D  Q+EWLS FV
Sbjct  33   NTNSAAFPPIWSEHSDSLPSDPVVDPVLFSVNTAPDSALSPDLCVPYDD--QMEWLSNFV  90

Query  359  EESFSDG-GLTLGKEN  403
            ++SFS    LT+   N
Sbjct  91   DDSFSGAETLTINASN  106


 Score = 34.3 bits (77),  Expect(2) = 2e-04, Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 18/20 (90%), Gaps = 0/20 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLID  162
            N  +EIDCG+FFD+I+DL++
Sbjct  5    NIAEEIDCGNFFDNIEDLLE  24



>ref|XP_008367332.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score = 50.4 bits (119),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 31/47 (66%), Gaps = 0/47 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS F E+SFS G LT+ K +     +  S ++FQ +
Sbjct  79   VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDISFINREPSHQQFQTS  125



>ref|XP_008347480.1| PREDICTED: GATA transcription factor 8-like [Malus domestica]
Length=351

 Score = 50.1 bits (118),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 24/47 (51%), Positives = 30/47 (64%), Gaps = 0/47 (0%)
 Frame = +2

Query  311  VPYEDIVQLEWLSAFVEESFSDGGLTLGKENYPLNPKPESDKKFQAA  451
            VP EDIVQLEWLS F E+SFS G LT+ K +        S ++FQ +
Sbjct  79   VPIEDIVQLEWLSNFCEDSFSGGSLTINKPDNSFVNNESSHRQFQTS  125



>ref|XP_009116158.1| PREDICTED: GATA transcription factor 8 [Brassica rapa]
Length=324

 Score = 37.4 bits (85),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F ++IDCG+FFD++DD++DFP
Sbjct  6    FPEDIDCGNFFDNMDDILDFP  26


 Score = 33.5 bits (75),  Expect(2) = 3e-04, Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (54%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPD----SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G   GD   FP+IW          SDP+FS+  +  +S       VP+EDIV++E  ++F
Sbjct  33   GFNIGDSDPFPNIWTNHQDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPASF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



>emb|CDY02894.1| BnaC04g25920D [Brassica napus]
Length=333

 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDL+DFP
Sbjct  6    FPEDLDCGNFFDNMDDLLDFP  26


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 36/65 (55%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G   GD  +FP+IW    D     S+P+F++  +  +S       VP+EDIV++E   +F
Sbjct  33   GFSIGDSDSFPNIWTTHHDTWPAASEPVFASNTNSDSSPELY---VPFEDIVKVERPQSF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



>emb|CDX78264.1| BnaA09g34590D [Brassica napus]
Length=324

 Score = 37.4 bits (85),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 13/21 (62%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F ++IDCG+FFD++DD++DFP
Sbjct  6    FPEDIDCGNFFDNMDDILDFP  26


 Score = 33.1 bits (74),  Expect(2) = 4e-04, Method: Compositional matrix adjust.
 Identities = 24/65 (37%), Positives = 35/65 (54%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIWDEPLPD----SDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G   GD  +FP+IW          SDP+FS+  +  +S       VP+EDIV++E  ++F
Sbjct  33   GFNIGDSDSFPNIWTNHQDTWPAASDPLFSSNTNSDSSPELY---VPFEDIVKVERPASF  89

Query  356  VEESF  370
            V ES 
Sbjct  90   VSESL  94



>ref|XP_006403533.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
 dbj|BAJ34547.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ44986.1| hypothetical protein EUTSA_v10010544mg [Eutrema salsugineum]
Length=325

 Score = 37.7 bits (86),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 14/21 (67%), Positives = 20/21 (95%), Gaps = 0/21 (0%)
 Frame = +1

Query  106  FVDEIDCGSFFDHIDDLIDFP  168
            F +++DCG+FFD++DDLIDFP
Sbjct  6    FPEDLDCGNFFDNMDDLIDFP  26


 Score = 32.0 bits (71),  Expect(2) = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/64 (41%), Positives = 36/64 (56%), Gaps = 7/64 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G   GD  +FP+IW    D     SDP+FS+  +  +S       VP+EDIV++E   +F
Sbjct  33   GFDIGDSDSFPNIWTTHHDTWPTASDPLFSSNTNSDSSTELY---VPFEDIVKVERPPSF  89

Query  356  VEES  367
            VEES
Sbjct  90   VEES  93



>ref|XP_006291493.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
 gb|EOA24391.1| hypothetical protein CARUB_v10017647mg [Capsella rubella]
Length=323

 Score = 35.8 bits (81),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 12/22 (55%), Positives = 21/22 (95%), Gaps = 0/22 (0%)
 Frame = +1

Query  103  NFVDEIDCGSFFDHIDDLIDFP  168
            +F +++DCG+FFD++DD++DFP
Sbjct  5    SFPEDLDCGNFFDNMDDIMDFP  26


 Score = 33.5 bits (75),  Expect(2) = 9e-04, Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 37/65 (57%), Gaps = 7/65 (11%)
 Frame = +2

Query  188  GVGSGDCANFPSIW----DEPLPDSDPIFsaahshsasdlsaelsVPYEDIVQLEWLSAF  355
            G G GD   FP+IW    D     SDP+FS+  + ++S       VP+EDIV+++   +F
Sbjct  33   GFGIGDSDAFPTIWTTQHDTWPAASDPLFSSNTNSNSSTELY---VPFEDIVKVDRPQSF  89

Query  356  VEESF  370
            VEES 
Sbjct  90   VEESL  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515