BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A05

Length=571
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

emb|CDO98845.1|  unnamed protein product                                195   5e-60   Coffea canephora [robusta coffee]
gb|KJB28660.1|  hypothetical protein B456_005G061200                    194   6e-60   Gossypium raimondii
gb|KHG14753.1|  Dynein light chain 1, cytoplasmic                       194   1e-59   Gossypium arboreum [tree cotton]
ref|XP_011090994.1|  PREDICTED: dynein light chain 2, cytoplasmic...    194   1e-59   Sesamum indicum [beniseed]
ref|XP_008390638.1|  PREDICTED: dynein light chain 2, cytoplasmic...    189   6e-58   
ref|XP_009352292.1|  PREDICTED: dynein light chain 2, cytoplasmic       189   1e-57   Pyrus x bretschneideri [bai li]
ref|XP_008340792.1|  PREDICTED: dynein light chain 2, cytoplasmic       189   1e-57   
ref|XP_007223479.1|  hypothetical protein PRUPE_ppa013502mg             188   1e-57   Prunus persica
ref|XP_003546364.1|  PREDICTED: dynein light chain 2, cytoplasmic...    187   3e-57   Glycine max [soybeans]
ref|XP_003533298.1|  PREDICTED: dynein light chain 2, cytoplasmic...    187   2e-56   Glycine max [soybeans]
gb|KJB72713.1|  hypothetical protein B456_011G192000                    186   2e-56   Gossypium raimondii
gb|AFY26900.1|  dynein light chain                                      185   4e-56   Morella rubra [Chinese arbutus]
ref|XP_006419530.1|  hypothetical protein CICLE_v10007063mg             184   5e-56   Citrus clementina [clementine]
ref|NP_001238295.1|  uncharacterized protein LOC100527842               184   7e-56   Glycine max [soybeans]
ref|XP_011007828.1|  PREDICTED: dynein light chain 1, cytoplasmic       182   3e-55   Populus euphratica
ref|XP_006342815.1|  PREDICTED: dynein light chain 2, cytoplasmic...    182   4e-55   Solanum tuberosum [potatoes]
gb|KHG22395.1|  Dynein 8 kDa light chain, flagellar outer arm           182   5e-55   Gossypium arboreum [tree cotton]
ref|XP_002270438.1|  PREDICTED: dynein light chain 1, cytoplasmic       180   3e-54   Vitis vinifera
ref|XP_010024718.1|  PREDICTED: dynein light chain 1, cytoplasmic       179   4e-54   Eucalyptus grandis [rose gum]
ref|XP_004296858.1|  PREDICTED: dynein light chain 1, cytoplasmic       179   4e-54   Fragaria vesca subsp. vesca
ref|XP_004229253.1|  PREDICTED: dynein light chain 2, cytoplasmic       179   7e-54   Solanum lycopersicum
gb|ABU98947.1|  dynein light chain                                      178   1e-53   Lupinus albus
ref|XP_010551078.1|  PREDICTED: dynein light chain 1, cytoplasmic...    178   2e-53   Tarenaya hassleriana [spider flower]
ref|XP_010259500.1|  PREDICTED: dynein light chain 2, cytoplasmic...    177   2e-53   Nelumbo nucifera [Indian lotus]
ref|XP_009594796.1|  PREDICTED: dynein light chain LC6, flagellar...    178   3e-53   Nicotiana tomentosiformis
ref|XP_007138930.1|  hypothetical protein PHAVU_009G249900g             177   3e-53   Phaseolus vulgaris [French bean]
ref|XP_007138929.1|  hypothetical protein PHAVU_009G249800g             177   5e-53   Phaseolus vulgaris [French bean]
ref|XP_004134221.1|  PREDICTED: dynein light chain 1, cytoplasmic...    176   7e-53   Cucumis sativus [cucumbers]
gb|EYU43969.1|  hypothetical protein MIMGU_mgv1a016455mg                176   1e-52   Erythranthe guttata [common monkey flower]
ref|XP_009618976.1|  PREDICTED: dynein light chain 1, cytoplasmic...    175   3e-52   Nicotiana tomentosiformis
ref|XP_003609697.1|  Dynein light chain 1 cytoplasmic-like protein      174   5e-52   Medicago truncatula
ref|XP_008458417.1|  PREDICTED: dynein light chain 1, cytoplasmic       174   8e-52   Cucumis melo [Oriental melon]
ref|XP_004150499.1|  PREDICTED: dynein light chain 1, cytoplasmic...    173   9e-52   Cucumis sativus [cucumbers]
emb|CDY57865.1|  BnaC08g47800D                                          173   2e-51   Brassica napus [oilseed rape]
gb|KJB28661.1|  hypothetical protein B456_005G061200                    172   2e-51   Gossypium raimondii
ref|XP_010524543.1|  PREDICTED: dynein light chain LC6, flagellar...    173   2e-51   Tarenaya hassleriana [spider flower]
ref|XP_009136731.1|  PREDICTED: dynein light chain 2, cytoplasmic...    172   2e-51   Brassica rapa
ref|XP_004508201.1|  PREDICTED: dynein light chain 2, cytoplasmic...    172   3e-51   Cicer arietinum [garbanzo]
gb|KFK33807.1|  hypothetical protein AALP_AA5G062700                    172   4e-51   Arabis alpina [alpine rockcress]
ref|XP_006596992.1|  PREDICTED: uncharacterized protein LOC100527...    172   5e-51   Glycine max [soybeans]
gb|KJB38567.1|  hypothetical protein B456_006G261500                    171   7e-51   Gossypium raimondii
ref|XP_002870199.1|  At4g15930                                          171   8e-51   
ref|XP_010434906.1|  PREDICTED: dynein light chain 1, cytoplasmic...    171   8e-51   Camelina sativa [gold-of-pleasure]
ref|XP_009782613.1|  PREDICTED: dynein light chain LC6, flagellar...    171   1e-50   Nicotiana sylvestris
ref|XP_010440231.1|  PREDICTED: dynein light chain 2, cytoplasmic...    171   1e-50   Camelina sativa [gold-of-pleasure]
emb|CDX90554.1|  BnaA03g42270D                                          171   1e-50   
emb|CDY09728.1|  BnaC07g33330D                                          170   2e-50   Brassica napus [oilseed rape]
ref|NP_001238570.1|  uncharacterized protein LOC100305908               170   2e-50   Glycine max [soybeans]
ref|XP_008438899.1|  PREDICTED: dynein light chain 1, cytoplasmic...    170   2e-50   
ref|NP_193328.4|  dynein light chain LC8-type                           170   2e-50   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009107870.1|  PREDICTED: dynein light chain LC6, flagellar...    170   2e-50   Brassica rapa
ref|XP_006284766.1|  hypothetical protein CARUB_v10006033mg             169   4e-50   Capsella rubella
gb|AAL57365.1|AF404866_1  neuronal nitric oxide synthase protein ...    166   3e-49   Arabidopsis thaliana [mouse-ear cress]
gb|AFK44581.1|  unknown                                                 168   3e-49   Lotus japonicus
emb|CAB46031.1|  dynein light chain like protein                        166   3e-49   Arabidopsis thaliana [mouse-ear cress]
ref|XP_006414418.1|  hypothetical protein EUTSA_v10026570mg             167   4e-49   Eutrema salsugineum [saltwater cress]
gb|EPS63643.1|  hypothetical protein M569_11140                         165   1e-48   Genlisea aurea
ref|XP_010693604.1|  PREDICTED: dynein light chain 1, cytoplasmic...    163   8e-48   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010269586.1|  PREDICTED: dynein light chain 2, cytoplasmic...    164   9e-48   Nelumbo nucifera [Indian lotus]
dbj|BAJ99897.1|  predicted protein                                      163   3e-47   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_008789848.1|  PREDICTED: dynein light chain 1, cytoplasmic...    160   2e-46   Phoenix dactylifera
ref|NP_001168554.1|  uncharacterized protein LOC100382335               159   5e-46   Zea mays [maize]
dbj|BAJ90639.1|  predicted protein                                      154   5e-44   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|NP_001132811.1|  uncharacterized protein LOC100194301               154   6e-44   Zea mays [maize]
ref|XP_010269585.1|  PREDICTED: dynein light chain 1, cytoplasmic...    153   2e-43   Nelumbo nucifera [Indian lotus]
ref|XP_003566466.1|  PREDICTED: dynein light chain 1, cytoplasmic       153   2e-43   Brachypodium distachyon [annual false brome]
ref|XP_010921629.1|  PREDICTED: dynein light chain 1, cytoplasmic       152   4e-43   
ref|XP_004967828.1|  PREDICTED: dynein 8 kDa light chain, flagell...    151   4e-43   Setaria italica
gb|KHN26541.1|  Dynein light chain 2, cytoplasmic                       151   5e-43   Glycine soja [wild soybean]
ref|XP_008784763.1|  PREDICTED: LOW QUALITY PROTEIN: dynein light...    150   1e-42   Phoenix dactylifera
ref|XP_002455387.1|  hypothetical protein SORBIDRAFT_03g009850          150   2e-42   Sorghum bicolor [broomcorn]
ref|NP_001042625.1|  Os01g0256400                                       148   9e-42   
gb|EEE54259.1|  hypothetical protein OsJ_01150                          148   1e-41   Oryza sativa Japonica Group [Japonica rice]
emb|CDQ77749.1|  unnamed protein product                                148   2e-41   Oncorhynchus mykiss
ref|XP_009414896.1|  PREDICTED: dynein light chain 1, cytoplasmic...    145   9e-41   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008693734.1|  PREDICTED: dynein light chain 2, cytoplasmic       144   1e-40   Ursus maritimus [white bear]
ref|XP_001363123.2|  PREDICTED: dynein light chain 2, cytoplasmic...    145   3e-40   
ref|XP_004434820.1|  PREDICTED: dynein light chain 2, cytoplasmic...    143   4e-40   
ref|XP_007086772.1|  PREDICTED: dynein light chain 2, cytoplasmic       143   5e-40   Panthera tigris altaica
ref|XP_005394096.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   6e-40   Chinchilla lanigera
ref|XP_004747381.1|  PREDICTED: dynein light chain 2, cytoplasmic...    143   7e-40   
ref|XP_001503476.3|  PREDICTED: dynein light chain 2, cytoplasmic...    142   8e-40   
ref|XP_004405258.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   9e-40   Odobenus rosmarus divergens
ref|XP_004405257.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   1e-39   Odobenus rosmarus divergens
ref|XP_005624775.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   1e-39   
ref|XP_008056250.1|  PREDICTED: dynein light chain 2, cytoplasmic       142   1e-39   Carlito syrichta
ref|XP_002683249.1|  predicted protein                                  141   1e-39   Naegleria gruberi strain NEG-M
ref|XP_003272346.1|  PREDICTED: dynein light chain 2, cytoplasmic       143   1e-39   Nomascus leucogenys [White-cheeked Gibbon]
ref|XP_004798759.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   1e-39   
ref|XP_005962028.1|  PREDICTED: dynein light chain 1, cytoplasmic       142   2e-39   Pantholops hodgsonii [Tibetan antelope]
ref|XP_005624774.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   2e-39   
ref|XP_004377946.1|  PREDICTED: dynein light chain 2, cytoplasmic...    144   2e-39   
ref|XP_009383543.1|  PREDICTED: dynein light chain 1, cytoplasmic...    141   2e-39   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002930443.1|  PREDICTED: dynein light chain 1, cytoplasmic...    142   2e-39   Ailuropoda melanoleuca
ref|XP_007622405.1|  PREDICTED: dynein light chain 2, cytoplasmic...    142   2e-39   
ref|NP_498422.1|  Protein DLC-1                                         140   2e-39   Caenorhabditis elegans [roundworm]
ref|XP_005959962.1|  PREDICTED: dynein light chain 2, cytoplasmic...    143   2e-39   Pantholops hodgsonii [Tibetan antelope]
ref|XP_003931391.1|  PREDICTED: dynein light chain 2, cytoplasmic       142   3e-39   Saimiri boliviensis boliviensis
ref|XP_006154720.1|  PREDICTED: dynein light chain 2, cytoplasmic...    140   4e-39   
gb|KFO35006.1|  Dynein light chain 2, cytoplasmic                       141   4e-39   Fukomys damarensis [Damara mole rat]
emb|CDS31683.1|  neuronal nitric oxidse synthase protein                140   4e-39   Hymenolepis microstoma
ref|XP_004905885.1|  PREDICTED: dynein light chain 2, cytoplasmic       141   5e-39   
gb|ETE67687.1|  Dynein light chain 2, cytoplasmic                       140   5e-39   Ophiophagus hannah
ref|XP_006154718.1|  PREDICTED: dynein light chain 2, cytoplasmic...    140   6e-39   
ref|XP_007126910.1|  PREDICTED: dynein light chain 2, cytoplasmic       140   6e-39   
gb|EKC35615.1|  Dynein light chain 2, cytoplasmic                       141   8e-39   Crassostrea gigas
ref|XP_003971218.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   1e-38   
gb|ACQ58498.1|  Dynein light chain 2, cytoplasmic                       139   1e-38   Anoplopoma fimbria
emb|CDJ90138.1|  Dynein light chain domain containing protein           139   1e-38   Haemonchus contortus [red stomach worm]
gb|KIH57877.1|  dynein light chain type 1                               139   1e-38   Ancylostoma duodenale
ref|XP_002408929.1|  dynein light chain                                 139   1e-38   Ixodes scapularis [blacklegged tick]
gb|ERL95022.1|  hypothetical protein D910_12292                         140   1e-38   Dendroctonus ponderosae
gb|ENN71870.1|  hypothetical protein YQE_11485                          140   1e-38   Dendroctonus ponderosae
ref|XP_011420841.1|  PREDICTED: dynein light chain 2, cytoplasmic       139   1e-38   Crassostrea gigas
gb|KIY45023.1|  outer dynein arm light chain 8                          139   1e-38   Fistulina hepatica ATCC 64428
gb|ETN73136.1|  dynein light chain type 1                               139   1e-38   Necator americanus
gb|KDR18512.1|  Dynein light chain 1, cytoplasmic                       139   1e-38   Zootermopsis nevadensis
ref|XP_004076438.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   1e-38   Oryzias latipes [Japanese rice fish]
ref|XP_005394095.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   1e-38   
ref|XP_006154719.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   1e-38   
ref|XP_010083528.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   1e-38   Pterocles gutturalis
emb|CEF68120.1|  Dynein, light chain, LC8-type 2                        139   1e-38   Strongyloides ratti
ref|XP_005298897.1|  PREDICTED: dynein light chain 2, cytoplasmic...    140   1e-38   
ref|XP_003446871.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   2e-38   Oreochromis niloticus
gb|EAW94483.1|  dynein, light chain, LC8-type 2, isoform CRA_a          143   2e-38   Homo sapiens [man]
ref|XP_001782608.1|  predicted protein                                  139   2e-38   
emb|CBI22981.3|  unnamed protein product                                138   2e-38   Vitis vinifera
gb|AHH29554.1|  dynein light chain type 1                               139   2e-38   Rhipicephalus microplus [cattle tick]
gb|EYB97434.1|  hypothetical protein Y032_0141g2270                     139   2e-38   Ancylostoma ceylanicum
ref|XP_006644010.1|  PREDICTED: dynein light chain 1, cytoplasmic...    138   2e-38   
ref|XP_006138678.1|  PREDICTED: dynein light chain 2, cytoplasmic       139   2e-38   
pdb|1RE6|A  Chain A, Localisation Of Dynein Light Chains 1 And 2 ...    139   2e-38   Mus musculus [mouse]
ref|XP_005026707.1|  PREDICTED: dynein light chain 1, cytoplasmic...    139   2e-38   Anas platyrhynchos [duck]
gb|KFO65122.1|  Dynein light chain 1, cytoplasmic                       139   2e-38   Corvus brachyrhynchos
ref|XP_008330933.1|  PREDICTED: dynein light chain 2, cytoplasmic...    138   2e-38   Cynoglossus semilaevis [half-smooth tongue sole]
ref|XP_007176204.1|  PREDICTED: dynein light chain 2, cytoplasmic       140   2e-38   
ref|XP_009025211.1|  hypothetical protein HELRODRAFT_68300              138   2e-38   Helobdella robusta
ref|XP_969268.1|  PREDICTED: dynein light chain 1, cytoplasmic          138   2e-38   Tribolium castaneum [rust-red flour beetle]
ref|XP_008333591.1|  PREDICTED: dynein light chain 2, cytoplasmic...    140   2e-38   Cynoglossus semilaevis [half-smooth tongue sole]
gb|EOB06446.1|  Dynein light chain 2, cytoplasmic                       138   2e-38   Anas platyrhynchos [duck]
ref|XP_011347927.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   2e-38   
ref|XP_010791813.1|  PREDICTED: dynein light chain 2, cytoplasmic...    138   2e-38   Notothenia coriiceps [yellowbelly rockcod]
ref|XP_008935180.1|  PREDICTED: dynein light chain 2, cytoplasmic       138   2e-38   Merops nubicus
ref|NP_080832.1|  dynein light chain 2, cytoplasmic                     138   3e-38   Mus musculus [mouse]
ref|XP_005012658.1|  PREDICTED: dynein light chain 2, cytoplasmic       138   3e-38   
ref|NP_956393.1|  dynein, light chain, LC8-type 2a                      138   3e-38   Danio rerio [leopard danio]
ref|XP_007663446.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   3e-38   
gb|KFQ26531.1|  Dynein light chain 2, cytoplasmic                       138   3e-38   Merops nubicus
ref|XP_001702907.1|  outer dynein arm light chain 8                     138   3e-38   Chlamydomonas reinhardtii
ref|XP_002946897.1|  outer dynein arm light chain 8, 8 kD               138   3e-38   Volvox carteri f. nagariensis
ref|XP_003740759.1|  PREDICTED: dynein light chain 2, cytoplasmic...    138   3e-38   Galendromus occidentalis
ref|XP_004946822.1|  PREDICTED: dynein light chain 2, cytoplasmic...    139   3e-38   
ref|XP_002602246.1|  hypothetical protein BRAFLDRAFT_114344             138   3e-38   Branchiostoma floridae
ref|XP_009042037.1|  dynein light chain protein 1                       138   3e-38   Aureococcus anophagefferens
ref|XP_004706475.1|  PREDICTED: dynein light chain 1, cytoplasmic...    138   3e-38   Echinops telfairi [lesser hedgehog tenrec]
gb|AAH56312.2|  Dnl2 protein                                            139   3e-38   Danio rerio [leopard danio]
ref|XP_001897484.1|  Dynein light chain 1, cytoplasmic                  138   3e-38   Brugia malayi [agent of lymphatic filariasis]
ref|XP_795719.1|  PREDICTED: dynein light chain LC6, flagellar ou...    138   3e-38   Strongylocentrotus purpuratus [purple urchin]
pdb|4QH7|A  Chain A, Lc8 - Ana2 (159-168) Complex                       138   3e-38   Drosophila melanogaster
pdb|3P8M|A  Chain A, Human Dynein Light Chain (Dynll2) In Complex...    138   3e-38   Saccharomyces cerevisiae [brewer's yeast]
gb|EJY68452.1|  hypothetical protein OXYTRI_10934                       137   4e-38   Oxytricha trifallax
ref|XP_002507507.1|  flagellar outer dynein arm light chain 8           137   4e-38   Micromonas commoda
ref|XP_005777809.1|  hypothetical protein EMIHUDRAFT_367415             137   4e-38   Emiliania huxleyi CCMP1516
emb|CDQ58993.1|  unnamed protein product                                138   4e-38   Oncorhynchus mykiss
emb|CBY18296.1|  unnamed protein product                                137   4e-38   Oikopleura dioica
gb|EFA05576.1|  hypothetical protein TcasGA2_TC015765                   140   4e-38   
gb|AAI22095.1|  Dnl2 protein                                            139   4e-38   Danio rerio [leopard danio]
ref|XP_009167363.1|  hypothetical protein T265_04378                    137   4e-38   Opisthorchis viverrini [Southeast Asian liver fluke]
ref|XP_006220091.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   4e-38   
gb|ACO10102.1|  Dynein light chain 2, cytoplasmic                       137   4e-38   Osmerus mordax
ref|XP_003705084.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   4e-38   Megachile rotundata
ref|XP_001775138.1|  predicted protein                                  138   5e-38   
ref|XP_002140822.1|  dynein light chain 1 protein                       137   5e-38   Cryptosporidium muris RN66
ref|XP_003726638.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   5e-38   Strongylocentrotus purpuratus [purple urchin]
tpg|DAA34424.1|  TPA: dynein light chain                                137   5e-38   Amblyomma variegatum
gb|AAI15161.1|  Dnl2 protein                                            139   5e-38   Danio rerio [leopard danio]
ref|XP_011315479.1|  PREDICTED: dynein light chain 1, cytoplasmic...    137   5e-38   Fopius arisanus
ref|NP_525075.1|  cut up, isoform A                                     137   5e-38   Drosophila melanogaster
gb|EFX71839.1|  hypothetical protein DAPPUDRAFT_308639                  137   5e-38   Daphnia pulex
ref|XP_007556385.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   5e-38   Poecilia formosa
pdb|2PG1|A  Chain A, Structural Analysis Of A Cytoplasmic Dynein ...    137   5e-38   Drosophila melanogaster
gb|AAT09073.1|  dynein 8 kDa light chain                                137   6e-38   Bigelowiella natans
ref|XP_004998053.1|  dynein light chain 1                               137   6e-38   Salpingoeca rosetta
ref|NP_001243365.1|  dynein light chain                                 137   6e-38   Aplysia californica
ref|NP_001232446.1|  putative dynein cytoplasmic light peptide va...    137   6e-38   Taeniopygia guttata
ref|NP_001037826.1|  dynein light chain 6                               137   6e-38   Ciona intestinalis [sea vase]
gb|AAP40019.1|  neuronal nitric oxidse synthase protein inhibitor       137   6e-38   Epinephelus akaara
ref|XP_008283113.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   6e-38   Stegastes partitus
gb|AGE89243.1|  dynein light chain-2                                    137   6e-38   Pleurobrachia bachei
gb|KFO23768.1|  Dynein light chain 1, cytoplasmic                       139   7e-38   Fukomys damarensis [Damara mole rat]
gb|EUB61914.1|  Dynein light chain 1, cytoplasmic                       137   7e-38   Echinococcus granulosus
ref|XP_008639842.1|  PREDICTED: dynein light chain 1, cytoplasmic...    138   7e-38   
ref|XP_003451081.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   8e-38   Oreochromis niloticus
ref|XP_009685775.1|  PREDICTED: dynein light chain 1, cytoplasmic...    137   8e-38   Struthio camelus australis
ref|XP_321810.4|  AGAP001335-PA                                         137   8e-38   Anopheles gambiae str. PEST
gb|ACF24567.1|  dynein light chain                                      137   8e-38   Gymnochlora stellata
ref|XP_007898930.1|  PREDICTED: dynein light chain 2, cytoplasmic       137   8e-38   Callorhinchus milii [Australian ghost shark]
ref|XP_003968584.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   8e-38   Takifugu rubripes [tiger puffer]
ref|XP_011315471.1|  PREDICTED: dynein light chain 1, cytoplasmic...    137   8e-38   Fopius arisanus
ref|XP_010226988.1|  PREDICTED: dynein light chain 1, cytoplasmic...    137   9e-38   Tinamus guttatus
ref|XP_001961854.1|  GF15181                                            137   9e-38   Drosophila ananassae
ref|XP_791800.2|  PREDICTED: dynein light chain LC6, flagellar ou...    137   9e-38   
ref|XP_005821422.1|  hypothetical protein GUITHDRAFT_90482              137   9e-38   Guillardia theta CCMP2712
ref|XP_002051711.1|  GJ17025                                            136   1e-37   Drosophila virilis
ref|XP_004075373.1|  PREDICTED: dynein light chain 2, cytoplasmic...    136   1e-37   
ref|XP_003974976.1|  PREDICTED: dynein light chain LC6, flagellar...    136   1e-37   Takifugu rubripes [tiger puffer]
emb|CDJ05601.1|  dynein light chain                                     136   1e-37   
ref|XP_005987216.1|  PREDICTED: dynein light chain LC6, flagellar...    136   1e-37   Latimeria chalumnae
ref|XP_004929013.1|  PREDICTED: dynein light chain 2, cytoplasmic...    137   1e-37   
ref|XP_010819532.1|  PREDICTED: dynein light chain 1, cytoplasmic...    136   1e-37   
gb|KDQ50414.1|  hypothetical protein JAAARDRAFT_42078                   137   1e-37   Jaapia argillacea MUCL 33604
ref|XP_009053825.1|  hypothetical protein LOTGIDRAFT_203845             136   1e-37   Lottia gigantea
ref|XP_003056096.1|  flagellar outer dynein arm light chain 8           136   1e-37   Micromonas pusilla CCMP1545
ref|XP_005154435.1|  PREDICTED: dynein light chain 2, cytoplasmic       137   1e-37   Melopsittacus undulatus
gb|AFS30551.1|  dynein light chain 8a protein                           136   1e-37   Eimeria falciformis
emb|CDO68156.1|  hypothetical protein BN946_scf184938.g8                137   1e-37   Trametes cinnabarina
ref|XP_797363.1|  PREDICTED: dynein light chain LC6, flagellar ou...    136   1e-37   
gb|KIY99664.1|  dynein light chain LC8-type                             136   1e-37   Monoraphidium neglectum
gb|ELT90591.1|  hypothetical protein CAPTEDRAFT_371                     136   1e-37   Capitella teleta
ref|XP_001655386.1|  AAEL011478-PA                                      137   1e-37   
ref|XP_002611808.1|  hypothetical protein BRAFLDRAFT_130244             136   2e-37   Branchiostoma floridae
ref|XP_002001896.1|  GI14559                                            136   2e-37   Drosophila mojavensis
gb|ADD37943.1|  Dynein light chain 1, cytoplasmic                       136   2e-37   Lepeophtheirus salmonis
ref|XP_003384137.1|  PREDICTED: dynein light chain 2, cytoplasmic       136   2e-37   Amphimedon queenslandica
gb|KFH71033.1|  dynein light chain 1, cytoplasmic                       136   2e-37   Mortierella verticillata NRRL 6337
ref|NP_477408.1|  cytoplasmic dynein light chain 2, isoform A           136   2e-37   Drosophila melanogaster
ref|NP_001232448.1|  putative dynein cytoplasmic light peptide va...    136   2e-37   Taeniopygia guttata
gb|ACO14507.1|  Dynein light chain 2, cytoplasmic                       136   2e-37   Esox lucius
ref|XP_002771658.1|  dynein light chain motor protein, putative         136   2e-37   Perkinsus marinus ATCC 50983
gb|ABN13588.1|  dynein light chain                                      136   2e-37   Artemia franciscana
ref|NP_003737.1|  dynein light chain 1, cytoplasmic                     135   2e-37   Homo sapiens [man]
pdb|3BRL|A  Chain A, Crystal Structure Of Lc8 S88e  SWA                 135   2e-37   synthetic construct
ref|XP_007897283.1|  PREDICTED: dynein light chain 1, cytoplasmic       135   2e-37   Callorhinchus milii [Australian ghost shark]
ref|XP_801821.1|  PREDICTED: dynein light chain 2, cytoplasmic-li...    135   2e-37   
ref|XP_006894414.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   2e-37   Elephantulus edwardii [Cape long-eared elephant shrew]
ref|XP_008610951.1|  dynein light chain 2, cytoplasmic                  135   2e-37   Saprolegnia diclina VS20
emb|CDS27671.1|  dynein light chain                                     135   2e-37   Hymenolepis microstoma
ref|XP_002990207.1|  hypothetical protein SELMODRAFT_131219             136   2e-37   
ref|XP_005794902.1|  PREDICTED: dynein light chain 2, cytoplasmic...    135   3e-37   Xiphophorus maculatus
ref|XP_009082707.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   3e-37   Acanthisitta chloris
ref|NP_998189.1|  dynein light chain 1, cytoplasmic                     135   3e-37   Danio rerio [leopard danio]
ref|XP_667783.1|  cut up CG6998-PA                                      135   3e-37   Cryptosporidium hominis TU502
ref|XP_003511737.1|  PREDICTED: dynein light chain 1, cytoplasmic       135   3e-37   Cricetulus griseus [Chinese hamsters]
ref|XP_004929012.1|  PREDICTED: dynein light chain 2, cytoplasmic...    136   3e-37   
gb|EUB57791.1|  Dynein light chain, flagellar outer arm                 135   3e-37   Echinococcus granulosus
gb|EPY31499.1|  dynein light chain LC8-type                             135   3e-37   Strigomonas culicis
ref|XP_004929014.1|  PREDICTED: dynein light chain 2, cytoplasmic...    135   3e-37   Bombyx mori [silk moth]
gb|ACQ58616.1|  Dynein light chain 2, cytoplasmic                       135   3e-37   Anoplopoma fimbria
ref|XP_003726637.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   3e-37   
gb|KGB42146.1|  Dynein 8 kDa light chain, flagellar outer arm           135   3e-37   Schistosoma haematobium
gb|KIY63783.1|  outer dynein arm light chain 8                          136   3e-37   Cylindrobasidium torrendii FP15055 ss-10
ref|NP_001005077.1|  dynein, light chain, LC8-type 1                    135   3e-37   Xenopus tropicalis [western clawed frog]
gb|EMP34135.1|  Dynein light chain 1, cytoplasmic                       135   3e-37   Chelonia mydas [green seaturtle]
gb|ESA01643.1|  hypothetical protein GLOINDRAFT_337867                  135   4e-37   
ref|XP_011090996.1|  PREDICTED: dynein light chain 2, cytoplasmic...    136   4e-37   Sesamum indicum [beniseed]
gb|EZA45265.1|  cytoplasmic dynein light chain 2-like protein           135   4e-37   
ref|XP_003764591.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   4e-37   Sarcophilus harrisii
ref|XP_011501444.1|  PREDICTED: dynein light chain 2, cytoplasmic       135   4e-37   Ceratosolen solmsi marchali
pdb|3DVH|A  Chain A, Lc8 Point Mutant K36p                              135   4e-37   Drosophila melanogaster
emb|CDS27670.1|  dynein light chain                                     135   5e-37   Hymenolepis microstoma
pdb|1CMI|A  Chain A, Structure Of The Human PinLC8 DIMER WITH A B...    135   5e-37   Homo sapiens [man]
ref|XP_003822204.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   5e-37   Pan paniscus [bonobo]
gb|EMD38723.1|  hypothetical protein CERSUDRAFT_81533                   135   5e-37   Gelatoporia subvermispora B
ref|XP_006053053.1|  PREDICTED: dynein light chain 1, cytoplasmic...    135   5e-37   Bubalus bubalis [domestic water buffalo]
emb|CDQ62741.1|  unnamed protein product                                136   5e-37   Oncorhynchus mykiss
ref|XP_002109055.1|  neuronal nitric oxidse synthase protein inhi...    134   6e-37   Trichoplax adhaerens
gb|ACI66012.1|  Dynein light chain 1, cytoplasmic                       134   6e-37   Salmo salar
gb|AFS30550.1|  dynein light chain 8a protein                           134   6e-37   Eimeria tenella
emb|CDS29601.1|  dynein light chain                                     134   6e-37   Hymenolepis microstoma
emb|CCD76586.1|  putative cytoplasmic dynein light chain                134   6e-37   Schistosoma mansoni
emb|CDJ36424.1|  dynein light chain, putative                           135   6e-37   Eimeria mitis
gb|KFQ42661.1|  Dynein light chain 1, cytoplasmic                       134   7e-37   Nestor notabilis
ref|XP_002020696.1|  GL15652                                            134   7e-37   Drosophila persimilis
emb|CBJ31978.1|  putative: flagellar outer dynein arm light chain 6     134   7e-37   Ectocarpus siliculosus
gb|ACO51730.1|  Dynein light chain 1, cytoplasmic                       134   8e-37   Rana catesbeiana [bullfrog]
gb|ACB47095.1|  SJCHGC01950 protein                                     134   8e-37   Schistosoma japonicum
emb|CDJ49414.1|  dynein light chain, putative                           134   8e-37   Eimeria brunetti
ref|XP_008003135.1|  PREDICTED: dynein light chain 1, cytoplasmic       134   9e-37   Chlorocebus sabaeus
ref|XP_010815505.1|  PREDICTED: dynein light chain 1, cytoplasmic       134   1e-36   
ref|XP_006899621.1|  PREDICTED: dynein light chain 1, cytoplasmic...    134   1e-36   
gb|KIJ65154.1|  hypothetical protein HYDPIDRAFT_111049                  134   1e-36   
ref|NP_001165166.1|  dynein, light chain, LC8-type 1                    134   1e-36   
ref|XP_010857222.1|  PREDICTED: dynein light chain 1, cytoplasmic...    134   1e-36   
ref|XP_007035633.1|  Dynein light chain type 1 family protein           137   1e-36   
gb|ACO08570.1|  Dynein light chain 1, cytoplasmic                       134   1e-36   
ref|XP_002370087.1|  dynein light chain, putative                       135   1e-36   
tpg|DAA13145.1|  TPA: dynein light chain 1-like                         134   1e-36   
ref|XP_008711568.1|  dynein light chain, cytoplasmic                    134   1e-36   
emb|CCD76584.1|  unnamed protein product                                134   1e-36   
gb|KJA23604.1|  hypothetical protein HYPSUDRAFT_39788                   134   1e-36   
dbj|BAB28973.1|  unnamed protein product                                134   1e-36   
gb|ETE59340.1|  Dynein light chain 1, cytoplasmic                       134   1e-36   
gb|ESS30008.1|  dynein light chain DLC                                  135   1e-36   
ref|XP_008141004.1|  PREDICTED: dynein light chain 1, cytoplasmic       134   1e-36   
ref|XP_004629419.1|  PREDICTED: dynein light chain 1, cytoplasmic...    134   1e-36   
ref|XP_001636645.1|  predicted protein                                  134   1e-36   
gb|AAM12035.1|  cytoplasmic dynein light chain 2                        134   1e-36   
ref|XP_828164.1|  dynein light chain                                    134   1e-36   
ref|XP_003880162.1|  putative dynein light chain                        134   2e-36   
gb|KFV57107.1|  Dynein light chain 2, cytoplasmic                       134   2e-36   
emb|CCC52569.1|  putative dynein light chain                            133   2e-36   
ref|XP_797323.1|  PREDICTED: dynein light chain LC6, flagellar ou...    133   2e-36   
ref|XP_001415389.1|  predicted protein                                  133   2e-36   
gb|ACO09652.1|  Dynein light chain 2, cytoplasmic                       133   2e-36   
gb|EPT01300.1|  hypothetical protein FOMPIDRAFT_1023375                 134   2e-36   
pdb|1PWK|A  Chain A, Structure Of The Monomeric 8-Kda Dynein Ligh...    133   2e-36   
ref|XP_007197765.1|  PREDICTED: dynein light chain 1, cytoplasmic...    133   2e-36   
ref|XP_002071078.1|  GK25335                                            138   2e-36   
gb|KGB37564.1|  Dynein light chain 2, cytoplasmic                       135   3e-36   
ref|XP_007872972.1|  hypothetical protein PNEG_01060                    133   3e-36   
ref|XP_008038229.1|  hypothetical protein TRAVEDRAFT_29343              133   3e-36   
ref|XP_786984.1|  PREDICTED: dynein light chain 1, cytoplasmic-like     133   3e-36   
gb|EUB55663.1|  Dynein light chain 2, cytoplasmic                       133   3e-36   
ref|XP_821602.1|  dynein light chain                                    132   3e-36   
ref|XP_005095138.1|  PREDICTED: dynein light chain 2, cytoplasmic...    132   3e-36   
ref|NP_001085625.1|  dynein, light chain, LC8-type 1                    132   4e-36   
ref|XP_002159448.1|  PREDICTED: dynein light chain 2, cytoplasmic...    132   4e-36   
gb|EUB62826.1|  Dynein light chain LC6, flagellar outer arm             132   4e-36   
ref|XP_006891098.1|  PREDICTED: dynein light chain 1, cytoplasmic...    132   4e-36   
ref|XP_009059708.1|  hypothetical protein LOTGIDRAFT_206820             132   4e-36   
ref|XP_009059709.1|  hypothetical protein LOTGIDRAFT_218759             132   5e-36   
gb|ETO04512.1|  outer dynein arm light chain 8                          138   5e-36   
gb|AAL30831.2|  cytoplasmic light-chain dynein                          132   5e-36   
ref|XP_007123406.1|  PREDICTED: dynein light chain 1, cytoplasmic...    132   6e-36   
ref|XP_001438949.1|  hypothetical protein                               132   6e-36   
ref|XP_005355413.1|  PREDICTED: dynein light chain 1, cytoplasmic...    132   6e-36   
ref|XP_005869356.1|  PREDICTED: dynein light chain 1, cytoplasmic...    132   6e-36   
gb|ACO08201.1|  Dynein light chain 1, cytoplasmic                       132   6e-36   
gb|AAW26821.1|  SJCHGC01741 protein                                     132   6e-36   
emb|CDS16713.1|  dynein light chain                                     135   7e-36   
ref|XP_007845840.1|  dynein light chain cytoplasmic                     132   7e-36   
ref|XP_006872322.1|  PREDICTED: dynein light chain 1, cytoplasmic...    132   7e-36   
ref|XP_009163851.1|  hypothetical protein T265_12809                    132   8e-36   
emb|CAG08572.1|  unnamed protein product                                132   8e-36   
ref|NP_001001185.1|  dynein light chain LC8-type 1-like                 132   8e-36   
ref|XP_009176903.1|  hypothetical protein T265_11849                    132   9e-36   
ref|XP_001831377.2|  outer dynein arm light chain 8                     132   9e-36   
gb|EUB55662.1|  Dynein light chain 2, cytoplasmic                       132   9e-36   
ref|XP_004386424.1|  PREDICTED: dynein light chain 1, cytoplasmic...    133   9e-36   
gb|KIK09019.1|  hypothetical protein K443DRAFT_672058                   132   1e-35   
ref|XP_007401513.1|  hypothetical protein PHACADRAFT_264942             132   1e-35   
ref|XP_009059707.1|  hypothetical protein LOTGIDRAFT_234245             131   1e-35   
ref|XP_009307586.1|  dynein light chain                                 131   1e-35   
ref|XP_002750995.1|  PREDICTED: dynein light chain 1, cytoplasmic...    131   1e-35   
gb|KIM83111.1|  hypothetical protein PILCRDRAFT_819872                  132   1e-35   
gb|KDP27819.1|  hypothetical protein JCGZ_18899                         132   1e-35   
gb|AFU49024.1|  dynein light chain                                      131   1e-35   
emb|CDJ04451.1|  dynein light chain                                     134   1e-35   
ref|XP_007840040.1|  Dynein light chain                                 131   1e-35   
gb|AAF64249.1|AF153718_1  dynein light chain 1 protein DLC-1            130   1e-35   
gb|ACH44844.1|  putative dynein cytoplasmic light peptide transcr...    131   1e-35   
dbj|GAA48636.1|  dynein light chain LC8-type                            131   1e-35   
emb|CDS29171.1|  dynein light chain                                     131   2e-35   
ref|XP_007411202.1|  hypothetical protein MELLADRAFT_52764              131   2e-35   
ref|XP_006900368.1|  PREDICTED: dynein light chain 1, cytoplasmic...    131   2e-35   
gb|EWM26799.1|  dynein light chain cytoplasmic                          136   2e-35   
ref|XP_004030612.1|  hypothetical protein IMG5_157030                   130   2e-35   
ref|XP_002729448.1|  PREDICTED: dynein light chain 1, cytoplasmic...    130   2e-35   
emb|CAX76255.1|  adenosinetriphosphatase                                130   2e-35   
gb|KIK60431.1|  hypothetical protein GYMLUDRAFT_607612                  131   2e-35   
ref|XP_009549592.1|  hypothetical protein HETIRDRAFT_411046             131   2e-35   
ref|XP_006072000.1|  PREDICTED: dynein light chain 1, cytoplasmic...    130   3e-35   
ref|XP_006679349.1|  cytoplasmic dynein light chain 2                   130   3e-35   
ref|XP_004039635.1|  hypothetical protein IMG5_016220                   130   3e-35   
gb|ABF38950.1|  dynein light chain 8                                    130   3e-35   
gb|KIL69477.1|  hypothetical protein M378DRAFT_788373                   130   3e-35   
gb|EUB55661.1|  Dynein light chain 2, cytoplasmic                       130   3e-35   
gb|KJB72714.1|  hypothetical protein B456_011G192000                    130   4e-35   
ref|XP_004364662.1|  cytoplasmic dynein light chain                     130   4e-35   
gb|ACC64544.1|  dynein light chain 1 (predicted)                        130   5e-35   
ref|XP_002184123.1|  predicted protein                                  129   5e-35   
ref|XP_003888554.1|  dynein light chain LC8-type                        132   5e-35   
ref|XP_006894504.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   6e-35   
ref|XP_797291.1|  PREDICTED: dynein light chain LC6, flagellar ou...    129   6e-35   
ref|XP_009059350.1|  hypothetical protein LOTGIDRAFT_218332             129   6e-35   
emb|CDS29000.1|  dynein light chain                                     129   6e-35   
ref|XP_006892473.1|  PREDICTED: dynein light chain 1, cytoplasmic...    130   7e-35   
emb|CAX76256.1|  adenosinetriphosphatase                                129   7e-35   
emb|CDS05039.1|  Putative Dynein light chain 1, cytoplasmic             129   7e-35   
ref|XP_006863077.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   8e-35   
ref|XP_005699538.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   8e-35   
emb|CBY19036.1|  unnamed protein product                                129   8e-35   
gb|EOA96262.1|  Dynein light chain 1, cytoplasmic                       129   8e-35   
ref|XP_007916682.1|  putative dynein light chain protein                129   9e-35   
ref|XP_005700219.1|  PREDICTED: dynein light chain 1, cytoplasmic...    131   9e-35   
ref|XP_002748441.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   9e-35   
ref|XP_006745376.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   9e-35   
emb|CAX76253.1|  adenosinetriphosphatase                                129   9e-35   
emb|CDJ04450.1|  dynein light chain                                     129   1e-34   
gb|EPY40624.1|  dynein light chain LC8-type                             129   1e-34   
emb|CDH51523.1|  dynein light chain cytoplasmic                         129   1e-34   
ref|XP_007747076.1|  dynein light chain, cytoplasmic                    129   1e-34   
emb|CAX76254.1|  adenosinetriphosphatase                                129   1e-34   
emb|CDS16712.1|  dynein light chain                                     129   1e-34   
emb|CAF31460.1|  dynein light chain                                     129   1e-34   
ref|XP_004022801.1|  PREDICTED: dynein light chain 1, cytoplasmic...    129   1e-34   
gb|EUB55664.1|  Dynein light chain 2, cytoplasmic                       129   1e-34   
ref|XP_007291288.1|  dynein light chain type 1                          129   1e-34   
ref|XP_011392984.1|  dynein light chain type 1, variant                 129   2e-34   
emb|CDS04959.1|  Putative Dynein light chain 1, cytoplasmic             128   2e-34   
gb|KIK20800.1|  hypothetical protein PISMIDRAFT_681994                  129   2e-34   
gb|KIK49156.1|  hypothetical protein CY34DRAFT_797549                   129   2e-34   
ref|XP_007517930.1|  PREDICTED: dynein light chain 1, cytoplasmic...    128   2e-34   
ref|XP_009856673.1|  hypothetical protein NEUTE1DRAFT_96970             129   2e-34   
ref|XP_002745111.2|  PREDICTED: dynein light chain 1, cytoplasmic...    128   2e-34   
ref|XP_006889245.1|  PREDICTED: dynein light chain 1, cytoplasmic...    128   2e-34   
emb|CDJ04505.1|  dynein light chain                                     128   2e-34   
gb|EPB86054.1|  dynein light chain 1, cytoplasmic                       128   2e-34   
ref|XP_001744877.1|  hypothetical protein                               128   2e-34   
ref|XP_002516948.1|  cytoplasmic dynein light chain, putative           129   2e-34   
ref|XP_009158220.1|  dynein light chain, cytoplasmic                    128   2e-34   
gb|KIK94997.1|  hypothetical protein PAXRUDRAFT_827440                  128   3e-34   
gb|KEQ98524.1|  hypothetical protein AUEXF2481DRAFT_2462                128   3e-34   
sp|Q94748.1|DYL2_SCHMA  RecName: Full=Probable dynein light chain...    128   3e-34   
ref|XP_006867575.1|  PREDICTED: dynein light chain 1, cytoplasmic...    128   3e-34   
gb|EUB58946.1|  Dynein light chain LC6, flagellar outer arm             128   3e-34   
gb|KIP04693.1|  hypothetical protein PHLGIDRAFT_109219                  128   3e-34   
emb|CAX74848.1|  Dynein light chain 2, cytoplasmic                      127   3e-34   
gb|EPS27990.1|  hypothetical protein PDE_02935                          127   3e-34   
ref|XP_005843957.1|  hypothetical protein CHLNCDRAFT_27579              127   3e-34   
ref|XP_003346215.1|  hypothetical protein SMAC_05752                    128   3e-34   
ref|XP_005539345.1|  dynein light chain                                 127   4e-34   
ref|XP_005644547.1|  dynein 8 kDa light chain, flagellar outer arm      127   4e-34   
gb|KFP25303.1|  Dynein light chain 1, cytoplasmic                       127   4e-34   
dbj|GAA48635.1|  dynein light chain LC8-type                            127   4e-34   
emb|CDS25732.1|  dynein light chain                                     127   5e-34   
ref|XP_007719333.1|  dynein light chain, cytoplasmic                    127   5e-34   
gb|AAX30103.1|  dynein light chain 2                                    127   6e-34   
ref|XP_003658622.1|  hypothetical protein MYCTH_62074                   127   6e-34   
gb|KIX07370.1|  dynein light chain, cytoplasmic                         127   6e-34   
gb|AAD41626.1|AF072327_1  dynein light chain 1                          127   6e-34   
gb|EFQ25539.1|  dynein light chain type 1                               127   7e-34   
ref|XP_001211805.1|  dynein light chain                                 127   7e-34   
emb|CCF35635.1|  dynein light chain                                     127   7e-34   
gb|KIH57242.1|  dynein light chain type 1                               127   7e-34   
ref|XP_003726639.1|  PREDICTED: dynein light chain 2, cytoplasmic...    127   8e-34   
gb|KIV81598.1|  dynein light chain, cytoplasmic                         127   8e-34   
ref|XP_009401625.1|  PREDICTED: dynein light chain 1, cytoplasmic...    127   8e-34   
gb|ABF46663.1|  neuronal nitric oxide synthase protein inhibitor        127   8e-34   
gb|AAX31134.1|  T-cell-stimulating antigen                              126   8e-34   
ref|XP_007731487.1|  dynein light chain, cytoplasmic                    127   8e-34   
gb|KIW34647.1|  dynein light chain, cytoplasmic                         127   8e-34   
gb|KFY19084.1|  hypothetical protein V491_04595                         126   8e-34   
gb|AAP73467.1|  neuronal nitric oxidse synthase protein inhibitor       126   8e-34   
gb|KEQ87041.1|  hypothetical protein M438DRAFT_353097                   127   9e-34   
pir||B71425  hypothetical protein - Arabidopsis thaliana                125   9e-34
ref|XP_006966630.1|  dynein light chain                                 127   9e-34   
gb|KIY02074.1|  dynein light chain, cytoplasmic                         126   1e-33   
gb|EHK40404.1|  hypothetical protein TRIATDRAFT_260089                  127   1e-33   
emb|CAX70490.1|  Dynein light chain                                     126   1e-33   
gb|KFX98772.1|  hypothetical protein V490_02129                         126   1e-33   
ref|XP_007788907.1|  putative dynein light chain protein                126   1e-33   
ref|XP_001350541.1|  dynein light chain 1, putative                     126   1e-33   
gb|ELR06538.1|  hypothetical protein GMDG_02172                         126   1e-33   
ref|XP_002753852.1|  PREDICTED: dynein light chain 1, cytoplasmic...    126   1e-33   
emb|CDJ04449.1|  dynein light chain                                     126   1e-33   
emb|CDI77240.1|  hypothetical protein, conserved                        136   1e-33   
ref|XP_677692.1|  dynein light chain 1                                  126   1e-33   
gb|KEQ60218.1|  hypothetical protein M437DRAFT_55114                    126   1e-33   
emb|CAX76214.1|  putative dynein light chain                            126   1e-33   
ref|XP_009176902.1|  hypothetical protein T265_15569                    126   1e-33   
ref|XP_006167077.1|  PREDICTED: dynein light chain 1, cytoplasmic...    126   1e-33   
gb|KFY75110.1|  hypothetical protein V499_04920                         129   1e-33   
ref|XP_002374474.1|  dynein light chain type 1, putative                126   1e-33   
sp|O94111.1|DYL1_EMENI  RecName: Full=Dynein light chain, cytopla...    126   1e-33   
ref|XP_004648072.1|  PREDICTED: dynein light chain 1, cytoplasmic...    126   1e-33   
gb|EIE76293.1|  dynein light chain 1, cytoplasmic                       125   2e-33   
gb|KIM62472.1|  hypothetical protein SCLCIDRAFT_1215048                 126   2e-33   
gb|EHK25271.1|  hypothetical protein TRIVIDRAFT_110796                  126   2e-33   
gb|EYB96650.1|  hypothetical protein Y032_0148g2649                     126   2e-33   
emb|CAX74847.1|  Dynein light chain 2, cytoplasmic                      125   2e-33   
gb|KHJ95652.1|  dynein light chain type 1                               127   2e-33   
gb|KEP54843.1|  dynein light chain 1, cytoplasmic protein               126   2e-33   
emb|CDS16711.1|  dynein light chain                                     125   2e-33   
emb|CAX70486.1|  Dynein light chain                                     125   2e-33   
ref|XP_006380160.1|  hypothetical protein POPTR_0008s22460g             127   2e-33   
ref|XP_007687688.1|  hypothetical protein COCMIDRAFT_94569              125   2e-33   
gb|EUB55665.1|  Dynein light chain 2, cytoplasmic                       125   2e-33   
gb|EPX73869.1|  dynein light chain Dlc2                                 126   2e-33   
gb|EST48224.1|  Dynein light chain                                      125   2e-33   
ref|XP_010198289.1|  PREDICTED: dynein light chain 1, cytoplasmic...    125   2e-33   
emb|CEG78202.1|  Putative Dynein light chain 1, cytoplasmic             125   2e-33   
ref|XP_007754897.1|  dynein light chain, cytoplasmic                    125   2e-33   
ref|XP_007599974.1|  dynein light chain                                 125   2e-33   
ref|XP_006082431.1|  PREDICTED: dynein light chain 1, cytoplasmic...    125   2e-33   
ref|XP_005077031.1|  PREDICTED: dynein light chain 1, cytoplasmic...    125   2e-33   
gb|EXV01976.1|  dynein light chain type 1                               125   3e-33   
emb|CDH51630.1|  dynein light chain cytoplasmic                         129   3e-33   
ref|XP_003280331.1|  PREDICTED: dynein light chain 1, cytoplasmic       125   3e-33   
ref|XP_007276777.1|  dynein light chain type                            125   3e-33   
ref|XP_008593623.1|  dynein light chain type 1                          125   3e-33   
gb|KEY65099.1|  hypothetical protein S7711_04190                        125   3e-33   
dbj|GAA55582.1|  probable dynein light chain                            128   3e-33   
sp|Q94758.1|DYL1_SCHMA  RecName: Full=Dynein light chain                125   3e-33   
gb|EYE94523.1|  putative dynein light chain type 1                      125   3e-33   
emb|CDS29006.1|  dnl2 protein                                           125   3e-33   
ref|XP_002415330.1|  dynein light chain, putative                       125   3e-33   
gb|KFY52177.1|  hypothetical protein V496_08637                         127   3e-33   
gb|EUC55701.1|  dynein light chain 1, cytoplasmic protein               125   3e-33   
ref|XP_011126992.1|  hypothetical protein AOL_s00193g79                 125   3e-33   



>emb|CDO98845.1| unnamed protein product [Coffea canephora]
Length=124

 Score =   195 bits (495),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 101/125 (81%), Positives = 109/125 (87%), Gaps = 4/125 (3%)
 Frame = +3

Query  105  MSEDSKRNDGGAL--VAKLPAADDRKSASPPA-SSITVSKKVIIKSADMKDDMQKEAVDI  275
            MSE++KR  GGA   VAK   +DDRKS S  A +S  V KKVIIKSADMK+DMQKEAVDI
Sbjct  1    MSEEAKRMVGGAAPAVAK-SLSDDRKSTSGSAPTSSAVGKKVIIKSADMKEDMQKEAVDI  59

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFEKN VEKDVAEHIKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLDSKAVL
Sbjct  60   AIAAFEKNGVEKDVAEHIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDSKAVL  119

Query  456  LFKSG  470
            LFKSG
Sbjct  120  LFKSG  124



>gb|KJB28660.1| hypothetical protein B456_005G061200 [Gossypium raimondii]
Length=124

 Score =   194 bits (494),  Expect = 6e-60, Method: Compositional matrix adjust.
 Identities = 97/125 (78%), Positives = 108/125 (86%), Gaps = 7/125 (6%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPA----SSITVSKKVIIKSADMKDDMQKEAVDI  275
            SE++KR+  GAL  K PA D+RK A  PA    S+   +KKV+IKSADMKDDMQKEAV+I
Sbjct  3    SEEAKRSISGALTVK-PATDERKPA--PALTAESTTLAAKKVVIKSADMKDDMQKEAVNI  59

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFEKNNVEKDVAEHIKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVL
Sbjct  60   AIAAFEKNNVEKDVAEHIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVL  119

Query  456  LFKSG  470
            LFKSG
Sbjct  120  LFKSG  124



>gb|KHG14753.1| Dynein light chain 1, cytoplasmic [Gossypium arboreum]
Length=124

 Score =   194 bits (493),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 95/123 (77%), Positives = 107/123 (87%), Gaps = 3/123 (2%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPA--SSITVSKKVIIKSADMKDDMQKEAVDIAI  281
            SE++KR+  GAL  K PA D+RK +   A  S+   +KKV+IKSADMKDDMQKEAV+IAI
Sbjct  3    SEEAKRSISGALTVK-PATDERKPSPALAAESTTLAAKKVVIKSADMKDDMQKEAVNIAI  61

Query  282  SAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLF  461
            +AFEKNNVEKDVAEHIKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLF
Sbjct  62   AAFEKNNVEKDVAEHIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLF  121

Query  462  KSG  470
            KSG
Sbjct  122  KSG  124



>ref|XP_011090994.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Sesamum 
indicum]
Length=119

 Score =   194 bits (492),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 98/123 (80%), Positives = 108/123 (88%), Gaps = 5/123 (4%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKL-PAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAI  281
            MSEDSKR  GGALV  L  +ADDRKS+S  + +    KKVIIKSADMK+DMQKEAVD+A+
Sbjct  1    MSEDSKRGSGGALVPPLISSADDRKSSSGSSPA----KKVIIKSADMKEDMQKEAVDVAV  56

Query  282  SAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLF  461
            +AFE +NVEKDVAEHIKK FDKK+GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLF
Sbjct  57   AAFEMHNVEKDVAEHIKKMFDKKYGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLF  116

Query  462  KSG  470
            KSG
Sbjct  117  KSG  119



>ref|XP_008390638.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Malus domestica]
Length=119

 Score =   189 bits (480),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 7/124 (6%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITV--SKKVIIKSADMKDDMQKEAVDIA  278
            MSED+KR+  GAL AK P +DDRK    P+S++T    K+VIIKSADM  DMQKEAVDIA
Sbjct  1    MSEDAKRSVAGALSAK-PXSDDRK----PSSAVTTPAGKRVIIKSADMFQDMQKEAVDIA  55

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            I AFEK++VEKDVAE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLL
Sbjct  56   IGAFEKHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLL  115

Query  459  FKSG  470
            FKSG
Sbjct  116  FKSG  119



>ref|XP_009352292.1| PREDICTED: dynein light chain 2, cytoplasmic [Pyrus x bretschneideri]
Length=119

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 7/124 (6%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITV--SKKVIIKSADMKDDMQKEAVDIA  278
            MSED+KR+  GAL AK P +DDRK    P+S++T    K+VIIKSADM  DMQKEAVDIA
Sbjct  1    MSEDAKRSVAGALSAK-PNSDDRK----PSSAVTTPAGKRVIIKSADMFQDMQKEAVDIA  55

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            I AFEK++VEKDVAE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLL
Sbjct  56   IGAFEKHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLL  115

Query  459  FKSG  470
            FKSG
Sbjct  116  FKSG  119



>ref|XP_008340792.1| PREDICTED: dynein light chain 2, cytoplasmic [Malus domestica]
 ref|XP_008353220.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Malus domestica]
Length=119

 Score =   189 bits (479),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 96/124 (77%), Positives = 107/124 (86%), Gaps = 7/124 (6%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITV--SKKVIIKSADMKDDMQKEAVDIA  278
            MSED+KR+  GAL AK P +DDRK    P+S++T    K+VIIKSADM  DMQKEAVDIA
Sbjct  1    MSEDAKRSVAGALSAK-PNSDDRK----PSSAVTTPTGKRVIIKSADMFQDMQKEAVDIA  55

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            I AFEK++VEKDVAE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLL
Sbjct  56   IGAFEKHSVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLL  115

Query  459  FKSG  470
            FKSG
Sbjct  116  FKSG  119



>ref|XP_007223479.1| hypothetical protein PRUPE_ppa013502mg [Prunus persica]
 ref|XP_008223216.1| PREDICTED: dynein light chain 2, cytoplasmic [Prunus mume]
 gb|EMJ24678.1| hypothetical protein PRUPE_ppa013502mg [Prunus persica]
Length=119

 Score =   188 bits (478),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSED+KR+  GAL AK P +DDRK +  PA +    K+VIIKSADM  DMQKEAVDIAI 
Sbjct  1    MSEDAKRSVPGALSAK-PNSDDRKPS--PAVTTATGKRVIIKSADMFQDMQKEAVDIAIG  57

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK++VEKDVAE+IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  58   AFEKHSVEKDVAEYIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  117

Query  465  SG  470
            SG
Sbjct  118  SG  119



>ref|XP_003546364.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Glycine max]
 gb|KHN20774.1| Dynein light chain 2, cytoplasmic [Glycine soja]
Length=122

 Score =   187 bits (476),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 93/123 (76%), Positives = 105/123 (85%), Gaps = 2/123 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVS-KKVIIKSADMKDDMQKEAVDIAI  281
            MSED+K+N  GAL A+ P +DD+K +  P+ +  V  KKVIIKSADM  DMQKEAVDIA+
Sbjct  1    MSEDAKKNIAGALTAR-PNSDDQKLSPLPSPAPAVPPKKVIIKSADMIPDMQKEAVDIAV  59

Query  282  SAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLF  461
            +AFEK NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLF
Sbjct  60   AAFEKYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLF  119

Query  462  KSG  470
            KSG
Sbjct  120  KSG  122



>ref|XP_003533298.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Glycine max]
Length=157

 Score =   187 bits (474),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 97/137 (71%), Positives = 111/137 (81%), Gaps = 3/137 (2%)
 Frame = +3

Query  66   LCSHKSQ-SPTKTNMSEDSKRNDGGALVAKLPAADDRKSASPPASSITVS-KKVIIKSAD  239
            L  H+S    T+  MSED+K+N  GAL A+ P +DD+K +  P+ +  V  KKVIIKSAD
Sbjct  22   LTHHQSSFRETERKMSEDAKKNIAGALTAR-PNSDDQKPSPLPSPAPAVPPKKVIIKSAD  80

Query  240  MKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNH  419
            M  DMQKEAVDIA++AFEK NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNH
Sbjct  81   MIPDMQKEAVDIAVAAFEKYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNH  140

Query  420  FVYFYLDSKAVLLFKSG  470
            FVYFYLD KAVLLFKSG
Sbjct  141  FVYFYLDQKAVLLFKSG  157



>gb|KJB72713.1| hypothetical protein B456_011G192000 [Gossypium raimondii]
Length=120

 Score =   186 bits (471),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 103/122 (84%), Gaps = 5/122 (4%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPASSITVS-KKVIIKSADMKDDMQKEAVDIAIS  284
            +E +KR+  GAL  K    D+ K    P+ ++T   KKVIIKSADMKD+MQKEAV+IAIS
Sbjct  3    TEATKRSTTGALTVKQRKTDELK----PSPALTAEPKKVIIKSADMKDEMQKEAVNIAIS  58

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEKNNVEKDVAE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  59   AFEKNNVEKDVAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  118

Query  465  SG  470
            SG
Sbjct  119  SG  120



>gb|AFY26900.1| dynein light chain [Morella rubra]
Length=125

 Score =   185 bits (469),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 89/125 (71%), Positives = 104/125 (83%), Gaps = 3/125 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRK---SASPPASSITVSKKVIIKSADMKDDMQKEAVDI  275
            MSED+KR   G L+ K P++DDRK   +A P  ++    K+VIIKSADM  DMQKEA+D 
Sbjct  1    MSEDAKRAIQGGLMVKPPSSDDRKPSAAAGPRPATPPSGKRVIIKSADMLPDMQKEAIDT  60

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFEK++VEKDVAEHIKKEFD++HG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVL
Sbjct  61   AIAAFEKHSVEKDVAEHIKKEFDQRHGSTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVL  120

Query  456  LFKSG  470
            LFKSG
Sbjct  121  LFKSG  125



>ref|XP_006419530.1| hypothetical protein CICLE_v10007063mg [Citrus clementina]
 ref|XP_006489049.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Citrus sinensis]
 gb|ESR32770.1| hypothetical protein CICLE_v10007063mg [Citrus clementina]
Length=118

 Score =   184 bits (468),  Expect = 5e-56, Method: Compositional matrix adjust.
 Identities = 91/122 (75%), Positives = 104/122 (85%), Gaps = 4/122 (3%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE++K++  GALV K P +DDRK   P  +     K++IIKSADMK+D+QKEAVDIAI+
Sbjct  1    MSEETKKSVTGALVVK-PNSDDRK---PTVAVSQSGKRIIIKSADMKEDLQKEAVDIAIA  56

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEKN+VEKDVAE IKK+FDKKHGPTWHCIVG NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  57   AFEKNSVEKDVAERIKKDFDKKHGPTWHCIVGSNFGSYVTHETNHFVYFYLDQKAVLLFK  116

Query  465  SG  470
            SG
Sbjct  117  SG  118



>ref|NP_001238295.1| uncharacterized protein LOC100527842 [Glycine max]
 gb|ACU17034.1| unknown [Glycine max]
 gb|KHN20775.1| Dynein light chain 2, cytoplasmic [Glycine soja]
Length=118

 Score =   184 bits (467),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 92/122 (75%), Positives = 105/122 (86%), Gaps = 4/122 (3%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE++K+N  GAL A+ P +DD+K A  PA ++   KKVIIKSADM  DMQKEAVDIA++
Sbjct  1    MSEEAKKNFVGALTAR-PTSDDQKQA--PALNVP-PKKVIIKSADMIPDMQKEAVDIAVA  56

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFE+ NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  57   AFERYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  116

Query  465  SG  470
            SG
Sbjct  117  SG  118



>ref|XP_011007828.1| PREDICTED: dynein light chain 1, cytoplasmic [Populus euphratica]
 gb|ABK92971.1| unknown [Populus trichocarpa]
Length=120

 Score =   182 bits (463),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 90/121 (74%), Positives = 100/121 (83%), Gaps = 3/121 (2%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISA  287
            SED KR+  G +  +    D     S PA++    KK+IIK+ADMKDDMQKEAVDIAI+A
Sbjct  3    SEDMKRSITGGVKVE---NDSYYRKSSPAAAAPPGKKIIIKNADMKDDMQKEAVDIAIAA  59

Query  288  FEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            FE+NNVEKDVAEHIKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKS
Sbjct  60   FERNNVEKDVAEHIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKS  119

Query  468  G  470
            G
Sbjct  120  G  120



>ref|XP_006342815.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Solanum tuberosum]
Length=119

 Score =   182 bits (462),  Expect = 4e-55, Method: Compositional matrix adjust.
 Identities = 96/122 (79%), Positives = 105/122 (86%), Gaps = 3/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSED+KR+ GGA  AK P +DDR+ +S    S T   KV IKSADMK D+QKEAVDIAI+
Sbjct  1    MSEDAKRS-GGAPAAK-PTSDDRRISSGSVPSPT-GTKVTIKSADMKPDVQKEAVDIAIA  57

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK+NVEKDVAE IKKEFDKK+GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK
Sbjct  58   AFEKHNVEKDVAELIKKEFDKKYGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  117

Query  465  SG  470
            SG
Sbjct  118  SG  119



>gb|KHG22395.1| Dynein 8 kDa light chain, flagellar outer arm [Gossypium arboreum]
Length=121

 Score =   182 bits (461),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 89/121 (74%), Positives = 102/121 (84%), Gaps = 2/121 (2%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISA  287
            SE++KR+  GAL A  P  D  K +  P S+ +  KKVIIKSADMK++ QKEAV+IAISA
Sbjct  3    SEEAKRSINGALKAVKPKTDAPKLS--PESTTSPPKKVIIKSADMKEEQQKEAVNIAISA  60

Query  288  FEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            FE+NNVEKDVAE IKKEFDK+HGPTWHCI+G+NFGSYVTHETNHFVYFYLD KAVLLFKS
Sbjct  61   FEENNVEKDVAERIKKEFDKRHGPTWHCIIGRNFGSYVTHETNHFVYFYLDQKAVLLFKS  120

Query  468  G  470
            G
Sbjct  121  G  121



>ref|XP_002270438.1| PREDICTED: dynein light chain 1, cytoplasmic [Vitis vinifera]
 emb|CAN81003.1| hypothetical protein VITISV_006994 [Vitis vinifera]
Length=117

 Score =   180 bits (456),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 102/122 (84%), Gaps = 5/122 (4%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            M+ED KRN  GAL   L  + D +  S  AS+   SK+VIIKSADMKDDMQKEA+DIAI+
Sbjct  1    MAEDLKRN--GALALSLKQSSDDRKLSLAASA---SKRVIIKSADMKDDMQKEAIDIAIA  55

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            A E ++VEK++AE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  56   ASENHSVEKNIAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  115

Query  465  SG  470
            SG
Sbjct  116  SG  117



>ref|XP_010024718.1| PREDICTED: dynein light chain 1, cytoplasmic [Eucalyptus grandis]
Length=119

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 83/105 (79%), Positives = 93/105 (89%), Gaps = 3/105 (3%)
 Frame = +3

Query  156  PAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKK  335
            P  DDRK   P ++S    +K+++KSADMKDDMQKEAVDIAI+AFEK+ VEKDVAEHIKK
Sbjct  18   PGLDDRK---PSSASAAAGRKIVVKSADMKDDMQKEAVDIAIAAFEKHGVEKDVAEHIKK  74

Query  336  EFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            EFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KA+LLFKSG
Sbjct  75   EFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAILLFKSG  119



>ref|XP_004296858.1| PREDICTED: dynein light chain 1, cytoplasmic [Fragaria vesca 
subsp. vesca]
Length=120

 Score =   179 bits (455),  Expect = 4e-54, Method: Compositional matrix adjust.
 Identities = 87/122 (71%), Positives = 99/122 (81%), Gaps = 2/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MS+D+KR+     V   P  DDRK +  PA + +  K+VIIKSADM  DMQKEAV+IAI 
Sbjct  1    MSQDAKRSVVPGTVPTKPNPDDRKPS--PAVTTSTGKRVIIKSADMFQDMQKEAVEIAIG  58

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFE ++VEKDVAEHIKKEFD +HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  59   AFETHSVEKDVAEHIKKEFDSRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  118

Query  465  SG  470
            SG
Sbjct  119  SG  120



>ref|XP_004229253.1| PREDICTED: dynein light chain 2, cytoplasmic [Solanum lycopersicum]
Length=119

 Score =   179 bits (454),  Expect = 7e-54, Method: Compositional matrix adjust.
 Identities = 94/122 (77%), Positives = 104/122 (85%), Gaps = 3/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSED+K++ GGA   K P +DDR+ +S    S T   KV IKSADMK D+QKEAVDIAI+
Sbjct  1    MSEDAKKS-GGAPAVK-PTSDDRRISSGSVPSPT-GTKVTIKSADMKPDVQKEAVDIAIA  57

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK+NVEKDVAE IKKEFDKK+GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK
Sbjct  58   AFEKHNVEKDVAELIKKEFDKKYGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  117

Query  465  SG  470
            SG
Sbjct  118  SG  119



>gb|ABU98947.1| dynein light chain [Lupinus albus]
Length=121

 Score =   178 bits (452),  Expect = 1e-53, Method: Compositional matrix adjust.
 Identities = 88/124 (71%), Positives = 105/124 (85%), Gaps = 5/124 (4%)
 Frame = +3

Query  105  MSEDSKRNDGGA--LVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIA  278
            MSE +K+  GG   L++K P ++DR  ++ P++  T  KKVIIK+ADM  +MQKEAVDIA
Sbjct  1    MSEGTKKMSGGGVGLISK-PNSEDRNLSALPSAVAT--KKVIIKNADMLPEMQKEAVDIA  57

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            +S+FEK NVEK+VAEHIKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLL
Sbjct  58   VSSFEKYNVEKEVAEHIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLL  117

Query  459  FKSG  470
            FKSG
Sbjct  118  FKSG  121



>ref|XP_010551078.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Tarenaya hassleriana]
Length=131

 Score =   178 bits (452),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 92/132 (70%), Positives = 103/132 (78%), Gaps = 11/132 (8%)
 Frame = +3

Query  105  MSEDSKRND-GGALVAKLPAADDRKSASPPASSIT---------VSKKVIIKSADMKDDM  254
            MSE  ++ D  GA ++K   +DDR+S  PP  + T           KK +IKSADMKDDM
Sbjct  1    MSEGLRKKDLYGAPMSK-SLSDDRRSVPPPLETATNIISLNPSPPRKKAVIKSADMKDDM  59

Query  255  QKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFY  434
            QKEA+DIAISAFEK NVEKD+AEHIKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFY
Sbjct  60   QKEAIDIAISAFEKFNVEKDIAEHIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFY  119

Query  435  LDSKAVLLFKSG  470
            LD KAVLLFKSG
Sbjct  120  LDQKAVLLFKSG  131



>ref|XP_010259500.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Nelumbo nucifera]
Length=116

 Score =   177 bits (450),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 106/122 (87%), Gaps = 6/122 (5%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            M+++++R  G + V   P++D++KS  P AS+  V +KVI+KSADMK+DMQKEA+D A++
Sbjct  1    MTDEARR--GVSFVK--PSSDEKKS--PAASATGVVRKVIVKSADMKEDMQKEAIDSALA  54

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK+ VEKD+AEHIKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYFYLD KA+LLFK
Sbjct  55   AFEKHGVEKDIAEHIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAILLFK  114

Query  465  SG  470
            SG
Sbjct  115  SG  116



>ref|XP_009594796.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Nicotiana 
tomentosiformis]
Length=134

 Score =   178 bits (451),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 100/134 (75%), Positives = 109/134 (81%), Gaps = 12/134 (9%)
 Frame = +3

Query  105  MSEDSKRND--GGALVAKL---------PAADDRKSASPPASSITVSKK-VIIKSADMKD  248
            MSED+KRN    GA+V K           ++DDRKS+S  A+S TV KK VIIKSADMK 
Sbjct  1    MSEDTKRNGIGAGAVVVKSSSDDRKSLSASSDDRKSSSNSATSTTVGKKTVIIKSADMKP  60

Query  249  DMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVY  428
            D+Q EAVDIAI+AFEK NVEKDVAE IKKEFDKK+GPTWHCIVGKNFGSYVTHETNHFVY
Sbjct  61   DLQNEAVDIAIAAFEKCNVEKDVAEQIKKEFDKKYGPTWHCIVGKNFGSYVTHETNHFVY  120

Query  429  FYLDSKAVLLFKSG  470
            FYLDSKAVLLFKSG
Sbjct  121  FYLDSKAVLLFKSG  134



>ref|XP_007138930.1| hypothetical protein PHAVU_009G249900g [Phaseolus vulgaris]
 gb|ESW10924.1| hypothetical protein PHAVU_009G249900g [Phaseolus vulgaris]
Length=118

 Score =   177 bits (449),  Expect = 3e-53, Method: Compositional matrix adjust.
 Identities = 89/122 (73%), Positives = 96/122 (79%), Gaps = 4/122 (3%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE+ K+N  G   A  P  DDRK    PA      KKVIIKSADM  +MQKEAVDIA++
Sbjct  1    MSEEVKKNIAGTPTAG-PNTDDRKPLPAPAVP---PKKVIIKSADMIPEMQKEAVDIAVA  56

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
             FEK NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  57   TFEKYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  116

Query  465  SG  470
            SG
Sbjct  117  SG  118



>ref|XP_007138929.1| hypothetical protein PHAVU_009G249800g [Phaseolus vulgaris]
 gb|ESW10923.1| hypothetical protein PHAVU_009G249800g [Phaseolus vulgaris]
Length=120

 Score =   177 bits (448),  Expect = 5e-53, Method: Compositional matrix adjust.
 Identities = 88/122 (72%), Positives = 98/122 (80%), Gaps = 2/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE++K+   G L A+ P  DDRK      +     KKVIIKSADM  DMQKEAVDIA++
Sbjct  1    MSEEAKKGIAGPLTAR-PNTDDRKPLPL-PAPAVPPKKVIIKSADMIPDMQKEAVDIAVA  58

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK NVEKDVAE +KKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  59   AFEKYNVEKDVAEQVKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  118

Query  465  SG  470
            SG
Sbjct  119  SG  120



>ref|XP_004134221.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus]
 ref|XP_004164708.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus]
 gb|KGN57126.1| hypothetical protein Csa_3G159460 [Cucumis sativus]
Length=120

 Score =   176 bits (447),  Expect = 7e-53, Method: Compositional matrix adjust.
 Identities = 85/124 (69%), Positives = 101/124 (81%), Gaps = 6/124 (5%)
 Frame = +3

Query  105  MSEDSKR--NDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIA  278
            M++DS+R  N     + KL + DDRK +SP      +SKK++IKSADM  DMQKEA+D A
Sbjct  1    MNQDSRRPTNHPPPPIVKLESTDDRKPSSP----APLSKKIVIKSADMFTDMQKEAIDTA  56

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            I+AFEK++VEKD+AE IKKEFDK HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KA+LL
Sbjct  57   IAAFEKHSVEKDIAEQIKKEFDKNHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAILL  116

Query  459  FKSG  470
            FKSG
Sbjct  117  FKSG  120



>gb|EYU43969.1| hypothetical protein MIMGU_mgv1a016455mg [Erythranthe guttata]
Length=121

 Score =   176 bits (446),  Expect = 1e-52, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 101/122 (83%), Gaps = 1/122 (1%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MS DSKRN GG+ VA  P           +S  +  KKVIIKSADMK+D+QKEA++IA++
Sbjct  1    MSADSKRNGGGSAVAPPPLMSSSDDRKS-SSGSSPGKKVIIKSADMKEDVQKEAIEIAVA  59

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEKNNVEKDVAEHIKK FD+K+GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK
Sbjct  60   AFEKNNVEKDVAEHIKKMFDQKYGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  119

Query  465  SG  470
            SG
Sbjct  120  SG  121



>ref|XP_009618976.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Nicotiana tomentosiformis]
 ref|XP_009776864.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Nicotiana sylvestris]
Length=119

 Score =   175 bits (443),  Expect = 3e-52, Method: Compositional matrix adjust.
 Identities = 97/122 (80%), Positives = 106/122 (87%), Gaps = 3/122 (2%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSED+KR  GGA VAK P +DDR+S+S    S  + KK+ IKSADMK D+QKEAVDIAI+
Sbjct  1    MSEDAKRT-GGAPVAK-PTSDDRRSSSGSVPS-PIGKKITIKSADMKPDVQKEAVDIAIA  57

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK NVEKDVAE IKKEFDKK+GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK
Sbjct  58   AFEKYNVEKDVAEQIKKEFDKKYGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  117

Query  465  SG  470
            SG
Sbjct  118  SG  119



>ref|XP_003609697.1| Dynein light chain 1 cytoplasmic-like protein [Medicago truncatula]
 gb|AES91894.1| dynein light chain type 1 family protein [Medicago truncatula]
 gb|AFK47173.1| unknown [Medicago truncatula]
Length=130

 Score =   174 bits (442),  Expect = 5e-52, Method: Compositional matrix adjust.
 Identities = 88/130 (68%), Positives = 102/130 (78%), Gaps = 8/130 (6%)
 Frame = +3

Query  105  MSEDSKRNDGG---ALVAKLPAADDRKSASPPASS-----ITVSKKVIIKSADMKDDMQK  260
            MSE++K++  G   AL+AK    D +   + P S+        +KKVIIKSADM  DMQK
Sbjct  1    MSEEAKKHSAGGGAALMAKSLTEDRKPLVTSPLSASASPATPATKKVIIKSADMLPDMQK  60

Query  261  EAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLD  440
            EAVDIA+ AFE++NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD
Sbjct  61   EAVDIAVVAFERHNVEKDVAETIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLD  120

Query  441  SKAVLLFKSG  470
             KAVLLFKSG
Sbjct  121  QKAVLLFKSG  130



>ref|XP_008458417.1| PREDICTED: dynein light chain 1, cytoplasmic [Cucumis melo]
Length=117

 Score =   174 bits (440),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 86/122 (70%), Positives = 103/122 (84%), Gaps = 5/122 (4%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MS D+KR+  G L+ K   ++DRK   PPA + T  KK++IKSADM  D+QKEA+D+AI+
Sbjct  1    MSNDAKRSIQGNLMVK-SVSEDRK---PPAVTAT-GKKIVIKSADMFGDVQKEAIDVAIA  55

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK++VEKD+AE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  56   AFEKHSVEKDIAECIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  115

Query  465  SG  470
            SG
Sbjct  116  SG  117



>ref|XP_004150499.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus]
 ref|XP_004171034.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis sativus]
 gb|KGN47430.1| hypothetical protein Csa_6G319760 [Cucumis sativus]
Length=117

 Score =   173 bits (439),  Expect = 9e-52, Method: Compositional matrix adjust.
 Identities = 85/122 (70%), Positives = 103/122 (84%), Gaps = 5/122 (4%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MS D+KR+  G L+ K   ++DRK   PPA + T  KK++IKSADM  D+QK+A+D+AI+
Sbjct  1    MSNDAKRSIQGTLLVK-SVSEDRK---PPAVT-TTGKKIVIKSADMFGDVQKKAIDVAIA  55

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK++VEKD+AE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  56   AFEKHSVEKDIAECIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  115

Query  465  SG  470
            SG
Sbjct  116  SG  117



>emb|CDY57865.1| BnaC08g47800D [Brassica napus]
Length=122

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 81/114 (71%), Positives = 96/114 (84%), Gaps = 2/114 (2%)
 Frame = +3

Query  129  DGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVE  308
            +GGA     P  DDR+S+   +S     ++ +IKSADMK+DMQKEA+DIAI+AFEKN+VE
Sbjct  11   NGGAPAQTNP--DDRRSSVEASSQGAGKQRAVIKSADMKEDMQKEAIDIAITAFEKNSVE  68

Query  309  KDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K++AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  69   KEIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  122



>gb|KJB28661.1| hypothetical protein B456_005G061200 [Gossypium raimondii]
Length=103

 Score =   172 bits (436),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 86/121 (71%), Positives = 95/121 (79%), Gaps = 20/121 (17%)
 Frame = +3

Query  108  SEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISA  287
            SE++KR+  GAL  K PA D+R                   +ADMKDDMQKEAV+IAI+A
Sbjct  3    SEEAKRSISGALTVK-PATDER-------------------NADMKDDMQKEAVNIAIAA  42

Query  288  FEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            FEKNNVEKDVAEHIKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKS
Sbjct  43   FEKNNVEKDVAEHIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKS  102

Query  468  G  470
            G
Sbjct  103  G  103



>ref|XP_010524543.1| PREDICTED: dynein light chain LC6, flagellar outer arm [Tarenaya 
hassleriana]
Length=132

 Score =   173 bits (438),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 92/133 (69%), Positives = 105/133 (79%), Gaps = 12/133 (9%)
 Frame = +3

Query  105  MSED-SKRNDGGALVAKLPAADDRKSASPP----ASSITVS------KKVIIKSADMKDD  251
            MSE   K+   GA  AK   +DDR+SA PP    AS ++++      KK +IKSADMK+ 
Sbjct  1    MSEGLRKKGIYGATAAK-SISDDRRSAPPPLETAASLLSLNPASPPMKKAVIKSADMKEG  59

Query  252  MQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYF  431
            MQKEA+DIAISAFEK +VEKD+AEHIKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYF
Sbjct  60   MQKEAIDIAISAFEKFSVEKDIAEHIKKEFDKKHGVTWHCIVGRNFGSYVTHETNHFVYF  119

Query  432  YLDSKAVLLFKSG  470
            YLD KAVLLFKSG
Sbjct  120  YLDQKAVLLFKSG  132



>ref|XP_009136731.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Brassica rapa]
Length=121

 Score =   172 bits (437),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 85/125 (68%), Positives = 100/125 (80%), Gaps = 7/125 (6%)
 Frame = +3

Query  105  MSEDSKR---NDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDI  275
            MSE  ++   N GGA     P  DDR+S  P A +    K+ +IKSADMK+DMQKEA++I
Sbjct  1    MSEGRRKKSVNGGGAPTQTNP--DDRRSTLPEAEA--AGKRAVIKSADMKEDMQKEAIEI  56

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFEK +VEK++AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVL
Sbjct  57   AITAFEKYSVEKEIAENIKKEFDKVHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVL  116

Query  456  LFKSG  470
            LFKSG
Sbjct  117  LFKSG  121



>ref|XP_004508201.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Cicer arietinum]
Length=135

 Score =   172 bits (437),  Expect = 3e-51, Method: Compositional matrix adjust.
 Identities = 90/135 (67%), Positives = 103/135 (76%), Gaps = 13/135 (10%)
 Frame = +3

Query  105  MSEDSKRND-------GGALVAKLPAADDRKSASPPASSITVS------KKVIIKSADMK  245
            MSE++K+N+       GG+ +     ++DRK   P   S   S      KKVIIKSADM 
Sbjct  1    MSEEAKKNNNNHNHNIGGSPLMAKSLSEDRKPLVPSPLSAAASPAQLPPKKVIIKSADML  60

Query  246  DDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFV  425
             DMQKEAVDIA+SAFE++NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFV
Sbjct  61   PDMQKEAVDIAVSAFERHNVEKDVAETIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFV  120

Query  426  YFYLDSKAVLLFKSG  470
            YFYLD KAVLLFKSG
Sbjct  121  YFYLDQKAVLLFKSG  135



>gb|KFK33807.1| hypothetical protein AALP_AA5G062700 [Arabis alpina]
Length=125

 Score =   172 bits (436),  Expect = 4e-51, Method: Compositional matrix adjust.
 Identities = 85/117 (73%), Positives = 96/117 (82%), Gaps = 4/117 (3%)
 Frame = +3

Query  126  NDGGALVAKLPAADDRKSASPPA--SSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKN  299
            N GGA    +  +DDR+S  P    +S  V K+ +IKSADMKDDMQKEA+DIAISAFE  
Sbjct  11   NGGGAPAQTM--SDDRRSNLPEVEEASPPVGKRAVIKSADMKDDMQKEAIDIAISAFENY  68

Query  300  NVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            +VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  69   SVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  125



>ref|XP_006596992.1| PREDICTED: uncharacterized protein LOC100527842 isoform X1 [Glycine 
max]
Length=139

 Score =   172 bits (436),  Expect = 5e-51, Method: Compositional matrix adjust.
 Identities = 92/143 (64%), Positives = 105/143 (73%), Gaps = 25/143 (17%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE++K+N  GAL A+ P +DD+K A  PA ++   KKVIIKSADM  DMQKEAVDIA++
Sbjct  1    MSEEAKKNFVGALTAR-PTSDDQKQA--PALNVP-PKKVIIKSADMIPDMQKEAVDIAVA  56

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF---------------------GSYV  401
            AFE+ NVEKDVAE IKKEFDK+HGPTWHCIVG+NF                     GSYV
Sbjct  57   AFERYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFAQYSQLAPAQYYKVGCDVDIQGSYV  116

Query  402  THETNHFVYFYLDSKAVLLFKSG  470
            THETNHFVYFYLD KAVLLFKSG
Sbjct  117  THETNHFVYFYLDQKAVLLFKSG  139



>gb|KJB38567.1| hypothetical protein B456_006G261500 [Gossypium raimondii]
Length=107

 Score =   171 bits (433),  Expect = 7e-51, Method: Compositional matrix adjust.
 Identities = 83/109 (76%), Positives = 93/109 (85%), Gaps = 2/109 (2%)
 Frame = +3

Query  144  VAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAE  323
            +A  P  DD K +  P S+ +  KKVIIKSADMK++ QKEAV+IAISAFEKNNVEK VAE
Sbjct  1    MAMKPKTDDPKLS--PESTTSPPKKVIIKSADMKEEQQKEAVNIAISAFEKNNVEKYVAE  58

Query  324  HIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
             IKKEFDK+HGPTWHCI+G+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  59   RIKKEFDKRHGPTWHCIIGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  107



>ref|XP_002870199.1| At4g15930 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH46458.1| At4g15930 [Arabidopsis lyrata subsp. lyrata]
Length=123

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 98/120 (82%), Gaps = 13/120 (11%)
 Frame = +3

Query  129  DGGALVAKLPAADDRKS------ASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAF  290
            +GGA    +  +DDR+S      ASPPA      K+ +IKSADMKDDMQKEA+DIAISAF
Sbjct  11   NGGAPAQTI--SDDRRSSLPEVEASPPAG-----KRAVIKSADMKDDMQKEAIDIAISAF  63

Query  291  EKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            EK +VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYL+ KAVLLFKSG
Sbjct  64   EKYSVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLEQKAVLLFKSG  123



>ref|XP_010434906.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Camelina sativa]
Length=124

 Score =   171 bits (434),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 83/116 (72%), Positives = 98/116 (84%), Gaps = 3/116 (3%)
 Frame = +3

Query  126  NDGGALVAKLPAADDRKSASPP-ASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNN  302
            N GGA    +  +DDR+S+ P   +S  V K+ +IKSADMK+DMQKEA++IA+SAFEK +
Sbjct  11   NGGGAPAQTI--SDDRRSSLPELEASPPVGKRAVIKSADMKEDMQKEAIEIAVSAFEKYS  68

Query  303  VEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  69   VEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  124



>ref|XP_009782613.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Nicotiana 
sylvestris]
Length=134

 Score =   171 bits (433),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 97/135 (72%), Positives = 108/135 (80%), Gaps = 14/135 (10%)
 Frame = +3

Query  105  MSEDSKRND--GGALVAKLPAADDRKS----------ASPPASSITVSKK-VIIKSADMK  245
            MSED+KRN    GA+V K  ++DDRKS          +S  A+S TV KK VIIKSADMK
Sbjct  1    MSEDTKRNGIGAGAVVVK-SSSDDRKSLSASSDDRKSSSSSATSTTVGKKTVIIKSADMK  59

Query  246  DDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFV  425
             D+Q EAVDIAI+A EK NVEKDVAE IKKEFDKK+GP+WHCIVGKNFGSYVTHETNHFV
Sbjct  60   PDLQNEAVDIAIAALEKCNVEKDVAEQIKKEFDKKYGPSWHCIVGKNFGSYVTHETNHFV  119

Query  426  YFYLDSKAVLLFKSG  470
            YFYLDSKA+LLFKSG
Sbjct  120  YFYLDSKAILLFKSG  134



>ref|XP_010440231.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Camelina sativa]
 ref|XP_010449876.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Camelina sativa]
Length=124

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 85/121 (70%), Positives = 98/121 (81%), Gaps = 13/121 (11%)
 Frame = +3

Query  126  NDGGALVAKLPAADDRKS------ASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISA  287
            N GGA    +  +DDR+S      ASPPA      K+ +IKSADMK+DMQKEA++IA+SA
Sbjct  11   NGGGAPAQTI--SDDRRSSLPELEASPPAG-----KRAVIKSADMKEDMQKEAIEIAVSA  63

Query  288  FEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            FEK +VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKS
Sbjct  64   FEKYSVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKS  123

Query  468  G  470
            G
Sbjct  124  G  124



>emb|CDX90554.1| BnaA03g42270D [Brassica napus]
Length=121

 Score =   171 bits (432),  Expect = 1e-50, Method: Compositional matrix adjust.
 Identities = 84/125 (67%), Positives = 99/125 (79%), Gaps = 7/125 (6%)
 Frame = +3

Query  105  MSEDSKR---NDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDI  275
            MSE  ++   N GGA     P  DDR+S  P A +    K+ +I SADMK+DMQKEA++I
Sbjct  1    MSEGRRKKSVNGGGAPTQTNP--DDRRSTLPEAEA--AGKRAVIMSADMKEDMQKEAIEI  56

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFEK +VEK++AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVL
Sbjct  57   AITAFEKYSVEKEIAENIKKEFDKVHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVL  116

Query  456  LFKSG  470
            LFKSG
Sbjct  117  LFKSG  121



>emb|CDY09728.1| BnaC07g33330D [Brassica napus]
Length=121

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/128 (67%), Positives = 101/128 (79%), Gaps = 13/128 (10%)
 Frame = +3

Query  105  MSEDSKR---NDGGALVAKLPAA---DDRKSASPPASSITVSKKVIIKSADMKDDMQKEA  266
            MSE  ++   N GGA     PA    DDR+S  P A +    K+ +IKSADMK+DMQKEA
Sbjct  1    MSEGRRKKSVNGGGA-----PAQTNHDDRRSTLPEAEA--AGKRAVIKSADMKEDMQKEA  53

Query  267  VDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSK  446
            ++IAI+AFEK +VEK++AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETNHFVYFYLD K
Sbjct  54   IEIAITAFEKYSVEKEIAENIKKEFDKVHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQK  113

Query  447  AVLLFKSG  470
            AVLLFKSG
Sbjct  114  AVLLFKSG  121



>ref|NP_001238570.1| uncharacterized protein LOC100305908 [Glycine max]
 gb|ACU13818.1| unknown [Glycine max]
Length=118

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 90/122 (74%), Positives = 100/122 (82%), Gaps = 4/122 (3%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSE++K+N  GAL A+ P +D+ K A          KKVIIKSADM  DMQKEAVDIA++
Sbjct  1    MSEEAKKNFAGALTAR-PNSDEPKPAP---VPAVPPKKVIIKSADMIPDMQKEAVDIAVA  56

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFK
Sbjct  57   AFEKYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFK  116

Query  465  SG  470
            SG
Sbjct  117  SG  118



>ref|XP_008438899.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Cucumis melo]
Length=120

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 83/124 (67%), Positives = 99/124 (80%), Gaps = 6/124 (5%)
 Frame = +3

Query  105  MSEDSKR--NDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIA  278
            M+ +S+R  N     + K  + DDRK +SP      +SKK++IKSADM  DMQKEA+D A
Sbjct  1    MNLESRRTTNHPPPSIVKTESTDDRKPSSPSP----LSKKIVIKSADMFTDMQKEAIDAA  56

Query  279  ISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLL  458
            I+AFEK++VEKD+AE IKKEFDK HGPTWHCIVG+NFGSYVTHETNHFVYFYLD KA+LL
Sbjct  57   IAAFEKHSVEKDIAEQIKKEFDKNHGPTWHCIVGRNFGSYVTHETNHFVYFYLDQKAILL  116

Query  459  FKSG  470
            FKSG
Sbjct  117  FKSG  120



>ref|NP_193328.4| dynein light chain LC8-type  [Arabidopsis thaliana]
 gb|AAO44051.1| At4g15930 [Arabidopsis thaliana]
 gb|AEE83667.1| dynein light chain LC8-type [Arabidopsis thaliana]
Length=123

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 86/120 (72%), Positives = 97/120 (81%), Gaps = 13/120 (11%)
 Frame = +3

Query  129  DGGALVAKLPAADDRKS------ASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAF  290
            +GGA    +   DDR+S      ASPPA      K+ +IKSADMKDDMQKEA++IAISAF
Sbjct  11   NGGAPAQTI--LDDRRSSLPEVEASPPAG-----KRAVIKSADMKDDMQKEAIEIAISAF  63

Query  291  EKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            EK +VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  64   EKYSVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  123



>ref|XP_009107870.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Brassica 
rapa]
 emb|CDY24919.1| BnaC03g22530D [Brassica napus]
Length=124

 Score =   170 bits (431),  Expect = 2e-50, Method: Compositional matrix adjust.
 Identities = 82/116 (71%), Positives = 97/116 (84%), Gaps = 4/116 (3%)
 Frame = +3

Query  129  DGGALVAKLPAADDRKSASPPASSITVS--KKVIIKSADMKDDMQKEAVDIAISAFEKNN  302
            +GGA     P  DDR+S+   +S    +  ++ +IKSADMK+DMQKEA+DIAI+AFEKN+
Sbjct  11   NGGAPAQTNP--DDRRSSVEASSQGAGAGKQRAVIKSADMKEDMQKEAIDIAITAFEKNS  68

Query  303  VEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  69   VEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  124



>ref|XP_006284766.1| hypothetical protein CARUB_v10006033mg [Capsella rubella]
 gb|EOA17664.1| hypothetical protein CARUB_v10006033mg [Capsella rubella]
Length=123

 Score =   169 bits (429),  Expect = 4e-50, Method: Compositional matrix adjust.
 Identities = 83/115 (72%), Positives = 97/115 (84%), Gaps = 3/115 (3%)
 Frame = +3

Query  129  DGGALVAKLPAADDRKSASPPA-SSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNV  305
            +GGA    +  +DDR+S+ P   +S  V K+ +IKSADMK+DMQKEA+DIAI AFEK +V
Sbjct  11   NGGAPAQTI--SDDRRSSLPEVEASPPVGKRAVIKSADMKEDMQKEAIDIAIFAFEKYSV  68

Query  306  EKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            EKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  69   EKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  123



>gb|AAL57365.1|AF404866_1 neuronal nitric oxide synthase protein inhibitor [Arabidopsis 
thaliana]
Length=103

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 5/97 (5%)
 Frame = +3

Query  180  ASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGP  359
            ASPPA      K+ +IKSADMKDDMQKEA++IAISAFEK +VEKD+AE+IKKEFDKKHG 
Sbjct  12   ASPPAG-----KRAVIKSADMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGA  66

Query  360  TWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  67   TWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  103



>gb|AFK44581.1| unknown [Lotus japonicus]
Length=142

 Score =   168 bits (425),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 77/86 (90%), Positives = 82/86 (95%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KKVIIKSADM  DMQKEAVDIA++AFE+ NVEKDVAEHIKKEFDK+HGPTWHCIVG+NFG
Sbjct  57   KKVIIKSADMLPDMQKEAVDIAVAAFERLNVEKDVAEHIKKEFDKRHGPTWHCIVGRNFG  116

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  117  SYVTHETNHFVYFYLDQKAVLLFKSG  142



>emb|CAB46031.1| dynein light chain like protein [Arabidopsis thaliana]
 emb|CAB78635.1| dynein light chain like protein [Arabidopsis thaliana]
Length=103

 Score =   166 bits (421),  Expect = 3e-49, Method: Compositional matrix adjust.
 Identities = 79/97 (81%), Positives = 87/97 (90%), Gaps = 5/97 (5%)
 Frame = +3

Query  180  ASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGP  359
            ASPPA      K+ +IKSADMKDDMQKEA++IAISAFEK +VEKD+AE+IKKEFDKKHG 
Sbjct  12   ASPPAG-----KRAVIKSADMKDDMQKEAIEIAISAFEKYSVEKDIAENIKKEFDKKHGA  66

Query  360  TWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            TWHCIVG+NFGSYVTHETNHFVYFYLD KAVLLFKSG
Sbjct  67   TWHCIVGRNFGSYVTHETNHFVYFYLDQKAVLLFKSG  103



>ref|XP_006414418.1| hypothetical protein EUTSA_v10026570mg [Eutrema salsugineum]
 gb|ESQ55871.1| hypothetical protein EUTSA_v10026570mg [Eutrema salsugineum]
Length=123

 Score =   167 bits (423),  Expect = 4e-49, Method: Compositional matrix adjust.
 Identities = 83/125 (66%), Positives = 102/125 (82%), Gaps = 5/125 (4%)
 Frame = +3

Query  105  MSEDSKRN--DGGALVAKLPAADDRKSASPP-ASSITVSKKVIIKSADMKDDMQKEAVDI  275
            MS++ ++   +GGA    +  +DDR+S+ P   +S    K+ +IKSADMK+DMQKEA+DI
Sbjct  1    MSDERRKKSINGGAPAQTI--SDDRRSSLPKLEASPPPGKRAVIKSADMKEDMQKEAIDI  58

Query  276  AISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVL  455
            AI+AFE  +VEKD+AE+IKKEFDKKHG TWHCIVG+NFGSYVTHETNHFVYFYLD KAVL
Sbjct  59   AITAFENYSVEKDIAENIKKEFDKKHGATWHCIVGRNFGSYVTHETNHFVYFYLDQKAVL  118

Query  456  LFKSG  470
            LFKSG
Sbjct  119  LFKSG  123



>gb|EPS63643.1| hypothetical protein M569_11140, partial [Genlisea aurea]
Length=104

 Score =   165 bits (417),  Expect = 1e-48, Method: Compositional matrix adjust.
 Identities = 82/108 (76%), Positives = 97/108 (90%), Gaps = 4/108 (4%)
 Frame = +3

Query  147  AKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEH  326
            A + + +DR+S   P++SI  +KKV IKSADMK+DMQKEAVDIAI+AF+K++VEKDVAE 
Sbjct  1    AVVGSGEDRRS---PSASIP-AKKVTIKSADMKEDMQKEAVDIAIAAFDKHSVEKDVAEQ  56

Query  327  IKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IKK FDKK+GPTWHCIVGKNFGSYVTHETNHFVYFYL++KAVLLFKSG
Sbjct  57   IKKMFDKKYGPTWHCIVGKNFGSYVTHETNHFVYFYLENKAVLLFKSG  104



>ref|XP_010693604.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Beta vulgaris 
subsp. vulgaris]
Length=112

 Score =   163 bits (413),  Expect = 8e-48, Method: Compositional matrix adjust.
 Identities = 83/122 (68%), Positives = 97/122 (80%), Gaps = 10/122 (8%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MSED+KR   G +   +  +          SS + +K++I+KSADM DDMQKEA++IAI+
Sbjct  1    MSEDAKRAMAGKVSTDVRKS----------SSASSAKRIIVKSADMADDMQKEAIEIAIA  50

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AFEK NVEKDVAE IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHF+YFYLD KAVLLFK
Sbjct  51   AFEKLNVEKDVAESIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFIYFYLDQKAVLLFK  110

Query  465  SG  470
            SG
Sbjct  111  SG  112



>ref|XP_010269586.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Nelumbo nucifera]
Length=134

 Score =   164 bits (414),  Expect = 9e-48, Method: Compositional matrix adjust.
 Identities = 81/138 (59%), Positives = 103/138 (75%), Gaps = 20/138 (14%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASS----------------ITVSKKVIIKSA  236
            M +++KR   GA   K P++D++  A+ P  +                   +KKV++KSA
Sbjct  1    MMDEAKR---GAGFLK-PSSDEKSPAASPLGAPKKIIIKSADMKEDMQYGAAKKVVVKSA  56

Query  237  DMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETN  416
            DMK+DMQKEA++ A +AFEK+++EKD+AEHIKKEFDKKHGPTWHCIVG+NFGSYVTHETN
Sbjct  57   DMKEDMQKEAIECAFTAFEKHSIEKDIAEHIKKEFDKKHGPTWHCIVGRNFGSYVTHETN  116

Query  417  HFVYFYLDSKAVLLFKSG  470
            HFVYFYLD KA+LLFKSG
Sbjct  117  HFVYFYLDQKAILLFKSG  134



>dbj|BAJ99897.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=142

 Score =   163 bits (412),  Expect = 3e-47, Method: Compositional matrix adjust.
 Identities = 83/142 (58%), Positives = 103/142 (73%), Gaps = 20/142 (14%)
 Frame = +3

Query  105  MSEDSKRNDGG--ALVAKLPA----------ADDRKSAS--------PPASSITVSKKVI  224
            MS++ +R   G  A+ A  PA          AD R +AS        PPA++   + K+ 
Sbjct  1    MSDELRRGIAGSAAVAASHPAPYAATRAPADADRRLAASATAALGSPPPATASPTAHKIT  60

Query  225  IKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVT  404
            +KSADMK++MQKEA DI+  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVT
Sbjct  61   LKSADMKEEMQKEAFDISRVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVT  120

Query  405  HETNHFVYFYLDSKAVLLFKSG  470
            HETN+FVYFY+DSKAVLLFKSG
Sbjct  121  HETNYFVYFYIDSKAVLLFKSG  142



>ref|XP_008789848.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Phoenix dactylifera]
Length=131

 Score =   160 bits (406),  Expect = 2e-46, Method: Compositional matrix adjust.
 Identities = 80/133 (60%), Positives = 99/133 (74%), Gaps = 13/133 (10%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPA-----ADDRKSASPPASSITV------SKKVIIKSADMKDD  251
            M+E+ K+  GGA  A   A     +DDRKSA+PP  +         ++K+  KSADMK++
Sbjct  1    MAEERKK--GGARSAASMAYLRTSSDDRKSAAPPGDNTGTGPAAPAARKITFKSADMKEE  58

Query  252  MQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYF  431
            MQ+E  + A  AFEK  VEK++AE+IKKEFD KHGPTWHCIVG+NFGSYVTHETNHF+YF
Sbjct  59   MQQEVFECARIAFEKYTVEKEIAEYIKKEFDNKHGPTWHCIVGRNFGSYVTHETNHFIYF  118

Query  432  YLDSKAVLLFKSG  470
            Y+DSKAVLLFKSG
Sbjct  119  YVDSKAVLLFKSG  131



>ref|NP_001168554.1| uncharacterized protein LOC100382335 [Zea mays]
 gb|ACN28649.1| unknown [Zea mays]
 gb|AFW79670.1| putative dynein light chain type 1 family protein [Zea mays]
Length=122

 Score =   159 bits (401),  Expect = 5e-46, Method: Compositional matrix adjust.
 Identities = 73/122 (60%), Positives = 98/122 (80%), Gaps = 0/122 (0%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAIS  284
            MS++++R   GA  A L A+ + +      S   V+ K+ +KSADMK++M+++A +IA  
Sbjct  1    MSDEARRGPAGAAQAMLRASSEDRKPVGAGSPAAVAHKIQLKSADMKEEMRQDAFEIARI  60

Query  285  AFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFK  464
            AF+K+++EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETN+FVYFY+DSKAVLLFK
Sbjct  61   AFDKHSMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNYFVYFYIDSKAVLLFK  120

Query  465  SG  470
            SG
Sbjct  121  SG  122



>dbj|BAJ90639.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ88391.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=142

 Score =   154 bits (390),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 81/142 (57%), Positives = 101/142 (71%), Gaps = 20/142 (14%)
 Frame = +3

Query  105  MSEDSKRNDGG--ALVAKLPA----------ADDRKSASPPAS--------SITVSKKVI  224
            MS++ +R   G  A+ A  PA          AD R +AS  A+        +   + K+ 
Sbjct  1    MSDELRRGIAGSAAVAASHPAPYAATRAPADADRRLAASATAALGSPPPAAASPTAHKIT  60

Query  225  IKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVT  404
            +KSADMK++MQKEA DI+  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVT
Sbjct  61   LKSADMKEEMQKEAFDISRVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVT  120

Query  405  HETNHFVYFYLDSKAVLLFKSG  470
            HETN+FVYFY+DSKAVLLFKSG
Sbjct  121  HETNYFVYFYIDSKAVLLFKSG  142



>ref|NP_001132811.1| uncharacterized protein LOC100194301 [Zea mays]
 gb|ACF81813.1| unknown [Zea mays]
 gb|ACG38206.1| dynein light chain LC6, flagellar outer arm [Zea mays]
 tpg|DAA53984.1| TPA: putative dynein light chain type 1 family protein [Zea mays]
Length=128

 Score =   154 bits (388),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 79/128 (62%), Positives = 103/128 (80%), Gaps = 6/128 (5%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAA-DDRK-----SASPPASSITVSKKVIIKSADMKDDMQKEA  266
            MS++++R   GA    L A+ +DRK     S  P A++  V+ K+ +KSADMK++M++EA
Sbjct  1    MSDEARRGPAGAAQVVLRASSEDRKPVGSGSPPPAATATAVAHKIQLKSADMKEEMRQEA  60

Query  267  VDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSK  446
             +IA  AFEK+++EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETN+FVYFY+DSK
Sbjct  61   FEIARIAFEKHSMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNYFVYFYIDSK  120

Query  447  AVLLFKSG  470
            AVLLFKSG
Sbjct  121  AVLLFKSG  128



>ref|XP_010269585.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Nelumbo nucifera]
Length=150

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 81/154 (53%), Positives = 103/154 (67%), Gaps = 36/154 (23%)
 Frame = +3

Query  105  MSEDSKRNDGGALVAKLPAADDRKSASPPASS----------------ITVSKKVIIKSA  236
            M +++KR   GA   K P++D++  A+ P  +                   +KKV++KSA
Sbjct  1    MMDEAKR---GAGFLK-PSSDEKSPAASPLGAPKKIIIKSADMKEDMQYGAAKKVVVKSA  56

Query  237  DMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF---------  389
            DMK+DMQKEA++ A +AFEK+++EKD+AEHIKKEFDKKHGPTWHCIVG+NF         
Sbjct  57   DMKEDMQKEAIECAFTAFEKHSIEKDIAEHIKKEFDKKHGPTWHCIVGRNFASGASHCDH  116

Query  390  -------GSYVTHETNHFVYFYLDSKAVLLFKSG  470
                   GSYVTHETNHFVYFYLD KA+LLFKSG
Sbjct  117  IVCSFFKGSYVTHETNHFVYFYLDQKAILLFKSG  150



>ref|XP_003566466.1| PREDICTED: dynein light chain 1, cytoplasmic [Brachypodium distachyon]
Length=150

 Score =   153 bits (387),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  216  KVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGS  395
            K+ +KSADMK++MQKEA DIA  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGS
Sbjct  66   KIQLKSADMKEEMQKEAFDIARVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGS  125

Query  396  YVTHETNHFVYFYLDSKAVLLFKSG  470
            YVTHETN+FVYFY+DSKAVLLFKSG
Sbjct  126  YVTHETNYFVYFYIDSKAVLLFKSG  150



>ref|XP_010921629.1| PREDICTED: dynein light chain 1, cytoplasmic [Elaeis guineensis]
Length=129

 Score =   152 bits (383),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 77/129 (60%), Positives = 100/129 (78%), Gaps = 7/129 (5%)
 Frame = +3

Query  105  MSEDSKRNDGGAL--VAKLPAA-DDRK----SASPPASSITVSKKVIIKSADMKDDMQKE  263
            M+E+S++   G++  V  L A+ DDRK    + +P A +   ++K+  KSADMK++M++E
Sbjct  1    MAEESRKGVAGSVSSVTYLRASSDDRKLPATAPAPAAGTGAAARKITFKSADMKEEMRQE  60

Query  264  AVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDS  443
              + A  AFEK  VEKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETNHF+YFY+DS
Sbjct  61   VFECARIAFEKYTVEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNHFIYFYVDS  120

Query  444  KAVLLFKSG  470
            KAVLLFKSG
Sbjct  121  KAVLLFKSG  129



>ref|XP_004967828.1| PREDICTED: dynein 8 kDa light chain, flagellar outer arm-like 
[Setaria italica]
Length=124

 Score =   151 bits (382),  Expect = 4e-43, Method: Compositional matrix adjust.
 Identities = 71/107 (66%), Positives = 91/107 (85%), Gaps = 5/107 (5%)
 Frame = +3

Query  159  AADDRK---SASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHI  329
            +++DRK   + SPP ++     K+ +KSADMK++M++EA +IA  AFEK+ +EKD+AE+I
Sbjct  20   SSEDRKPVGAGSPPPAA--AGHKIQLKSADMKEEMRQEAFEIARIAFEKHTMEKDIAEYI  77

Query  330  KKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            KKEFDK HGPTWHCIVG+NFGSYVTHETN+FVYFY+DSKAVLLFKSG
Sbjct  78   KKEFDKNHGPTWHCIVGRNFGSYVTHETNYFVYFYIDSKAVLLFKSG  124



>gb|KHN26541.1| Dynein light chain 2, cytoplasmic [Glycine soja]
Length=121

 Score =   151 bits (381),  Expect = 5e-43, Method: Compositional matrix adjust.
 Identities = 68/77 (88%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  240  MKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNH  419
            M  DMQKEAVDIA++AFEK NVEKDVAE IKKEFDK+HGPTWHCIVG+NFGSYVTHETNH
Sbjct  45   MIPDMQKEAVDIAVAAFEKYNVEKDVAEQIKKEFDKRHGPTWHCIVGRNFGSYVTHETNH  104

Query  420  FVYFYLDSKAVLLFKSG  470
            FVYFYLD KAVLLFKSG
Sbjct  105  FVYFYLDQKAVLLFKSG  121



>ref|XP_008784763.1| PREDICTED: LOW QUALITY PROTEIN: dynein light chain 1, cytoplasmic-like 
[Phoenix dactylifera]
Length=131

 Score =   150 bits (380),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 79/134 (59%), Positives = 99/134 (74%), Gaps = 15/134 (11%)
 Frame = +3

Query  105  MSEDSKRNDGGAL--VAKLPAA-DDRKSASPPASSITV---------SKKVIIKSADMKD  248
            M++DS++   G+    A L A+ DDRK   PPA++            S+K+  KSADMK+
Sbjct  1    MADDSRKGVAGSAPSAAYLRASSDDRK---PPATAALGAGTAGTGAASRKITFKSADMKE  57

Query  249  DMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVY  428
            +M++E  + A  AFEK  VEKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETNHF+Y
Sbjct  58   EMRQEVFECARIAFEKYTVEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNHFIY  117

Query  429  FYLDSKAVLLFKSG  470
            FY+DSKAVLLFKSG
Sbjct  118  FYVDSKAVLLFKSG  131



>ref|XP_002455387.1| hypothetical protein SORBIDRAFT_03g009850 [Sorghum bicolor]
 gb|EES00507.1| hypothetical protein SORBIDRAFT_03g009850 [Sorghum bicolor]
Length=130

 Score =   150 bits (379),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 97/130 (75%), Gaps = 8/130 (6%)
 Frame = +3

Query  105  MSEDSKRND--GGALVAKLPAADDRKSASPPASSITVSK------KVIIKSADMKDDMQK  260
            MS++++R    G A      +++DRK     +     +       K+ +KSADMK++M++
Sbjct  1    MSDEARRGGPAGAAQAVVRASSEDRKPVGAGSPPPAAAAAAVAAHKIQLKSADMKEEMRQ  60

Query  261  EAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLD  440
            EA +IA  AFEK+++EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETN+FVYFY+D
Sbjct  61   EAFEIARVAFEKHSMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNYFVYFYID  120

Query  441  SKAVLLFKSG  470
            SKAVLLFKSG
Sbjct  121  SKAVLLFKSG  130



>ref|NP_001042625.1| Os01g0256400 [Oryza sativa Japonica Group]
 dbj|BAA85215.1| putative dynein 8 kDa light chain, flagellar outer arm [Oryza 
sativa Japonica Group]
 dbj|BAF04539.1| Os01g0256400 [Oryza sativa Japonica Group]
 dbj|BAG98219.1| unnamed protein product [Oryza sativa Japonica Group]
Length=130

 Score =   148 bits (374),  Expect = 9e-42, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  216  KVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGS  395
            K+ +KSADMK++M++EA DIA  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGS
Sbjct  46   KIQLKSADMKEEMRQEAFDIARVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGS  105

Query  396  YVTHETNHFVYFYLDSKAVLLFKSG  470
            YVTHETN+FVYFY+DSKAVLLFKSG
Sbjct  106  YVTHETNYFVYFYIDSKAVLLFKSG  130



>gb|EEE54259.1| hypothetical protein OsJ_01150 [Oryza sativa Japonica Group]
Length=142

 Score =   148 bits (374),  Expect = 1e-41, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 79/85 (93%), Gaps = 0/85 (0%)
 Frame = +3

Query  216  KVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGS  395
            K+ +KSADMK++M++EA DIA  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGS
Sbjct  58   KIQLKSADMKEEMRQEAFDIARVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGS  117

Query  396  YVTHETNHFVYFYLDSKAVLLFKSG  470
            YVTHETN+FVYFY+DSKAVLLFKSG
Sbjct  118  YVTHETNYFVYFYIDSKAVLLFKSG  142



>emb|CDQ77749.1| unnamed protein product [Oncorhynchus mykiss]
Length=157

 Score =   148 bits (374),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/111 (62%), Positives = 84/111 (76%), Gaps = 2/111 (2%)
 Frame = +3

Query  138  ALVAKLPAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDV  317
            +LV+ L A    K AS P   I   +K +IK+ADM +DMQ++AVD A  A EK N+EKD+
Sbjct  49   SLVSYLIA--KWKVASSPTQGIMTDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDI  106

Query  318  AEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            A +IKKEFDKK+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  107  AAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  157



>ref|XP_009414896.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=104

 Score =   145 bits (365),  Expect = 9e-41, Method: Compositional matrix adjust.
 Identities = 64/103 (62%), Positives = 84/103 (82%), Gaps = 0/103 (0%)
 Frame = +3

Query  162  ADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEF  341
            A++ KS     +    S K+++KS DM + M+ +A+D A +AFEK+ +EK++AE+IKKEF
Sbjct  2    AEESKSGVGAVAQAATSPKIVLKSIDMSEKMRNDAIDCARAAFEKHRLEKEIAEYIKKEF  61

Query  342  DKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            DKK+G TWHCIVG+NFGSYVTHETNHF+YFY+DSKAVLLFKSG
Sbjct  62   DKKYGQTWHCIVGRNFGSYVTHETNHFLYFYVDSKAVLLFKSG  104



>ref|XP_008693734.1| PREDICTED: dynein light chain 2, cytoplasmic [Ursus maritimus]
Length=97

 Score =   144 bits (364),  Expect = 1e-40, Method: Compositional matrix adjust.
 Identities = 65/95 (68%), Positives = 80/95 (84%), Gaps = 1/95 (1%)
 Frame = +3

Query  189  PASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTW  365
            P SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTW
Sbjct  3    PWSSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTW  62

Query  366  HCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            HCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  63   HCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  97



>ref|XP_001363123.2| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Monodelphis 
domestica]
Length=174

 Score =   145 bits (367),  Expect = 3e-40, Method: Compositional matrix adjust.
 Identities = 65/102 (64%), Positives = 83/102 (81%), Gaps = 1/102 (1%)
 Frame = +3

Query  168  DRKSASPPASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFD  344
            D   A+P ++S+ +S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFD
Sbjct  73   DCTKAAPTSTSVAMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFD  132

Query  345  KKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            KK+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  133  KKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  174



>ref|XP_004434820.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 1 [Ceratotherium 
simum simum]
Length=110

 Score =   143 bits (361),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPA--SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            SASP     S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  10   SASPLCFFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  69

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  70   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  110



>ref|XP_007086772.1| PREDICTED: dynein light chain 2, cytoplasmic [Panthera tigris 
altaica]
Length=104

 Score =   143 bits (360),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPA--SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            SASP     S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  4    SASPLCFFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  63

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  104



>ref|XP_005394096.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Chinchilla 
lanigera]
Length=97

 Score =   142 bits (359),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  5    SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  64

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  97



>ref|XP_004747381.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Mustela 
putorius furo]
Length=130

 Score =   143 bits (361),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 64/95 (67%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = +3

Query  189  PASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTW  365
            P  S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTW
Sbjct  36   PGGSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTW  95

Query  366  HCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            HCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  96   HCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  130



>ref|XP_001503476.3| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Equus 
caballus]
 ref|XP_008511062.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Equus 
przewalskii]
Length=98

 Score =   142 bits (358),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  6    SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  65

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  66   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  98



>ref|XP_004405258.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 2 [Odobenus 
rosmarus divergens]
 ref|XP_006750327.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Leptonychotes 
weddellii]
Length=97

 Score =   142 bits (358),  Expect = 9e-40, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  5    SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  64

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  97



>ref|XP_004405257.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 1 [Odobenus 
rosmarus divergens]
Length=118

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  26   SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  85

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  86   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  118



>ref|XP_005624775.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X10 [Canis 
lupus familiaris]
Length=102

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  10   SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  69

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  70   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  102



>ref|XP_008056250.1| PREDICTED: dynein light chain 2, cytoplasmic [Tarsius syrichta]
Length=104

 Score =   142 bits (357),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPAS--SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            SAS   S  S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  4    SASSLCSFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  63

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  104



>ref|XP_002683249.1| predicted protein [Naegleria gruberi]
 gb|EFC50505.1| predicted protein [Naegleria gruberi]
Length=90

 Score =   141 bits (356),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 76/87 (87%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            +KK +IK+ADM+++MQ+EAVDIA  A +K N+EKD+A HIKKEFDKK+ PTWHC+VG+NF
Sbjct  4    NKKAVIKNADMEENMQREAVDIAAQALDKFNIEKDIAAHIKKEFDKKYNPTWHCVVGRNF  63

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   GSYVTHETKHFIYFYLGQVAVLLFKSG  90



>ref|XP_003272346.1| PREDICTED: dynein light chain 2, cytoplasmic [Nomascus leucogenys]
Length=136

 Score =   143 bits (360),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPAS--SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            SA P  S  S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  36   SALPLCSFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  95

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  96   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  136



>ref|XP_004798759.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Mustela 
putorius furo]
Length=129

 Score =   142 bits (359),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 67/101 (66%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPA--SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            SASP     S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  29   SASPLCFFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  88

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  89   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  129



>ref|XP_005962028.1| PREDICTED: dynein light chain 1, cytoplasmic [Pantholops hodgsonii]
Length=124

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/99 (63%), Positives = 79/99 (80%), Gaps = 0/99 (0%)
 Frame = +3

Query  174  KSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKH  353
            +SASP +      +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+
Sbjct  26   QSASPCSLVTMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKY  85

Query  354  GPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
             PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  86   NPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  124



>ref|XP_005624774.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X9 [Canis 
lupus familiaris]
Length=119

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/93 (69%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            SS+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  27   SSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  86

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  87   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  119



>ref|XP_004377946.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 1 [Trichechus 
manatus latirostris]
Length=168

 Score =   144 bits (362),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/107 (64%), Positives = 84/107 (79%), Gaps = 3/107 (3%)
 Frame = +3

Query  159  AADDRKSASPPAS--SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHI  329
              D   SASP  S  S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +I
Sbjct  62   CPDHGPSASPLCSFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYI  121

Query  330  KKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            KKEFDKK+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  122  KKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  168



>ref|XP_009383543.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Musa acuminata 
subsp. malaccensis]
Length=107

 Score =   141 bits (356),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 78/87 (90%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            S K+++KS DM + M+ +A+D A +AFEK+ +EKD+AE+IKKEFDKK+G TWHCIVG+NF
Sbjct  21   SPKIVLKSIDMSEKMRNDAIDCARAAFEKHRLEKDIAEYIKKEFDKKYGATWHCIVGRNF  80

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHETNHF+YFY+DSKAVLLFKSG
Sbjct  81   GSYVTHETNHFLYFYVDSKAVLLFKSG  107



>ref|XP_002930443.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Ailuropoda 
melanoleuca]
Length=125

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 62/95 (65%), Positives = 79/95 (83%), Gaps = 1/95 (1%)
 Frame = +3

Query  189  PASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTW  365
            P SS+T+  +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTW
Sbjct  31   PCSSVTMCDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTW  90

Query  366  HCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            HCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  91   HCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  125



>ref|XP_007622405.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Cricetulus 
griseus]
Length=129

 Score =   142 bits (358),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 64/97 (66%), Positives = 80/97 (82%), Gaps = 1/97 (1%)
 Frame = +3

Query  183  SPPASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGP  359
            S  + S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ P
Sbjct  33   SRRSCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNP  92

Query  360  TWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            TWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  93   TWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  129



>ref|NP_498422.1| Protein DLC-1 [Caenorhabditis elegans]
 ref|XP_002634696.1| C. briggsae CBR-DLC-1 protein [Caenorhabditis briggsae]
 ref|XP_003111692.1| CRE-DLC-1 protein [Caenorhabditis remanei]
 sp|Q22799.1|DYL1_CAEEL RecName: Full=Dynein light chain 1, cytoplasmic [Caenorhabditis 
elegans]
 emb|CAP36886.1| Protein CBR-DLC-1 [Caenorhabditis briggsae]
 gb|EFO83553.1| CRE-DLC-1 protein [Caenorhabditis remanei]
 gb|EGT35665.1| CBN-DLC-1 protein [Caenorhabditis brenneri]
 emb|CCD63216.1| DLC-1 [Caenorhabditis elegans]
Length=89

 Score =   140 bits (354),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V +K +IK+ADM DDMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  2    VDRKAVIKNADMSDDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  61

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  62   FGSYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_005959962.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Pantholops 
hodgsonii]
Length=153

 Score =   143 bits (360),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 69/135 (51%), Positives = 92/135 (68%), Gaps = 3/135 (2%)
 Frame = +3

Query  75   HKSQSPTKTNMSEDSKRNDGGALVAKLPAADDRKSASPPASSITVS---KKVIIKSADMK  245
            H   S  +T+M + +  +    ++   P A     AS   + + V+   +K +IK+ADM 
Sbjct  19   HAHYSGDETSMDKQNGNHSSNPVIQWGPTASAFDGASKEHTDLCVTTSDRKAVIKNADMS  78

Query  246  DDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFV  425
            +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFGSYVTHET HF+
Sbjct  79   EDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFI  138

Query  426  YFYLDSKAVLLFKSG  470
            YFYL   A+LLFKSG
Sbjct  139  YFYLGQVAILLFKSG  153



>ref|XP_003931391.1| PREDICTED: dynein light chain 2, cytoplasmic [Saimiri boliviensis 
boliviensis]
Length=161

 Score =   142 bits (359),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 68/105 (65%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = +3

Query  165  DDRKSASPPAS--SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKK  335
            D   SA P  S  S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKK
Sbjct  57   DGVLSALPLCSFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKK  116

Query  336  EFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            EFDKK+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  117  EFDKKYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  161



>ref|XP_006154720.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Tupaia 
chinensis]
Length=94

 Score =   140 bits (354),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
             S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  2    GSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  61

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  62   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  94



>gb|KFO35006.1| Dynein light chain 2, cytoplasmic [Fukomys damarensis]
Length=137

 Score =   141 bits (356),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  198  SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCI  374
            S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCI
Sbjct  46   SVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCI  105

Query  375  VGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  106  VGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  137



>emb|CDS31683.1| neuronal nitric oxidse synthase protein [Hymenolepis microstoma]
Length=89

 Score =   140 bits (352),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K ++K+ADM +DMQ +AV IA  A EK N+EKD+A +IKKEFDKKH PTWHCIVG+NFG
Sbjct  4    RKAVVKNADMTEDMQSDAVSIAGQALEKFNIEKDIAAYIKKEFDKKHSPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHETNHF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETNHFIYFYLGQVAILLFKSG  89



>ref|XP_004905885.1| PREDICTED: dynein light chain 2, cytoplasmic [Heterocephalus 
glaber]
Length=136

 Score =   141 bits (356),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
             S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  44   CSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  103

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  104  IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  136



>gb|ETE67687.1| Dynein light chain 2, cytoplasmic, partial [Ophiophagus hannah]
Length=105

 Score =   140 bits (353),  Expect = 5e-39, Method: Compositional matrix adjust.
 Identities = 62/91 (68%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  SITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIV  377
            SI   +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIV
Sbjct  15   SIMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIV  74

Query  378  GKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            G+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  75   GRNFGSYVTHETKHFIYFYLGQVAILLFKSG  105



>ref|XP_006154718.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Tupaia 
chinensis]
Length=118

 Score =   140 bits (354),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 64/94 (68%), Positives = 79/94 (84%), Gaps = 1/94 (1%)
 Frame = +3

Query  192  ASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWH  368
            A S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWH
Sbjct  25   AHSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWH  84

Query  369  CIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            CIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  85   CIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  118



>ref|XP_007126910.1| PREDICTED: dynein light chain 2, cytoplasmic [Physeter catodon]
Length=108

 Score =   140 bits (353),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 63/93 (68%), Positives = 79/93 (85%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            +S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  16   ASVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  75

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  76   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  108



>gb|EKC35615.1| Dynein light chain 2, cytoplasmic [Crassostrea gigas]
Length=137

 Score =   141 bits (355),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 61/91 (67%), Positives = 76/91 (84%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  SITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIV  377
            +I   +K +IK+ADM +DMQ++AVD A +A EK N+EKD+A +IKKEFDKK+ PTWHCIV
Sbjct  47   AIMSERKAVIKNADMSEDMQQDAVDCATTALEKYNIEKDIAAYIKKEFDKKYNPTWHCIV  106

Query  378  GKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            G+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  107  GRNFGSYVTHETKHFIYFYLGQVAILLFKSG  137



>ref|XP_003971218.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Takifugu rubripes]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM DDMQ++AVD A+ A EK N+EKD+A  +KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSDDMQQDAVDYAMQAMEKYNIEKDIAAFVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|ACQ58498.1| Dynein light chain 2, cytoplasmic [Anoplopoma fimbria]
 gb|ACQ58728.1| Dynein light chain 2, cytoplasmic [Anoplopoma fimbria]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++AVD A+ A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>emb|CDJ90138.1| Dynein light chain domain containing protein [Haemonchus contortus]
Length=98

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  11   VDRKAVIKNADMSEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  70

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  71   FGSYVTHETKHFIYFYLGQVAILLFKSG  98



>gb|KIH57877.1| dynein light chain type 1 [Ancylostoma duodenale]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  2    VDRKAVIKNADMTEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  61

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  62   FGSYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_002408929.1| dynein light chain [Ixodes scapularis]
 gb|EEC06921.1| dynein light chain [Ixodes scapularis]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM ++MQ++AVD+A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSEEMQQDAVDVATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|ERL95022.1| hypothetical protein D910_12292 [Dendroctonus ponderosae]
Length=125

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  183  SPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPT  362
            SP        +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PT
Sbjct  30   SPSKVEKMTDRKAVIKNADMSEDMQQDAVDCATQAIEKYNIEKDIAAYIKKEFDKKYNPT  89

Query  363  WHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            WHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  90   WHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG  125



>gb|ENN71870.1| hypothetical protein YQE_11485, partial [Dendroctonus ponderosae]
Length=127

 Score =   140 bits (353),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/96 (65%), Positives = 75/96 (78%), Gaps = 0/96 (0%)
 Frame = +3

Query  183  SPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPT  362
            SP        +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PT
Sbjct  32   SPSKVEKMTDRKAVIKNADMSEDMQQDAVDCATQAIEKYNIEKDIAAYIKKEFDKKYNPT  91

Query  363  WHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            WHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  92   WHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG  127



>ref|XP_011420841.1| PREDICTED: dynein light chain 2, cytoplasmic [Crassostrea gigas]
 gb|EKC17891.1| Dynein light chain 2, cytoplasmic [Crassostrea gigas]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A +A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATTALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|KIY45023.1| outer dynein arm light chain 8 [Fistulina hepatica ATCC 64428]
Length=106

 Score =   139 bits (351),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 64/105 (61%), Positives = 83/105 (79%), Gaps = 3/105 (3%)
 Frame = +3

Query  162  ADDRKSASPPASSITV---SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIK  332
            A+ + + S PAS  T    S K IIK+ DM ++MQ+E+VD+A SA EK N+EKD+A HIK
Sbjct  2    AEKQDAPSDPASGPTTGGTSAKAIIKNVDMSEEMQQESVDVASSALEKYNIEKDIAAHIK  61

Query  333  KEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            KEFD++HGPTWH +VGKNFGSYVTHET HF+YFY+ S A+L++KS
Sbjct  62   KEFDRRHGPTWHVVVGKNFGSYVTHETKHFIYFYVGSLAILIWKS  106



>gb|ETN73136.1| dynein light chain type 1 [Necator americanus]
Length=97

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  10   VDRKAVIKNADMTEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  69

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  70   FGSYVTHETKHFIYFYLGQVAILLFKSG  97



>gb|KDR18512.1| Dynein light chain 1, cytoplasmic [Zootermopsis nevadensis]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_004076438.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Oryzias latipes]
 ref|XP_005805871.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Xiphophorus 
maculatus]
 ref|XP_008290724.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Stegastes 
partitus]
 ref|XP_008425360.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Poecilia reticulata]
 ref|XP_010746525.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Larimichthys 
crocea]
Length=89

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++AVD A+ A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_005394095.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Chinchilla 
lanigera]
Length=98

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 74/94 (79%), Gaps = 0/94 (0%)
 Frame = +3

Query  189  PASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWH  368
            P       +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWH
Sbjct  5    PRRVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWH  64

Query  369  CIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            CIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   CIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  98



>ref|XP_006154719.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Tupaia 
chinensis]
Length=97

 Score =   139 bits (350),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 62/93 (67%), Positives = 78/93 (84%), Gaps = 1/93 (1%)
 Frame = +3

Query  195  SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHC  371
            + +T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHC
Sbjct  5    NCVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHC  64

Query  372  IVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            IVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   IVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  97



>ref|XP_010083528.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Pterocles 
gutturalis]
 gb|KFV02283.1| Dynein light chain 2, cytoplasmic [Pterocles gutturalis]
Length=89

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>emb|CEF68120.1| Dynein, light chain, LC8-type 2 [Strongyloides ratti]
Length=89

 Score =   139 bits (349),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM DDMQ EA++ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMADDMQTEAIECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_005298897.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Chrysemys 
picta bellii]
Length=151

 Score =   140 bits (354),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  66   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  125

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  126  SYVTHETKHFIYFYLGQVAILLFKSG  151



>ref|XP_003446871.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004550035.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Maylandia zebra]
 ref|XP_004550036.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Maylandia zebra]
 ref|XP_005472262.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005751094.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Pundamilia 
nyererei]
 ref|XP_005945425.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Haplochromis burtoni]
 ref|XP_005945426.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Haplochromis burtoni]
 ref|XP_006800092.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006800093.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Neolamprologus brichardi]
Length=89

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++AVD A+ A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|EAW94483.1| dynein, light chain, LC8-type 2, isoform CRA_a, partial [Homo 
sapiens]
Length=226

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  141  RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  200

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  201  SYVTHETKHFIYFYLGQVAILLFKSG  226



>ref|XP_001782608.1| predicted protein [Physcomitrella patens]
 gb|EDQ52597.1| predicted protein [Physcomitrella patens]
Length=99

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 64/92 (70%), Positives = 78/92 (85%), Gaps = 1/92 (1%)
 Frame = +3

Query  195  SSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCI  374
            SSI + +K IIK+ADM +DMQ++A++ A +A +K NVEKD+A +IKKEFDKK+ PTWHCI
Sbjct  9    SSI-LERKAIIKNADMTEDMQQDAIECATAALDKYNVEKDIAAYIKKEFDKKYNPTWHCI  67

Query  375  VGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VG+NFGSYVTHET HFVYFYL   AVLLFKSG
Sbjct  68   VGRNFGSYVTHETRHFVYFYLGQVAVLLFKSG  99



>emb|CBI22981.3| unnamed protein product [Vitis vinifera]
Length=73

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/73 (85%), Positives = 70/73 (96%), Gaps = 0/73 (0%)
 Frame = +3

Query  252  MQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYF  431
            MQKEA+DIAI+A E ++VEK++AE+IKKEFDKKHGPTWHCIVG+NFGSYVTHETNHFVYF
Sbjct  1    MQKEAIDIAIAASENHSVEKNIAEYIKKEFDKKHGPTWHCIVGRNFGSYVTHETNHFVYF  60

Query  432  YLDSKAVLLFKSG  470
            YLD KAVLLFKSG
Sbjct  61   YLDQKAVLLFKSG  73



>gb|AHH29554.1| dynein light chain type 1 [Rhipicephalus microplus]
Length=89

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD+A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDVATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|EYB97434.1| hypothetical protein Y032_0141g2270 [Ancylostoma ceylanicum]
Length=97

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  10   VDRKAVIKNADMTEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  69

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  70   FGSYVTHETKHFIYFYLGQVAILLFKSG  97



>ref|XP_006644010.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Oryza brachyantha]
Length=77

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/77 (79%), Positives = 72/77 (94%), Gaps = 0/77 (0%)
 Frame = +3

Query  240  MKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNH  419
            MK++M++EA DIA  AFEK+ +EKD+AE+IKKEFDK HGPTWHCIVG+NFGSYVTHETN+
Sbjct  1    MKEEMRQEAFDIARVAFEKHTMEKDIAEYIKKEFDKNHGPTWHCIVGRNFGSYVTHETNY  60

Query  420  FVYFYLDSKAVLLFKSG  470
            FVYFY+DSKAVLLFKSG
Sbjct  61   FVYFYIDSKAVLLFKSG  77



>ref|XP_006138678.1| PREDICTED: dynein light chain 2, cytoplasmic [Pelodiscus sinensis]
Length=111

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  26   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  85

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  86   SYVTHETKHFIYFYLGQVAILLFKSG  111



>pdb|1RE6|A Chain A, Localisation Of Dynein Light Chains 1 And 2 And Their 
Pro- Apoptotic Ligands
 pdb|1RE6|B Chain B, Localisation Of Dynein Light Chains 1 And 2 And Their 
Pro- Apoptotic Ligands
Length=94

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 62/94 (66%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  189  PASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWH  368
            P  S++  +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWH
Sbjct  2    PLGSMS-DRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWH  60

Query  369  CIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            CIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   CIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  94



>ref|XP_005026707.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Anas platyrhynchos]
Length=104

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 61/98 (62%), Positives = 77/98 (79%), Gaps = 0/98 (0%)
 Frame = +3

Query  177  SASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHG  356
            S +    +I   +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A HIKKEFDKK+ 
Sbjct  7    SHASRREAIMSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAHIKKEFDKKYN  66

Query  357  PTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  67   PTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  104



>gb|KFO65122.1| Dynein light chain 1, cytoplasmic, partial [Corvus brachyrhynchos]
 gb|KFP07829.1| Dynein light chain 1, cytoplasmic, partial [Calypte anna]
 gb|KFR12447.1| Dynein light chain 1, cytoplasmic, partial [Opisthocomus hoazin]
 gb|KFW82507.1| Dynein light chain 1, cytoplasmic, partial [Manacus vitellinus]
 gb|KGL96196.1| Dynein light chain 1, cytoplasmic, partial [Charadrius vociferus]
 gb|KGL96198.1| Dynein light chain 1, cytoplasmic, partial [Charadrius vociferus]
Length=92

 Score =   139 bits (349),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/92 (65%), Positives = 75/92 (82%), Gaps = 0/92 (0%)
 Frame = +3

Query  195  SSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCI  374
             +I   +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCI
Sbjct  1    QAIMSDRKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCI  60

Query  375  VGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   VGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  92



>ref|XP_008330933.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Cynoglossus 
semilaevis]
Length=89

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM D+MQ++AVD A+ A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_007176204.1| PREDICTED: dynein light chain 2, cytoplasmic [Balaenoptera acutorostrata 
scammoni]
Length=134

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/101 (65%), Positives = 82/101 (81%), Gaps = 3/101 (3%)
 Frame = +3

Query  177  SASPPA--SSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDK  347
            +ASP     S+T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDK
Sbjct  34   AASPLCFFCSVTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDK  93

Query  348  KHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            K+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  94   KYNPTWHCIVGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  134



>ref|XP_009025211.1| hypothetical protein HELRODRAFT_68300 [Helobdella robusta]
 gb|ESN96608.1| hypothetical protein HELRODRAFT_68300 [Helobdella robusta]
Length=89

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_969268.1| PREDICTED: dynein light chain 1, cytoplasmic [Tribolium castaneum]
 gb|AEE63573.1| unknown [Dendroctonus ponderosae]
Length=89

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAIEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_008333591.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Cynoglossus 
semilaevis]
Length=131

 Score =   140 bits (352),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  46   RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  105

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  106  SYVTHETKHFIYFYLGQVAILLFKSG  131



>gb|EOB06446.1| Dynein light chain 2, cytoplasmic, partial [Anas platyrhynchos]
 gb|KFM06859.1| Dynein light chain 2, cytoplasmic, partial [Aptenodytes forsteri]
 gb|KFO15221.1| Dynein light chain 2, cytoplasmic, partial [Balearica regulorum 
gibbericeps]
 gb|KFO57144.1| Dynein light chain 2, cytoplasmic, partial [Corvus brachyrhynchos]
 gb|KFO80957.1| Dynein light chain 2, cytoplasmic, partial [Cuculus canorus]
 gb|KFO89664.1| Dynein light chain 2, cytoplasmic, partial [Buceros rhinoceros 
silvestris]
 gb|KFO98905.1| Dynein light chain 2, cytoplasmic, partial [Calypte anna]
 gb|KFP09065.1| Dynein light chain 2, cytoplasmic, partial [Egretta garzetta]
 gb|KFP33458.1| Dynein light chain 2, cytoplasmic, partial [Colius striatus]
 gb|KFP36416.1| Dynein light chain 2, cytoplasmic, partial [Chlamydotis macqueenii]
 gb|KFP62423.1| Dynein light chain 2, cytoplasmic, partial [Cariama cristata]
 gb|KFP79411.1| Dynein light chain 2, cytoplasmic, partial [Acanthisitta chloris]
 gb|KFP83418.1| Dynein light chain 2, cytoplasmic, partial [Apaloderma vittatum]
 gb|KFP96996.1| Dynein light chain 2, cytoplasmic, partial [Haliaeetus albicilla]
 gb|KFQ15392.1| Dynein light chain 2, cytoplasmic, partial [Leptosomus discolor]
 gb|KFQ31170.1| Dynein light chain 2, cytoplasmic, partial [Mesitornis unicolor]
 gb|KFQ44747.1| Dynein light chain 2, cytoplasmic, partial [Nestor notabilis]
 gb|KFQ63345.1| Dynein light chain 2, cytoplasmic, partial [Pelecanus crispus]
 gb|KFQ73995.1| Dynein light chain 2, cytoplasmic, partial [Phoenicopterus ruber 
ruber]
 gb|KFQ78009.1| Dynein light chain 2, cytoplasmic, partial [Phaethon lepturus]
 gb|KFQ91506.1| Dynein light chain 2, cytoplasmic, partial [Nipponia nippon]
 gb|KFR09489.1| Dynein light chain 2, cytoplasmic, partial [Opisthocomus hoazin]
 gb|KFU86227.1| Dynein light chain 2, cytoplasmic, partial [Chaetura pelagica]
 gb|KFV10414.1| Dynein light chain 2, cytoplasmic, partial [Pterocles gutturalis]
 gb|KFV20509.1| Dynein light chain 2, cytoplasmic, partial [Tauraco erythrolophus]
 gb|KFV49523.1| Dynein light chain 2, cytoplasmic, partial [Tyto alba]
 gb|KFV56773.1| Dynein light chain 2, cytoplasmic, partial [Gavia stellata]
 gb|KFV75486.1| Dynein light chain 2, cytoplasmic, partial [Struthio camelus 
australis]
 gb|KFV75790.1| Dynein light chain 2, cytoplasmic, partial [Picoides pubescens]
 gb|KFV96520.1| Dynein light chain 2, cytoplasmic, partial [Fulmarus glacialis]
 gb|KFW04158.1| Dynein light chain 2, cytoplasmic, partial [Eurypyga helias]
 gb|KFW70647.1| Dynein light chain 2, cytoplasmic, partial [Pygoscelis adeliae]
 gb|KFW84085.1| Dynein light chain 2, cytoplasmic, partial [Manacus vitellinus]
 gb|KFW93993.1| Dynein light chain 2, cytoplasmic, partial [Phalacrocorax carbo]
 gb|KFZ57844.1| Dynein light chain 2, cytoplasmic, partial [Podiceps cristatus]
 gb|KFZ58160.1| Dynein light chain 2, cytoplasmic, partial [Caprimulgus carolinensis]
 gb|KGL81743.1| Dynein light chain 2, cytoplasmic, partial [Tinamus guttatus]
 gb|KGL90424.1| Dynein light chain 2, cytoplasmic, partial [Charadrius vociferus]
Length=91

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  6    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  65

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  66   SYVTHETKHFIYFYLGQVAILLFKSG  91



>ref|XP_011347927.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Cerapachys 
biroi]
Length=111

 Score =   139 bits (350),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 66/111 (59%), Positives = 83/111 (75%), Gaps = 5/111 (5%)
 Frame = +3

Query  153  LPAADDRKSAS----PPASSITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDV  317
            +PA D R +      P + S  +S +K +IK+ADM ++MQ++AVD A  A EK N+EKD+
Sbjct  1    MPALDVRATVKVVRFPCSRSNKMSDRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDI  60

Query  318  AEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            A  IKKEFDKK+ PTWHCIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   AAFIKKEFDKKYNPTWHCIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG  111



>ref|XP_010791813.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Notothenia 
coriiceps]
Length=89

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++AVD A+ A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMPDEMQQDAVDCAMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_008935180.1| PREDICTED: dynein light chain 2, cytoplasmic [Merops nubicus]
Length=96

 Score =   138 bits (348),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  11   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  70

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  71   SYVTHETKHFIYFYLGQVAILLFKSG  96



>ref|NP_080832.1| dynein light chain 2, cytoplasmic [Mus musculus]
 ref|NP_542408.1| dynein light chain 2, cytoplasmic [Homo sapiens]
 ref|NP_542428.1| dynein light chain 2, cytoplasmic [Rattus norvegicus]
 ref|NP_001088907.1| dynein, light chain, LC8-type 2 [Xenopus laevis]
 ref|NP_001106774.1| dynein light chain 2, cytoplasmic [Bos taurus]
 ref|NP_001161943.1| dynein light chain 2, cytoplasmic [Mus musculus]
 ref|NP_001161944.1| dynein light chain 2, cytoplasmic [Mus musculus]
 ref|NP_001165079.1| dynein, light chain, LC8-type 2 [Xenopus (Silurana) tropicalis]
 ref|NP_001229550.1| dynein light chain 2, cytoplasmic [Pan troglodytes]
 ref|NP_001289085.1| dynein light chain 2, cytoplasmic [Gallus gallus]
 ref|XP_537691.2| PREDICTED: dynein light chain 2, cytoplasmic isoformX1 [Canis 
lupus familiaris]
 ref|XP_866856.1| PREDICTED: dynein light chain 2, cytoplasmic isoformX3 [Canis 
lupus familiaris]
 ref|XP_866905.1| PREDICTED: dynein light chain 2, cytoplasmic isoformX8 [Canis 
lupus familiaris]
 ref|XP_002199546.1| PREDICTED: dynein light chain 2, cytoplasmic [Taeniopygia guttata]
 ref|XP_003131683.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Sus scrofa]
 ref|XP_003211903.1| PREDICTED: dynein light chain 2, cytoplasmic [Meleagris gallopavo]
 ref|XP_003229879.1| PREDICTED: dynein light chain 2, cytoplasmic [Anolis carolinensis]
 ref|XP_003414646.1| PREDICTED: dynein light chain 2, cytoplasmic [Loxodonta africana]
 ref|XP_001519193.2| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Ornithorhynchus 
anatinus]
 ref|XP_003466866.1| PREDICTED: dynein light chain 2, cytoplasmic [Cavia porcellus]
 ref|XP_003498244.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform 1 [Cricetulus 
griseus]
 ref|XP_003768003.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Sarcophilus 
harrisii]
 ref|XP_002827393.2| PREDICTED: dynein light chain 2, cytoplasmic [Pongo abelii]
 ref|XP_003817442.1| PREDICTED: dynein light chain 2, cytoplasmic [Pan paniscus]
 ref|XP_003912849.1| PREDICTED: dynein light chain 2, cytoplasmic [Papio anubis]
 ref|XP_004012440.1| PREDICTED: dynein light chain 2, cytoplasmic [Ovis aries]
 ref|XP_004041315.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004041316.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004271826.1| PREDICTED: dynein light chain 2, cytoplasmic [Orcinus orca]
 ref|XP_004323804.1| PREDICTED: dynein light chain 2, cytoplasmic [Tursiops truncatus]
 ref|XP_004377947.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 2 [Trichechus 
manatus latirostris]
 ref|XP_004405259.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 3 [Odobenus 
rosmarus divergens]
 ref|XP_004405260.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 4 [Odobenus 
rosmarus divergens]
 ref|XP_004405261.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 5 [Odobenus 
rosmarus divergens]
 ref|XP_004405262.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 6 [Odobenus 
rosmarus divergens]
 ref|XP_004405263.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 7 [Odobenus 
rosmarus divergens]
 ref|XP_004434821.1| PREDICTED: dynein light chain 2, cytoplasmic isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004461355.1| PREDICTED: dynein light chain 2, cytoplasmic [Dasypus novemcinctus]
 ref|XP_004591049.1| PREDICTED: dynein light chain 2, cytoplasmic [Ochotona princeps]
 ref|XP_004608695.1| PREDICTED: dynein light chain 2, cytoplasmic [Sorex araneus]
 ref|XP_004670024.1| PREDICTED: dynein light chain 2, cytoplasmic [Jaculus jaculus]
 ref|XP_004707082.1| PREDICTED: dynein light chain 2, cytoplasmic [Echinops telfairi]
 ref|XP_004645324.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Octodon degus]
 ref|XP_004645325.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Octodon degus]
 ref|XP_004684466.1| PREDICTED: dynein light chain 2, cytoplasmic [Condylura cristata]
 ref|XP_004747382.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Mustela 
putorius furo]
 ref|XP_004747383.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Mustela 
putorius furo]
 ref|XP_004747384.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X4 [Mustela 
putorius furo]
 ref|XP_004798760.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Mustela 
putorius furo]
 ref|XP_004798761.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Mustela 
putorius furo]
 ref|XP_004798762.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X4 [Mustela 
putorius furo]
 ref|XP_004798763.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X5 [Mustela 
putorius furo]
 ref|XP_004859872.1| PREDICTED: dynein light chain 2, cytoplasmic [Heterocephalus 
glaber]
 ref|XP_005056647.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Ficedula 
albicollis]
 ref|XP_005056648.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Ficedula 
albicollis]
 ref|XP_005219978.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Bos 
taurus]
 ref|XP_005298898.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Chrysemys 
picta bellii]
 ref|XP_005350559.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Microtus 
ochrogaster]
 ref|XP_005350560.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Microtus 
ochrogaster]
 ref|XP_005321649.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005321650.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005394097.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Chinchilla 
lanigera]
 ref|XP_005525728.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Pseudopodoces 
humilis]
 ref|XP_005503303.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Columba 
livia]
 ref|XP_005583872.1| PREDICTED: dynein light chain 2, cytoplasmic [Macaca fascicularis]
 ref|XP_005597565.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Equus 
caballus]
 ref|XP_005624776.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X11 [Canis 
lupus familiaris]
 ref|XP_005669028.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Sus scrofa]
 ref|XP_005693153.1| PREDICTED: dynein light chain 2, cytoplasmic [Capra hircus]
 ref|XP_005872588.1| PREDICTED: dynein light chain 2, cytoplasmic [Myotis brandtii]
 ref|XP_005911464.1| PREDICTED: dynein light chain 2, cytoplasmic [Bos mutus]
 ref|XP_005962494.1| PREDICTED: dynein light chain 2, cytoplasmic [Pantholops hodgsonii]
 ref|XP_006016138.1| PREDICTED: dynein light chain 2, cytoplasmic [Alligator sinensis]
 ref|XP_006095671.1| PREDICTED: dynein light chain 2, cytoplasmic [Myotis lucifugus]
 ref|XP_006181469.1| PREDICTED: dynein light chain 2, cytoplasmic [Camelus ferus]
 ref|XP_006216469.1| PREDICTED: dynein light chain 2, cytoplasmic [Vicugna pacos]
 ref|XP_006154721.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X4 [Tupaia 
chinensis]
 ref|XP_006276531.1| PREDICTED: dynein light chain 2, cytoplasmic [Alligator mississippiensis]
 ref|XP_006247139.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Rattus 
norvegicus]
 ref|XP_006640976.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Lepisosteus 
oculatus]
 ref|XP_006756274.1| PREDICTED: dynein light chain 2, cytoplasmic [Myotis davidii]
 ref|XP_006750328.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Leptonychotes 
weddellii]
 ref|XP_006750329.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Leptonychotes 
weddellii]
 ref|XP_006750330.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X4 [Leptonychotes 
weddellii]
 ref|XP_006750331.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X5 [Leptonychotes 
weddellii]
 ref|XP_006750332.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X6 [Leptonychotes 
weddellii]
 ref|XP_006889312.1| PREDICTED: dynein light chain 2, cytoplasmic [Elephantulus edwardii]
 ref|XP_006832458.1| PREDICTED: dynein light chain 2, cytoplasmic [Chrysochloris asiatica]
 ref|XP_006924930.1| PREDICTED: dynein light chain 2, cytoplasmic [Pteropus alecto]
 ref|XP_006972098.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Peromyscus 
maniculatus bairdii]
 ref|XP_006972099.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Peromyscus 
maniculatus bairdii]
 ref|XP_007057670.1| PREDICTED: dynein light chain 2, cytoplasmic [Chelonia mydas]
 ref|XP_006076300.1| PREDICTED: dynein light chain 2, cytoplasmic [Bubalus bubalis]
 ref|XP_007426898.1| PREDICTED: dynein light chain 2, cytoplasmic [Python bivittatus]
 ref|XP_007463949.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Lipotes 
vexillifer]
 ref|XP_007463950.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Lipotes 
vexillifer]
 ref|XP_007481889.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Monodelphis 
domestica]
 ref|XP_007481890.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Monodelphis 
domestica]
 ref|XP_007539040.1| PREDICTED: dynein light chain 2, cytoplasmic [Erinaceus europaeus]
 ref|XP_007663447.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Ornithorhynchus 
anatinus]
 ref|XP_007632383.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Cricetulus 
griseus]
 ref|XP_007632384.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Cricetulus 
griseus]
 ref|XP_007947824.1| PREDICTED: dynein light chain 2, cytoplasmic [Orycteropus afer 
afer]
 ref|XP_008009526.1| PREDICTED: dynein light chain 2, cytoplasmic [Chlorocebus sabaeus]
 ref|XP_008145954.1| PREDICTED: dynein light chain 2, cytoplasmic [Eptesicus fuscus]
 ref|XP_008269469.1| PREDICTED: dynein light chain 2, cytoplasmic [Oryctolagus cuniculus]
 ref|XP_008511063.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Equus 
przewalskii]
 ref|XP_008587117.1| PREDICTED: dynein light chain 2, cytoplasmic [Galeopterus variegatus]
 ref|XP_008766162.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Rattus 
norvegicus]
 ref|XP_008840933.1| PREDICTED: dynein light chain 2, cytoplasmic [Nannospalax galili]
 ref|XP_009188598.1| PREDICTED: dynein light chain 2, cytoplasmic [Papio anubis]
 ref|XP_010120322.1| PREDICTED: dynein light chain 2, cytoplasmic [Chlamydotis macqueenii]
 ref|XP_010219404.1| PREDICTED: dynein light chain 2, cytoplasmic [Tinamus guttatus]
 ref|XP_010371223.1| PREDICTED: dynein light chain 2, cytoplasmic [Rhinopithecus roxellana]
 ref|XP_010572125.1| PREDICTED: dynein light chain 2, cytoplasmic [Haliaeetus leucocephalus]
 ref|XP_010572126.1| PREDICTED: dynein light chain 2, cytoplasmic [Haliaeetus leucocephalus]
 ref|XP_010618542.1| PREDICTED: dynein light chain 2, cytoplasmic [Fukomys damarensis]
 ref|XP_010859958.1| PREDICTED: dynein light chain 2, cytoplasmic [Bison bison bison]
 ref|XP_010949376.1| PREDICTED: dynein light chain 2, cytoplasmic [Camelus bactrianus]
 ref|XP_010988694.1| PREDICTED: dynein light chain 2, cytoplasmic [Camelus dromedarius]
 ref|XP_011218563.1| PREDICTED: dynein light chain 2, cytoplasmic [Ailuropoda melanoleuca]
 ref|XP_011287412.1| PREDICTED: dynein light chain 2, cytoplasmic [Felis catus]
 ref|XP_011373398.1| PREDICTED: dynein light chain 2, cytoplasmic [Pteropus vampyrus]
 sp|Q78P75.1|DYL2_RAT RecName: Full=Dynein light chain 2, cytoplasmic; AltName: Full=Dynein 
light chain LC8-type 2 [Rattus norvegicus]
 sp|Q96FJ2.1|DYL2_HUMAN RecName: Full=Dynein light chain 2, cytoplasmic; AltName: Full=8 
kDa dynein light chain b; Short=DLC8b; AltName: Full=Dynein 
light chain LC8-type 2 [Homo sapiens]
 sp|Q9D0M5.1|DYL2_MOUSE RecName: Full=Dynein light chain 2, cytoplasmic; AltName: Full=8 
kDa dynein light chain b; Short=DLC8; Short=DLC8b; AltName: 
Full=Dynein light chain LC8-type 2 [Mus musculus]
 sp|Q3MHR3.1|DYL2_BOVIN RecName: Full=Dynein light chain 2, cytoplasmic [Bos taurus]
 pdb|1PWJ|A Chain A, Structure Of The Monomeric 8-Kda Dynein Light Chain 
And Mechanism Of Domain Swapped Dimer Assembly
 pdb|2XQQ|A Chain A, Human Dynein Light Chain (dynll2) In Complex With An 
In Vitro Evolved Peptide (ac-srgtqte).
 pdb|2XQQ|B Chain B, Human Dynein Light Chain (dynll2) In Complex With An 
In Vitro Evolved Peptide (ac-srgtqte).
 pdb|2XQQ|C Chain C, Human Dynein Light Chain (dynll2) In Complex With An 
In Vitro Evolved Peptide (ac-srgtqte).
 pdb|2XQQ|D Chain D, Human Dynein Light Chain (dynll2) In Complex With An 
In Vitro Evolved Peptide (ac-srgtqte).
 gb|AAP97230.1|AF112997_1 protein inhibitor of neuronal nitric oxide synthase [Homo sapiens]
 dbj|BAB27516.1| unnamed protein product [Mus musculus]
 gb|AAK57536.1| dynein light chain-2 [Rattus norvegicus]
 gb|AAH10744.1| Dynein, light chain, LC8-type 2 [Homo sapiens]
 gb|AAH11289.1| Dynein light chain LC8-type 2 [Mus musculus]
 gb|AAK38749.1| dynein light chain 2 [Mus musculus]
 gb|AAH40822.1| Dynein light chain LC8-type 2 [Mus musculus]
 dbj|BAC33856.1| unnamed protein product [Mus musculus]
 dbj|BAC37271.1| unnamed protein product [Mus musculus]
 dbj|BAC25877.1| unnamed protein product [Mus musculus]
 gb|AAH61874.1| Dynein light chain LC8-type 2 [Rattus norvegicus]
 gb|AAH88794.1| Dynll2 protein [Xenopus laevis]
 dbj|BAE40984.1| unnamed protein product [Mus musculus]
 dbj|BAE35638.1| unnamed protein product [Mus musculus]
 gb|AAI05141.1| DYNLL2 protein [Bos taurus]
 gb|ABF47136.1| dynein light chain dlc8b [Xenopus laevis]
 gb|EAW94484.1| dynein, light chain, LC8-type 2, isoform CRA_b [Homo sapiens]
 gb|EDL15838.1| dynein light chain LC8-type 2, isoform CRA_a [Mus musculus]
 gb|EDL15839.1| dynein light chain LC8-type 2, isoform CRA_a [Mus musculus]
 gb|EDL15840.1| dynein light chain LC8-type 2, isoform CRA_a [Mus musculus]
 gb|EDM05620.1| dynein light chain LC8-type 2, isoform CRA_b [Rattus norvegicus]
 gb|EDM05621.1| dynein light chain LC8-type 2, isoform CRA_b [Rattus norvegicus]
 gb|AAI58330.1| dynll2 protein [Xenopus (Silurana) tropicalis]
 dbj|BAG35061.1| unnamed protein product [Homo sapiens]
 gb|ACO51636.1| Dynein light chain 2, cytoplasmic [Rana catesbeiana]
 gb|EFB18594.1| hypothetical protein PANDA_003680 [Ailuropoda melanoleuca]
 tpg|DAA19171.1| TPA: dynein light chain 2, cytoplasmic [Bos taurus]
 gb|EGV99587.1| Dynein light chain 2, cytoplasmic [Cricetulus griseus]
 gb|EHB16281.1| Dynein light chain 2, cytoplasmic [Heterocephalus glaber]
 gb|ELK01708.1| Dynein light chain 2, cytoplasmic [Pteropus alecto]
 gb|ELK35930.1| Dynein light chain 2, cytoplasmic [Myotis davidii]
 gb|ELR44666.1| Dynein light chain 2, cytoplasmic [Bos mutus]
 gb|EMP37700.1| Dynein light chain 2, cytoplasmic, partial [Chelonia mydas]
 gb|EPQ11626.1| Dynein light chain 2, cytoplasmic [Myotis brandtii]
 gb|AIC53133.1| DYNLL2, partial [synthetic construct]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_005012658.1| PREDICTED: dynein light chain 2, cytoplasmic [Anas platyrhynchos]
 ref|XP_005233750.1| PREDICTED: dynein light chain 2, cytoplasmic [Falco peregrinus]
 ref|XP_005439754.1| PREDICTED: dynein light chain 2, cytoplasmic [Falco cherrug]
 ref|XP_005492031.1| PREDICTED: dynein light chain 2, cytoplasmic [Zonotrichia albicollis]
 ref|XP_005424439.1| PREDICTED: dynein light chain 2, cytoplasmic [Geospiza fortis]
 ref|XP_005525727.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Pseudopodoces 
humilis]
 ref|XP_005503302.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Columba 
livia]
 ref|XP_008489468.1| PREDICTED: dynein light chain 2, cytoplasmic [Calypte anna]
 ref|XP_008629297.1| PREDICTED: dynein light chain 2, cytoplasmic [Corvus brachyrhynchos]
 ref|XP_008925918.1| PREDICTED: dynein light chain 2, cytoplasmic [Manacus vitellinus]
 ref|XP_009071944.1| PREDICTED: dynein light chain 2, cytoplasmic [Acanthisitta chloris]
 ref|XP_009093084.1| PREDICTED: dynein light chain 2, cytoplasmic [Serinus canaria]
 ref|XP_009276526.1| PREDICTED: dynein light chain 2, cytoplasmic [Aptenodytes forsteri]
 ref|XP_009327372.1| PREDICTED: dynein light chain 2, cytoplasmic [Pygoscelis adeliae]
 ref|XP_009485398.1| PREDICTED: dynein light chain 2, cytoplasmic [Pelecanus crispus]
 ref|XP_009467438.1| PREDICTED: dynein light chain 2, cytoplasmic [Nipponia nippon]
 ref|XP_009508510.1| PREDICTED: dynein light chain 2, cytoplasmic [Phalacrocorax carbo]
 ref|XP_009565695.1| PREDICTED: dynein light chain 2, cytoplasmic [Cuculus canorus]
 ref|XP_009585276.1| PREDICTED: dynein light chain 2, cytoplasmic [Fulmarus glacialis]
 ref|XP_009688690.1| PREDICTED: dynein light chain 2, cytoplasmic [Struthio camelus 
australis]
 ref|XP_009632196.1| PREDICTED: dynein light chain 2, cytoplasmic [Egretta garzetta]
 ref|XP_009693210.1| PREDICTED: dynein light chain 2, cytoplasmic [Cariama cristata]
 ref|XP_009814175.1| PREDICTED: dynein light chain 2, cytoplasmic [Gavia stellata]
 ref|XP_009877379.1| PREDICTED: dynein light chain 2, cytoplasmic [Apaloderma vittatum]
 ref|XP_009879758.1| PREDICTED: dynein light chain 2, cytoplasmic [Charadrius vociferus]
 ref|XP_009907171.1| PREDICTED: dynein light chain 2, cytoplasmic [Picoides pubescens]
 ref|XP_009923259.1| PREDICTED: dynein light chain 2, cytoplasmic [Haliaeetus albicilla]
 ref|XP_009931302.1| PREDICTED: dynein light chain 2, cytoplasmic [Opisthocomus hoazin]
 ref|XP_009956129.1| PREDICTED: dynein light chain 2, cytoplasmic [Leptosomus discolor]
 ref|XP_010020345.1| PREDICTED: dynein light chain 2, cytoplasmic [Nestor notabilis]
 ref|XP_010007339.1| PREDICTED: dynein light chain 2, cytoplasmic [Chaetura pelagica]
 ref|XP_009964056.1| PREDICTED: dynein light chain 2, cytoplasmic [Tyto alba]
 ref|XP_009988915.1| PREDICTED: dynein light chain 2, cytoplasmic [Tauraco erythrolophus]
 ref|XP_010134326.1| PREDICTED: dynein light chain 2, cytoplasmic [Buceros rhinoceros 
silvestris]
 ref|XP_010148800.1| PREDICTED: dynein light chain 2, cytoplasmic [Eurypyga helias]
 ref|XP_010166159.1| PREDICTED: dynein light chain 2, cytoplasmic [Caprimulgus carolinensis]
 ref|XP_010075914.1| PREDICTED: dynein light chain 2, cytoplasmic [Pterocles gutturalis]
 ref|XP_010178046.1| PREDICTED: dynein light chain 2, cytoplasmic [Mesitornis unicolor]
 ref|XP_010204449.1| PREDICTED: dynein light chain 2, cytoplasmic [Colius striatus]
 ref|XP_010288452.1| PREDICTED: dynein light chain 2, cytoplasmic [Phaethon lepturus]
 ref|XP_010309509.1| PREDICTED: dynein light chain 2, cytoplasmic [Balearica regulorum 
gibbericeps]
 ref|XP_010400592.1| PREDICTED: dynein light chain 2, cytoplasmic [Corvus cornix cornix]
 gb|EMC88985.1| Dynein light chain 2, cytoplasmic [Columba livia]
Length=96

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  11   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  70

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  71   SYVTHETKHFIYFYLGQVAILLFKSG  96



>ref|NP_956393.1| dynein, light chain, LC8-type 2a [Danio rerio]
 ref|NP_001025171.1| dynein, light chain, LC8-type 2b [Danio rerio]
 ref|NP_001135077.1| Dynein light chain 2, cytoplasmic [Salmo salar]
 ref|XP_003440174.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Oreochromis 
niloticus]
 ref|XP_004558250.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Maylandia 
zebra]
 ref|XP_005739453.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Pundamilia 
nyererei]
 ref|XP_005811020.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Xiphophorus 
maculatus]
 ref|XP_005932110.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Haplochromis 
burtoni]
 ref|XP_006801591.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Neolamprologus 
brichardi]
 ref|XP_007248692.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Astyanax mexicanus]
 ref|XP_007248693.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Astyanax mexicanus]
 ref|XP_007259664.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Astyanax mexicanus]
 ref|XP_007567423.1| PREDICTED: dynein light chain 2, cytoplasmic [Poecilia formosa]
 ref|XP_008287289.1| PREDICTED: dynein light chain 2, cytoplasmic [Stegastes partitus]
 ref|XP_008287290.1| PREDICTED: dynein light chain 2, cytoplasmic [Stegastes partitus]
 ref|XP_008423150.1| PREDICTED: dynein light chain 2, cytoplasmic [Poecilia reticulata]
 ref|XP_010734954.1| PREDICTED: dynein light chain 2, cytoplasmic [Larimichthys crocea]
 ref|XP_010734955.1| PREDICTED: dynein light chain 2, cytoplasmic [Larimichthys crocea]
 ref|XP_010772231.1| PREDICTED: dynein light chain 2, cytoplasmic [Notothenia coriiceps]
 ref|XP_010891280.1| PREDICTED: dynein light chain 2, cytoplasmic [Esox lucius]
 ref|XP_010891363.1| PREDICTED: dynein light chain 2, cytoplasmic [Esox lucius]
 ref|XP_010863989.1| PREDICTED: dynein light chain 2, cytoplasmic [Esox lucius]
 emb|CAG08960.1| unnamed protein product [Tetraodon nigroviridis]
 gb|AAH90543.1| Dynein light chain 2, like [Danio rerio]
 gb|AAI39655.1| Dynein light chain 2 [Danio rerio]
 gb|AAI53626.1| Dnl2l protein [Danio rerio]
 gb|AAI64433.1| Dnl2l protein [Danio rerio]
 gb|ACI70121.1| Dynein light chain 2, cytoplasmic [Salmo salar]
 gb|AGH92525.1| dynein light chain 2 [Salmo salar]
 emb|CDQ95920.1| unnamed protein product [Oncorhynchus mykiss]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_007663446.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X1 [Ornithorhynchus 
anatinus]
Length=112

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/92 (68%), Positives = 77/92 (84%), Gaps = 1/92 (1%)
 Frame = +3

Query  198  SITVS-KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCI  374
            S T+S +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCI
Sbjct  21   SCTMSDRKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCI  80

Query  375  VGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            VG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  81   VGRNFGSYVTHETKHFIYFYLGQVAILLFKSG  112



>gb|KFQ26531.1| Dynein light chain 2, cytoplasmic, partial [Merops nubicus]
Length=91

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  6    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  65

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  66   SYVTHETKHFIYFYLGQVAILLFKSG  91



>ref|XP_001702907.1| outer dynein arm light chain 8 [Chlamydomonas reinhardtii]
 sp|Q39580.1|DYL1_CHLRE RecName: Full=Dynein 8 kDa light chain, flagellar outer arm [Chlamydomonas 
reinhardtii]
 gb|AAA80586.1| 8 kDa outer arm dynein light chain [Chlamydomonas reinhardtii]
 gb|ABA01119.1| dynein light chain 8 kDa outer arm [Chlamydomonas incerta]
 gb|EDO96760.1| outer dynein arm light chain 8 [Chlamydomonas reinhardtii]
Length=91

 Score =   138 bits (348),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            S K +IK+ADM ++MQ +AVD A  A EK N+EKD+A +IKKEFD+KH PTWHCIVG+NF
Sbjct  5    SSKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDRKHNPTWHCIVGRNF  64

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   GSYVTHETKHFIYFYLGQVAILLFKSG  91



>ref|XP_002946897.1| outer dynein arm light chain 8, 8 kD [Volvox carteri f. nagariensis]
 gb|EFJ52123.1| outer dynein arm light chain 8, 8 kD [Volvox carteri f. nagariensis]
Length=91

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            S K +IK+ADM ++MQ +AVD A  A EK N+EKD+A +IKKEFD+KH PTWHCIVG+NF
Sbjct  5    SSKAVIKNADMSEEMQADAVDCATCALEKYNIEKDIAAYIKKEFDRKHNPTWHCIVGRNF  64

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   GSYVTHETKHFIYFYLGQVAILLFKSG  91



>ref|XP_003740759.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Metaseiulus 
occidentalis]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVDIA  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDIATQALEKYNIEKDIAAFIKKEFDKKYSPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_004946822.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X3 [Gallus 
gallus]
Length=110

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  25   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  84

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  85   SYVTHETKHFIYFYLGQVAILLFKSG  110



>ref|XP_002602246.1| hypothetical protein BRAFLDRAFT_114344 [Branchiostoma floridae]
 gb|EEN58258.1| hypothetical protein BRAFLDRAFT_114344 [Branchiostoma floridae]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ+++VD A  A EK N+EKDVA +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDSVDCATQAMEKYNIEKDVAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>ref|XP_009042037.1| dynein light chain protein 1 [Aureococcus anophagefferens]
 gb|EGB03276.1| dynein light chain protein 1 [Aureococcus anophagefferens]
Length=88

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            + +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+N
Sbjct  1    MERKAVIKNADMSEDMQQDAVDCASQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRN  60

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   FGSYVTHETKHFIYFYLGQVAILLFKSG  88



>ref|XP_004706475.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Echinops telfairi]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ AI A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVECAIQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|AAH56312.2| Dnl2 protein, partial [Danio rerio]
Length=115

 Score =   139 bits (349),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  30   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  89

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  90   SYVTHETKHFIYFYLGQVAILLFKSG  115



>ref|XP_001897484.1| Dynein light chain 1, cytoplasmic [Brugia malayi]
 ref|XP_003142990.1| neuronal nitric oxidse synthase inhibitor [Loa loa]
 gb|EFO21076.1| dynein light chain 2 [Loa loa]
 gb|EJW83189.1| dynein light chain 1 [Wuchereria bancrofti]
 gb|ERG86310.1| dynein light chain cytoplasmic [Ascaris suum]
 emb|CDP93308.1| Protein BM-DLC-1 [Brugia malayi]
 gb|KHN74977.1| Dynein light chain 2, cytoplasmic [Toxocara canis]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_795719.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Strongylocentrotus 
purpuratus]
 sp|O02414.1|DYL1_HELCR RecName: Full=Dynein light chain LC6, flagellar outer arm [Heliocidaris 
crassispina]
 dbj|BAA20525.1| outer arm dynein LC6 [Heliocidaris crassispina]
Length=89

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMPEDMQQDAVDCATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>pdb|4QH7|A Chain A, Lc8 - Ana2 (159-168) Complex
 pdb|4QH7|B Chain B, Lc8 - Ana2 (159-168) Complex
 pdb|4QH7|E Chain E, Lc8 - Ana2 (159-168) Complex
 pdb|4QH7|F Chain F, Lc8 - Ana2 (159-168) Complex
 pdb|4QH8|A Chain A, Lc8 - Ana2 (237-246) Complex
 pdb|4QH8|B Chain B, Lc8 - Ana2 (237-246) Complex
 pdb|4QH8|E Chain E, Lc8 - Ana2 (237-246) Complex
 pdb|4QH8|F Chain F, Lc8 - Ana2 (237-246) Complex
 pdb|4QH8|G Chain G, Lc8 - Ana2 (237-246) Complex
 pdb|4QH8|H Chain H, Lc8 - Ana2 (237-246) Complex
Length=94

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 61/94 (65%), Positives = 77/94 (82%), Gaps = 1/94 (1%)
 Frame = +3

Query  189  PASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWH  368
            P  S++  +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWH
Sbjct  2    PLGSMS-DRKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWH  60

Query  369  CIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            CIVG+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   CIVGRNFGSYVTHETRHFIYFYLGQVAILLFKSG  94



>pdb|3P8M|A Chain A, Human Dynein Light Chain (Dynll2) In Complex With An 
In Vitro Evolved Peptide Dimerized By Leucine Zipper
 pdb|3P8M|B Chain B, Human Dynein Light Chain (Dynll2) In Complex With An 
In Vitro Evolved Peptide Dimerized By Leucine Zipper
 pdb|4D07|A Chain A, Dynll2 Dynein Light Chain Binds To An Extended, Unstructured 
Linear Motif Of Myosin 5a Tail
Length=92

 Score =   138 bits (347),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  7    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  66

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  67   SYVTHETKHFIYFYLGQVAILLFKSG  92



>gb|EJY68452.1| hypothetical protein OXYTRI_10934 [Oxytricha trifallax]
 gb|EJY69116.1| hypothetical protein OXYTRI_10265 [Oxytricha trifallax]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K ++K+ADM +DMQ++A+DIA  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVVKNADMSEDMQQDAIDIATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SY+THET HF+YFYL   AVLLFKSG
Sbjct  64   SYITHETKHFIYFYLGQVAVLLFKSG  89



>ref|XP_002507507.1| flagellar outer dynein arm light chain 8 [Micromonas sp. RCC299]
 gb|ACO68765.1| flagellar outer dynein arm light chain 8 [Micromonas sp. RCC299]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>ref|XP_005777809.1| hypothetical protein EMIHUDRAFT_367415 [Emiliania huxleyi CCMP1516]
 ref|XP_005780468.1| dynein light chain [Emiliania huxleyi CCMP1516]
 gb|EOD25380.1| hypothetical protein EMIHUDRAFT_367415 [Emiliania huxleyi CCMP1516]
 gb|EOD28039.1| dynein light chain [Emiliania huxleyi CCMP1516]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDLAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>emb|CDQ58993.1| unnamed protein product [Oncorhynchus mykiss]
Length=107

 Score =   138 bits (348),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  22   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  81

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  82   SYVTHETKHFIYFYLGQVAILLFKSG  107



>emb|CBY18296.1| unnamed protein product [Oikopleura dioica]
 emb|CBY34746.1| unnamed protein product [Oikopleura dioica]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ +AV+ A  A EK N+EKD+A  IKKEFDKK+GPTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQTDAVECATQALEKYNIEKDIAAFIKKEFDKKYGPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|EFA05576.1| hypothetical protein TcasGA2_TC015765 [Tribolium castaneum]
Length=157

 Score =   140 bits (352),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  72   RKAVIKNADMSEDMQQDAVDCATQAIEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  131

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  132  SYVTHETRHFIYFYLGQVAILLFKSG  157



>gb|AAI22095.1| Dnl2 protein [Danio rerio]
Length=125

 Score =   139 bits (349),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  40   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  99

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  100  SYVTHETKHFIYFYLGQVAILLFKSG  125



>ref|XP_009167363.1| hypothetical protein T265_04378 [Opisthorchis viverrini]
 gb|KER28922.1| hypothetical protein T265_04378 [Opisthorchis viverrini]
Length=91

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            S+K ++K+ADM ++MQ++A+++A  AFEK N+EKD+A HIKKEFDKKH PTWHC+VG+N+
Sbjct  5    SRKAVVKNADMSEEMQQDAIEVATHAFEKFNIEKDIAAHIKKEFDKKHSPTWHCVVGRNY  64

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFY    A+LLFKSG
Sbjct  65   GSYVTHETKHFIYFYAGQVAILLFKSG  91



>ref|XP_006220091.1| PREDICTED: dynein light chain 2, cytoplasmic-like, partial [Vicugna 
pacos]
Length=90

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  5    RKAVIKNADMSEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  64

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  65   SYVTHETKHFIYFYLGQVAILLFKSG  90



>gb|ACO10102.1| Dynein light chain 2, cytoplasmic [Osmerus mordax]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_003705084.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Megachile 
rotundata]
Length=89

 Score =   137 bits (346),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_001775138.1| predicted protein [Physcomitrella patens]
 gb|EDQ59999.1| predicted protein [Physcomitrella patens]
Length=99

 Score =   138 bits (347),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            + +K IIK+ADM +DMQ++A++ A +A +K NVEKD+A +IKKEFDKK+ PTWHC+VG+N
Sbjct  12   LERKAIIKNADMTEDMQQDAIECATAALDKYNVEKDIAAYIKKEFDKKYNPTWHCVVGRN  71

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HFVYFYL   AVLLFKSG
Sbjct  72   FGSYVTHETRHFVYFYLGQVAVLLFKSG  99



>ref|XP_002140822.1| dynein light chain 1 protein [Cryptosporidium muris RN66]
 gb|EEA06473.1| dynein light chain 1 protein, putative [Cryptosporidium muris 
RN66]
Length=89

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM DDMQ++A+  A +A E++NVEKD+A +IKKEFD+K+ PTWHC+VG+NFG
Sbjct  4    KKAVIKNADMSDDMQQDAISCAAAALERHNVEKDIAAYIKKEFDRKYNPTWHCVVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFY+   AVLLFKSG
Sbjct  64   SYVTHETRHFIYFYMGQVAVLLFKSG  89



>ref|XP_003726638.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Strongylocentrotus 
purpuratus]
Length=89

 Score =   137 bits (346),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM D+MQ++A++ A  + EK N+EKD+A HIKKEFDKKH PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMTDEMQRDAIECANQSMEKFNIEKDIAAHIKKEFDKKHNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>tpg|DAA34424.1| TPA_exp: dynein light chain [Amblyomma variegatum]
Length=85

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +3

Query  216  KVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGS  395
            K +IK+ADM ++MQ++AVD+A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFGS
Sbjct  1    KAVIKNADMSEEMQQDAVDVATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFGS  60

Query  396  YVTHETNHFVYFYLDSKAVLLFKSG  470
            YVTHET HF+YFYL   A+LLFKSG
Sbjct  61   YVTHETKHFIYFYLGQVAILLFKSG  85



>gb|AAI15161.1| Dnl2 protein, partial [Danio rerio]
Length=126

 Score =   139 bits (349),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  41   RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  100

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  101  SYVTHETKHFIYFYLGQVAILLFKSG  126



>ref|XP_011315479.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Fopius 
arisanus]
 ref|XP_011315488.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Fopius 
arisanus]
Length=89

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|NP_525075.1| cut up, isoform A [Drosophila melanogaster]
 ref|NP_726942.1| cut up, isoform B [Drosophila melanogaster]
 ref|NP_726943.1| cut up, isoform C [Drosophila melanogaster]
 ref|NP_001177683.1| dynein light chain A [Nasonia vitripennis]
 ref|NP_001245530.1| cut up, isoform E [Drosophila melanogaster]
 ref|XP_001947701.1| PREDICTED: dynein light chain 1, cytoplasmic [Acyrthosiphon pisum]
 ref|XP_001976907.1| GG18720 [Drosophila erecta]
 ref|XP_001988887.1| GH11410 [Drosophila grimshawi]
 ref|XP_002001895.1| GI14563 [Drosophila mojavensis]
 ref|XP_002036984.1| GM12359 [Drosophila sechellia]
 ref|XP_002051712.1| GJ17036 [Drosophila virilis]
 ref|XP_002064919.1| GK15188 [Drosophila willistoni]
 ref|XP_002100074.1| ctp [Drosophila yakuba]
 ref|XP_002134258.1| GA25980 [Drosophila pseudoobscura pseudoobscura]
 ref|XP_003248689.1| PREDICTED: dynein light chain 1, cytoplasmic [Acyrthosiphon pisum]
 ref|XP_004530512.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Ceratitis capitata]
 ref|XP_004530513.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X2 
[Ceratitis capitata]
 ref|XP_004530514.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X3 
[Ceratitis capitata]
 ref|XP_008470477.1| PREDICTED: dynein light chain 1, cytoplasmic [Diaphorina citri]
 ref|XP_008470478.1| PREDICTED: dynein light chain 1, cytoplasmic [Diaphorina citri]
 ref|XP_008470479.1| PREDICTED: dynein light chain 1, cytoplasmic [Diaphorina citri]
 ref|XP_008470480.1| PREDICTED: dynein light chain 1, cytoplasmic [Diaphorina citri]
 ref|XP_008470482.1| PREDICTED: dynein light chain 1, cytoplasmic [Diaphorina citri]
 ref|XP_011142106.1| PREDICTED: dynein light chain 1, cytoplasmic [Harpegnathos saltator]
 ref|XP_011188934.1| PREDICTED: dynein light chain 1, cytoplasmic [Bactrocera cucurbitae]
 ref|XP_011188936.1| PREDICTED: dynein light chain 1, cytoplasmic [Bactrocera cucurbitae]
 ref|XP_011212117.1| PREDICTED: dynein light chain 1, cytoplasmic [Bactrocera dorsalis]
 sp|Q24117.1|DYL1_DROME RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=8 
kDa dynein light chain; AltName: Full=Cut up protein [Drosophila 
melanogaster]
 pdb|1RHW|A Chain A, The Solution Structure Of The Ph-Induced Monomer Of 
Dynein Light Chain Lc8 From Drosophila
 pdb|2P2T|A Chain A, Crystal Structure Of Dynein Light Chain Lc8 Bound To 
Residues 123-138 Of Intermediate Chain Ic74
 pdb|3E2B|A Chain A, Crystal Structure Of Dynein Light Chain Lc8 In Complex 
With A Peptide Derived From Swallow
 pdb|3BRI|A Chain A, Crystal Structure Of Apo-Lc8
 pdb|3FM7|E Chain E, Quaternary Structure Of Drosophila Melanogaster IcTCTEX-1LC8; 
Allosteric Interactions Of Dynein Light Chains With 
Dynein Intermediate Chain
 pdb|3FM7|F Chain F, Quaternary Structure Of Drosophila Melanogaster IcTCTEX-1LC8; 
Allosteric Interactions Of Dynein Light Chains With 
Dynein Intermediate Chain
 pdb|3GLW|A Chain A, Quaternary Structure Of Drosophila Melanogaster IcTCTEX-1LC8; 
Allosteric Interactions Of Dynein Light Chains With 
Dynein Intermediate Chain
 gb|AAB04148.1| cytoplasmic dynein light chain 1 [Drosophila melanogaster]
 gb|AAD00072.1| 8kd dynein light chain [Drosophila melanogaster]
 gb|AAD00074.1| 8kd dynein light chain [Drosophila melanogaster]
 gb|AAF45975.1| cut up, isoform A [Drosophila melanogaster]
 gb|AAN09126.1| cut up, isoform B [Drosophila melanogaster]
 gb|AAN09127.1| cut up, isoform C [Drosophila melanogaster]
 gb|AAR10109.1| similar to Drosophila melanogaster ctp, partial [Drosophila yakuba]
 gb|ABM55544.1| dynein light chain 1, cytoplasmic-like protein [Maconellicoccus 
hirsutus]
 gb|EDV45834.1| GG18720 [Drosophila erecta]
 gb|EDW03754.1| GH11410 [Drosophila grimshawi]
 gb|EDW11337.1| GI14563 [Drosophila mojavensis]
 gb|EDW53143.1| GM12359 [Drosophila sechellia]
 gb|EDW63867.1| GJ17036 [Drosophila virilis]
 gb|EDW75905.1| GK15188 [Drosophila willistoni]
 gb|EDX01182.1| ctp [Drosophila yakuba]
 gb|EDY72885.1| GA25980 [Drosophila pseudoobscura pseudoobscura]
 gb|ACL88484.1| ctp-PA, partial [synthetic construct]
 gb|EFN82799.1| Dynein light chain 1, cytoplasmic [Harpegnathos saltator]
 gb|AFH07244.1| cut up, isoform E [Drosophila melanogaster]
Length=89

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>gb|EFX71839.1| hypothetical protein DAPPUDRAFT_308639 [Daphnia pulex]
Length=89

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_007556385.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Poecilia formosa]
Length=89

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++AVD  + A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    KKAVIKNADMSDEMQQDAVDCTMQAMEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>pdb|2PG1|A Chain A, Structural Analysis Of A Cytoplasmic Dynein Light Chain- 
Intermediate Chain Complex
 pdb|2PG1|B Chain B, Structural Analysis Of A Cytoplasmic Dynein Light Chain- 
Intermediate Chain Complex
 pdb|2PG1|C Chain C, Structural Analysis Of A Cytoplasmic Dynein Light Chain- 
Intermediate Chain Complex
 pdb|2PG1|D Chain D, Structural Analysis Of A Cytoplasmic Dynein Light Chain- 
Intermediate Chain Complex
 pdb|3DVT|A Chain A, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
 pdb|3DVT|B Chain B, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
 pdb|3DVT|C Chain C, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
 pdb|3DVT|D Chain D, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
 pdb|3DVT|E Chain E, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
 pdb|3DVT|F Chain F, Biochemical And Structural Characterization Of The Pak1- 
Lc8 Interaction
Length=91

 Score =   137 bits (345),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  6    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  65

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  66   SYVTHETRHFIYFYLGQVAILLFKSG  91



>gb|AAT09073.1| dynein 8 kDa light chain [Bigelowiella natans]
Length=88

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 75/88 (85%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            +S+K ++K+ADM ++MQ++AVD A +A  K N+EK+VA +IKKEFDK+H PTWHCIVG+N
Sbjct  1    MSRKAVVKNADMSEEMQQDAVDCATTALSKYNIEKEVAAYIKKEFDKRHNPTWHCIVGRN  60

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   FGSYVTHETKHFIYFYLGQVAILLFKSG  88



>ref|XP_004998053.1| dynein light chain 1 [Salpingoeca rosetta]
 gb|EGD79097.1| dynein light chain 1 [Salpingoeca rosetta]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K ++K+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVVKNADMSEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|NP_001243365.1| dynein light chain [Aplysia californica]
 gb|ADX20590.1| dynein light chain [Aplysia californica]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|NP_001232446.1| putative dynein cytoplasmic light peptide variant 2 [Taeniopygia 
guttata]
 ref|NP_001264808.1| dynein, light chain, LC8-type 1 [Gallus gallus]
 ref|XP_005054901.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Ficedula albicollis]
 ref|XP_005147869.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Melopsittacus 
undulatus]
 ref|XP_005233283.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Falco peregrinus]
 ref|XP_005445330.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Falco cherrug]
 ref|XP_005493522.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Zonotrichia 
albicollis]
 ref|XP_005421543.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Geospiza fortis]
 ref|XP_005503973.1| PREDICTED: dynein light chain 1, cytoplasmic [Columba livia]
 ref|XP_008501035.1| PREDICTED: dynein light chain 1, cytoplasmic [Calypte anna]
 ref|XP_008639841.1| PREDICTED: dynein light chain 1, cytoplasmic [Corvus brachyrhynchos]
 ref|XP_008924014.1| PREDICTED: dynein light chain 1, cytoplasmic [Manacus vitellinus]
 ref|XP_009090536.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Serinus canaria]
 ref|XP_009090537.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Serinus canaria]
 ref|XP_009329087.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Pygoscelis 
adeliae]
 ref|XP_009461997.1| PREDICTED: dynein light chain 1, cytoplasmic [Nipponia nippon]
 ref|XP_009564831.1| PREDICTED: dynein light chain 1, cytoplasmic [Cuculus canorus]
 ref|XP_009685774.1| PREDICTED: dynein light chain 1, cytoplasmic [Struthio camelus 
australis]
 ref|XP_009641126.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Egretta garzetta]
 ref|XP_009706300.1| PREDICTED: dynein light chain 1, cytoplasmic [Cariama cristata]
 ref|XP_009908570.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Picoides pubescens]
 ref|XP_009886892.1| PREDICTED: dynein light chain 1, cytoplasmic [Charadrius vociferus]
 ref|XP_009886894.1| PREDICTED: dynein light chain 1, cytoplasmic [Charadrius vociferus]
 ref|XP_009935032.1| PREDICTED: dynein light chain 1, cytoplasmic [Opisthocomus hoazin]
 ref|XP_010003129.1| PREDICTED: dynein light chain 1, cytoplasmic [Chaetura pelagica]
 ref|XP_010153635.1| PREDICTED: dynein light chain 1, cytoplasmic [Eurypyga helias]
 ref|XP_010187096.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Mesitornis 
unicolor]
 ref|XP_010396371.1| PREDICTED: dynein light chain 1, cytoplasmic [Corvus cornix cornix]
 ref|XP_010396372.1| PREDICTED: dynein light chain 1, cytoplasmic [Corvus cornix cornix]
 ref|XP_010718788.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Meleagris 
gallopavo]
 emb|CAH65122.1| hypothetical protein RCJMB04_3n18 [Gallus gallus]
 gb|ACH44851.1| putative dynein cytoplasmic light peptide variant 2 [Taeniopygia 
guttata]
 gb|ACH44852.1| putative dynein cytoplasmic light peptide variant 2 [Taeniopygia 
guttata]
 gb|ACH44853.1| putative dynein cytoplasmic light peptide variant 2 [Taeniopygia 
guttata]
 gb|ACH44854.1| putative dynein cytoplasmic light peptide variant 2 [Taeniopygia 
guttata]
 gb|ACH44860.1| putative dynein cytoplasmic light peptide variant 7 [Taeniopygia 
guttata]
 gb|EMC88644.1| Dynein light chain 1, cytoplasmic [Columba livia]
 gb|EOA96263.1| Dynein light chain 1, cytoplasmic, partial [Anas platyrhynchos]
 gb|KFO70351.1| Dynein light chain 1, cytoplasmic [Cuculus canorus]
 gb|KFP19320.1| Dynein light chain 1, cytoplasmic [Egretta garzetta]
 gb|KFP68882.1| Dynein light chain 1, cytoplasmic [Cariama cristata]
 gb|KFQ24473.1| Dynein light chain 1, cytoplasmic [Mesitornis unicolor]
 gb|KFQ95931.1| Dynein light chain 1, cytoplasmic [Nipponia nippon]
 gb|KFU95070.1| Dynein light chain 1, cytoplasmic [Chaetura pelagica]
 gb|KFV62787.1| Dynein light chain 1, cytoplasmic [Picoides pubescens]
 gb|KFV87775.1| Dynein light chain 1, cytoplasmic [Struthio camelus australis]
 gb|KFV94742.1| Dynein light chain 1, cytoplasmic [Eurypyga helias]
 gb|KFW71939.1| Dynein light chain 1, cytoplasmic [Pygoscelis adeliae]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|NP_001037826.1| dynein light chain 6 [Ciona intestinalis]
 dbj|BAC05522.1| dynein light chain [Ciona savignyi]
 dbj|BAE71140.1| dynein light chain 6 [Ciona intestinalis]
 dbj|BAH59282.1| dynein light chain LC8 [Ciona intestinalis]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCI G+NFG
Sbjct  4    RKAVIKNADMAEDMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCICGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>gb|AAP40019.1| neuronal nitric oxidse synthase protein inhibitor [Epinephelus 
akaara]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_008283113.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Stegastes 
partitus]
 ref|XP_010732554.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Larimichthys 
crocea]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|AGE89243.1| dynein light chain-2 [Pleurobrachia bachei]
Length=89

 Score =   137 bits (345),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMAEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|KFO23768.1| Dynein light chain 1, cytoplasmic [Fukomys damarensis]
Length=144

 Score =   139 bits (349),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 68/134 (51%), Positives = 91/134 (68%), Gaps = 7/134 (5%)
 Frame = +3

Query  87   SPTKTNMSEDSKRNDGGALVAKLPAADDRKSA-----SPPASSITVS-KKVIIKSADMKD  248
            SP+  +  E + R  G  LV  +   + R+       S     +T+  +K +IK+ADM +
Sbjct  12   SPSGRSTEEPAVRV-GAVLVPWIREIERRQCERLMEESRAIVQVTMCDRKAVIKNADMSE  70

Query  249  DMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFGSYVTHETNHFVY  428
            +MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFGSYVTHET HF+Y
Sbjct  71   EMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFGSYVTHETKHFIY  130

Query  429  FYLDSKAVLLFKSG  470
            FYL   A+LLFKSG
Sbjct  131  FYLGQVAILLFKSG  144



>gb|EUB61914.1| Dynein light chain 1, cytoplasmic [Echinococcus granulosus]
 emb|CDS17834.1| dynein light chain [Echinococcus granulosus]
Length=89

 Score =   137 bits (344),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV +A  A EK N+EKD+A +IKKEFDKKH PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVAVAGQALEKFNIEKDIAAYIKKEFDKKHSPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETQHFIYFYLGQVAILLFKSG  89



>ref|XP_008639842.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Corvus brachyrhynchos]
Length=118

 Score =   138 bits (347),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 59/91 (65%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  SITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIV  377
            +I   +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIV
Sbjct  28   AIMSDRKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIV  87

Query  378  GKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            G+NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  88   GRNFGSYVTHETKHFIYFYLGQVAILLFKSG  118



>ref|XP_003451081.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Oreochromis niloticus]
 ref|XP_004072216.1| PREDICTED: dynein light chain 2, cytoplasmic [Oryzias latipes]
 ref|XP_004547082.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Maylandia zebra]
 ref|XP_004547083.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Maylandia zebra]
 ref|XP_005473576.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Oreochromis niloticus]
 ref|XP_005738274.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Pundamilia nyererei]
 ref|XP_005738275.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Pundamilia nyererei]
 ref|XP_005924452.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Haplochromis 
burtoni]
 ref|XP_006790006.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Neolamprologus brichardi]
 ref|XP_006790007.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Neolamprologus brichardi]
 ref|XP_008334364.1| PREDICTED: dynein light chain 2, cytoplasmic [Cynoglossus semilaevis]
 ref|XP_010782522.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Notothenia 
coriiceps]
Length=89

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_009685775.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Struthio camelus 
australis]
Length=107

 Score =   137 bits (346),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  22   RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  81

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  82   SYVTHETKHFIYFYLGQVAILLFKSG  107



>ref|XP_321810.4| AGAP001335-PA [Anopheles gambiae str. PEST]
 gb|EAA01180.4| AGAP001335-PA [Anopheles gambiae str. PEST]
Length=89

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>gb|ACF24567.1| dynein light chain [Gymnochlora stellata]
Length=90

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 75/90 (83%), Gaps = 0/90 (0%)
 Frame = +3

Query  201  ITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVG  380
            ++  +  ++K+ADM ++MQ++AVD A+SA  K N+EK+VA +IKKEFDK+H PTWHCIVG
Sbjct  1    MSTRRAAVVKNADMSEEMQQDAVDCAVSALSKYNIEKEVAAYIKKEFDKRHNPTWHCIVG  60

Query  381  KNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            +NFGSYVTHET HF+YFYL   A+LLFKSG
Sbjct  61   RNFGSYVTHETKHFIYFYLGQVAILLFKSG  90



>ref|XP_007898930.1| PREDICTED: dynein light chain 2, cytoplasmic [Callorhinchus milii]
Length=89

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_003968584.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Takifugu rubripes]
Length=89

 Score =   137 bits (344),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_011315471.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Fopius 
arisanus]
Length=106

 Score =   137 bits (345),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  21   RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  80

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  81   SYVTHETRHFIYFYLGQVAILLFKSG  106



>ref|XP_010226988.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Tinamus guttatus]
 gb|KGL74606.1| Dynein light chain 1, cytoplasmic [Tinamus guttatus]
Length=89

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A HIKKEFD+K+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAHIKKEFDRKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_001961854.1| GF15181 [Drosophila ananassae]
 gb|EDV31075.1| GF15181 [Drosophila ananassae]
Length=89

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A ++KKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYVKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_791800.2| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Strongylocentrotus 
purpuratus]
Length=89

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A++ A +A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMTEDMQQDAIECATTALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_005821422.1| hypothetical protein GUITHDRAFT_90482 [Guillardia theta CCMP2712]
 gb|EKX34442.1| hypothetical protein GUITHDRAFT_90482 [Guillardia theta CCMP2712]
Length=89

 Score =   137 bits (344),  Expect = 9e-38, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K ++K+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVVKNADMSEDMQQDAIDCAAQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_002051711.1| GJ17025 [Drosophila virilis]
 gb|EDW63866.1| GJ17025 [Drosophila virilis]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++VD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAVLLFKSG  89



>ref|XP_004075373.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Oryzias latipes]
 ref|XP_011480691.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Oryzias latipes]
 ref|XP_011480692.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Oryzias latipes]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_003974976.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Takifugu 
rubripes]
 ref|XP_003974979.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Takifugu 
rubripes]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>emb|CDJ05601.1| dynein light chain [Echinococcus multilocularis]
 emb|CDS42883.1| dynein light chain [Echinococcus multilocularis]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            ++ +IK+ADM ++MQ++AV +A  A EK N+EKD+A +IKKEFDKKH PTWHCIVG+NFG
Sbjct  4    RRAVIKNADMSEEMQQDAVAVAGQALEKFNIEKDIAAYIKKEFDKKHSPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETQHFIYFYLGQVAILLFKSG  89



>ref|XP_005987216.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Latimeria 
chalumnae]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMPEDMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_004929013.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X2 
[Bombyx mori]
Length=119

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  34   RKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  93

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  94   SYVTHETRHFIYFYLGQVAILLFKSG  119



>ref|XP_010819532.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Bos taurus]
 ref|XP_010799037.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Bos taurus]
 tpg|DAA23836.1| TPA: dynein, light chain, LC8-type 2-like [Bos taurus]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K IIK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAIIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|KDQ50414.1| hypothetical protein JAAARDRAFT_42078 [Jaapia argillacea MUCL 
33604]
Length=111

 Score =   137 bits (345),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/104 (58%), Positives = 78/104 (75%), Gaps = 0/104 (0%)
 Frame = +3

Query  156  PAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKK  335
            P +    ++ P    I    K IIK+ DM ++MQ+E+VDIA +A EK N+EKD+A  IKK
Sbjct  8    PTSSSDAASGPKEGGIASGPKAIIKNVDMTEEMQQESVDIASAALEKYNIEKDIAAQIKK  67

Query  336  EFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            EFD+KHGPTWH +VGKNFGSYVTHET HF+YFY+ S A+L++KS
Sbjct  68   EFDRKHGPTWHVVVGKNFGSYVTHETKHFIYFYVGSLAILIWKS  111



>ref|XP_009053825.1| hypothetical protein LOTGIDRAFT_203845 [Lottia gigantea]
 gb|ESO95310.1| hypothetical protein LOTGIDRAFT_203845 [Lottia gigantea]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ E+++ A +A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMAEDMQSESIECATTALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_003056096.1| flagellar outer dynein arm light chain 8 [Micromonas pusilla 
CCMP1545]
 gb|EEH59472.1| flagellar outer dynein arm light chain 8 [Micromonas pusilla 
CCMP1545]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +D+Q++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDLQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>ref|XP_005154435.1| PREDICTED: dynein light chain 2, cytoplasmic [Melopsittacus undulatus]
Length=96

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A +K N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  11   RKAVIKNADMSEDMQQDAVDCATQAMDKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  70

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  71   SYVTHETKHFIYFYLGQVAILLFKSG  96



>gb|AFS30551.1| dynein light chain 8a protein [Eimeria falciformis]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +I++ADM DDMQ++AVD A  A E+ N+EKD+A HIKKEFD+KH PTWHC+VG+NFG
Sbjct  4    RKFVIRNADMPDDMQQDAVDCANQALERYNIEKDIAAHIKKEFDRKHNPTWHCVVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET++F+YFY+   AVLLFKSG
Sbjct  64   SYVTHETHNFIYFYIGQVAVLLFKSG  89



>emb|CDO68156.1| hypothetical protein BN946_scf184938.g8 [Trametes cinnabarina]
Length=110

 Score =   137 bits (344),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 63/104 (61%), Positives = 79/104 (76%), Gaps = 1/104 (1%)
 Frame = +3

Query  156  PAADDRKSASPPASSITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKK  335
            P + D  S  P   + T   K IIK+ DM DDMQ+EAVD+A +A EK N+EKD+A  IKK
Sbjct  8    PTSSDSLSRGPQPDNGT-GPKAIIKNVDMSDDMQQEAVDVAHAALEKYNIEKDIAAQIKK  66

Query  336  EFDKKHGPTWHCIVGKNFGSYVTHETNHFVYFYLDSKAVLLFKS  467
            EFDK+HGPTWH +VGKNFGSYVTHET HF+YFY+ + A+L++KS
Sbjct  67   EFDKRHGPTWHVVVGKNFGSYVTHETKHFIYFYIGTLAILIWKS  110



>ref|XP_797363.1| PREDICTED: dynein light chain LC6, flagellar outer arm-like [Strongylocentrotus 
purpuratus]
Length=89

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A+D +  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAIDCSNQAMEKFNLEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQIAVLLFKSG  89



>gb|KIY99664.1| dynein light chain LC8-type [Monoraphidium neglectum]
Length=93

 Score =   136 bits (343),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ +AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  8    RKAVIKNADMSEEMQADAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  67

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  68   SYVTHETKHFIYFYLGQVAILLFKSG  93



>gb|ELT90591.1| hypothetical protein CAPTEDRAFT_371 [Capitella teleta]
Length=89

 Score =   136 bits (342),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFY+   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYMGQVAVLLFKSG  89



>ref|XP_001655386.1| AAEL011478-PA [Aedes aegypti]
 ref|XP_001655387.1| AAEL011478-PB [Aedes aegypti]
 gb|EAT36432.1| AAEL011478-PA [Aedes aegypti]
 gb|EAT36433.1| AAEL011478-PB [Aedes aegypti]
Length=128

 Score =   137 bits (346),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDK++ PTWHCIVG+NFG
Sbjct  43   RKAVIKNADMGEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKRYNPTWHCIVGRNFG  102

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  103  SYVTHETRHFIYFYLGQVAILLFKSG  128



>ref|XP_002611808.1| hypothetical protein BRAFLDRAFT_130244 [Branchiostoma floridae]
 gb|AAQ83888.1| cytoplasmic dynein light chain 2 [Branchiostoma belcheri tsingtauense]
 gb|EEN67817.1| hypothetical protein BRAFLDRAFT_130244 [Branchiostoma floridae]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   AVLLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAVLLFKSG  89



>ref|XP_002001896.1| GI14559 [Drosophila mojavensis]
 gb|EDW11338.1| GI14559 [Drosophila mojavensis]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++VD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>gb|ADD37943.1| Dynein light chain 1, cytoplasmic [Lepeophtheirus salmonis]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +++Q++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMAEELQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|XP_003384137.1| PREDICTED: dynein light chain 2, cytoplasmic [Amphimedon queenslandica]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+IA  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVEIATQAMEKFNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET +F+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKNFIYFYLGQVAILLFKSG  89



>gb|KFH71033.1| dynein light chain 1, cytoplasmic [Mortierella verticillata NRRL 
6337]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +3

Query  207  VSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKN  386
            V  +  IK+ADM +DMQ+EAV+ A+ AFEK  VEKD+A  +KKEFDKK+G TWHCIVG+N
Sbjct  2    VDPRPTIKNADMAEDMQQEAVECAVRAFEKYTVEKDIAAFMKKEFDKKYGSTWHCIVGRN  61

Query  387  FGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            FGSYVTHET HF+YFYLD  A+LLFKSG
Sbjct  62   FGSYVTHETKHFIYFYLDQIAILLFKSG  89



>ref|NP_477408.1| cytoplasmic dynein light chain 2, isoform A [Drosophila melanogaster]
 ref|NP_722698.1| cytoplasmic dynein light chain 2, isoform B [Drosophila melanogaster]
 ref|NP_001245836.1| cytoplasmic dynein light chain 2, isoform C [Drosophila melanogaster]
 ref|XP_001968277.1| GG24601 [Drosophila erecta]
 ref|XP_001968279.1| GG24789 [Drosophila erecta]
 ref|XP_002041694.1| GM16816 [Drosophila sechellia]
 ref|XP_002087534.1| GE17560 [Drosophila yakuba]
 ref|XP_002077746.1| GD23096 [Drosophila simulans]
 ref|XP_003250346.1| PREDICTED: dynein light chain 2, cytoplasmic [Apis mellifera]
 ref|XP_003403073.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Bombus terrestris]
 ref|XP_003403074.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Bombus terrestris]
 ref|XP_003489427.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Bombus impatiens]
 ref|XP_003693297.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform 1 [Apis 
florea]
 ref|XP_003693298.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform 2 [Apis 
florea]
 ref|XP_003693299.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform 3 [Apis 
florea]
 ref|XP_005188901.1| PREDICTED: dynein light chain 2, cytoplasmic [Musca domestica]
 ref|XP_005188903.1| PREDICTED: dynein light chain 2, cytoplasmic [Musca domestica]
 ref|XP_005188904.1| PREDICTED: dynein light chain 2, cytoplasmic [Musca domestica]
 ref|XP_005188905.1| PREDICTED: dynein light chain 2, cytoplasmic [Musca domestica]
 ref|XP_006607508.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Apis dorsata]
 ref|XP_008548337.1| PREDICTED: dynein light chain 2, cytoplasmic [Microplitis demolitor]
 ref|XP_011051129.1| PREDICTED: dynein light chain 2, cytoplasmic [Acromyrmex echinatior]
 ref|XP_011176152.1| PREDICTED: dynein light chain 2, cytoplasmic [Solenopsis invicta]
 ref|XP_011269285.1| PREDICTED: dynein light chain 2, cytoplasmic [Camponotus floridanus]
 ref|XP_011269286.1| PREDICTED: dynein light chain 2, cytoplasmic [Camponotus floridanus]
 ref|XP_011269287.1| PREDICTED: dynein light chain 2, cytoplasmic [Camponotus floridanus]
 ref|XP_011347928.1| PREDICTED: dynein light chain 2, cytoplasmic isoform X2 [Cerapachys 
biroi]
 sp|O96860.1|DYL2_DROME RecName: Full=Dynein light chain 2, cytoplasmic; AltName: Full=8 
kDa dynein light chain [Drosophila melanogaster]
 gb|AAD00073.1| 8kd dynein light chain [Drosophila melanogaster]
 gb|AAF51383.1| cytoplasmic dynein light chain 2, isoform A [Drosophila melanogaster]
 gb|AAL39863.1| LP02196p [Drosophila melanogaster]
 gb|AAN10465.1| cytoplasmic dynein light chain 2, isoform B [Drosophila melanogaster]
 gb|EDV57336.1| GG24601 [Drosophila erecta]
 gb|EDV57338.1| GG24789 [Drosophila erecta]
 gb|EDW45510.1| GM16816 [Drosophila sechellia]
 gb|EDW87246.1| GE17560 [Drosophila yakuba]
 gb|EDX03331.1| GD23096 [Drosophila simulans]
 gb|ACL86362.1| Cdlc2-PA, partial [synthetic construct]
 gb|ACL91042.1| Cdlc2-PA [synthetic construct]
 gb|ACT88127.1| AT22575p [Drosophila melanogaster]
 gb|EFN72781.1| Dynein light chain 2, cytoplasmic [Camponotus floridanus]
 gb|EGI67484.1| Dynein light chain 2, cytoplasmic [Acromyrmex echinatior]
 gb|AFH03513.1| cytoplasmic dynein light chain 2, isoform C [Drosophila melanogaster]
 gb|EZA48593.1| Dynein light chain 2, cytoplasmic [Cerapachys biroi]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|NP_001232448.1| putative dynein cytoplasmic light peptide variant 3 [Taeniopygia 
guttata]
 ref|XP_003226034.1| PREDICTED: dynein light chain 1, cytoplasmic [Anolis carolinensis]
 ref|XP_003642263.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Gallus gallus]
 ref|XP_005054900.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Ficedula albicollis]
 ref|XP_005147871.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Melopsittacus 
undulatus]
 ref|XP_005233282.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Falco peregrinus]
 ref|XP_005445331.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Falco cherrug]
 ref|XP_005493523.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Zonotrichia albicollis]
 ref|XP_005493524.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X2 
[Zonotrichia albicollis]
 ref|XP_005421542.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Geospiza fortis]
 ref|XP_005524486.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Pseudopodoces humilis]
 ref|XP_005524487.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X2 
[Pseudopodoces humilis]
 ref|XP_005524488.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X3 
[Pseudopodoces humilis]
 ref|XP_005524489.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X1 
[Pseudopodoces humilis]
 ref|XP_005524490.1| PREDICTED: dynein light chain 1, cytoplasmic-like isoform X2 
[Pseudopodoces humilis]
 ref|XP_007440126.1| PREDICTED: dynein light chain 1, cytoplasmic [Python bivittatus]
 ref|XP_008501036.1| PREDICTED: dynein light chain 1, cytoplasmic [Calypte anna]
 ref|XP_008924016.1| PREDICTED: dynein light chain 1, cytoplasmic [Manacus vitellinus]
 ref|XP_009070462.1| PREDICTED: dynein light chain 1, cytoplasmic [Acanthisitta chloris]
 ref|XP_009090539.1| PREDICTED: dynein light chain 1, cytoplasmic [Serinus canaria]
 ref|XP_009090540.1| PREDICTED: dynein light chain 1, cytoplasmic [Serinus canaria]
 ref|XP_009090541.1| PREDICTED: dynein light chain 1, cytoplasmic [Serinus canaria]
 ref|XP_009090542.1| PREDICTED: dynein light chain 1, cytoplasmic [Serinus canaria]
 ref|XP_009329086.1| PREDICTED: dynein light chain 1, cytoplasmic [Pygoscelis adeliae]
 ref|XP_009641128.1| PREDICTED: dynein light chain 1, cytoplasmic [Egretta garzetta]
 ref|XP_009907937.1| PREDICTED: dynein light chain 1, cytoplasmic [Picoides pubescens]
 ref|XP_010018471.1| PREDICTED: dynein light chain 1, cytoplasmic [Nestor notabilis]
 ref|XP_010180368.1| PREDICTED: dynein light chain 1, cytoplasmic [Mesitornis unicolor]
 ref|XP_010125402.1| PREDICTED: dynein light chain 1, cytoplasmic [Chlamydotis macqueenii]
 ref|XP_010206949.1| PREDICTED: dynein light chain 1, cytoplasmic [Colius striatus]
 ref|XP_010226987.1| PREDICTED: dynein light chain 1, cytoplasmic [Tinamus guttatus]
 ref|XP_010301470.1| PREDICTED: dynein light chain 1, cytoplasmic [Balearica regulorum 
gibbericeps]
 ref|XP_010573006.1| PREDICTED: dynein light chain 1, cytoplasmic [Haliaeetus leucocephalus]
 ref|XP_010718786.1| PREDICTED: dynein light chain 1, cytoplasmic [Meleagris gallopavo]
 gb|ACH44842.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44843.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44845.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44846.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44847.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44848.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44849.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44850.1| putative dynein cytoplasmic light peptide transcript variant 
1 [Taeniopygia guttata]
 gb|ACH44856.1| putative dynein cytoplasmic light peptide variant 3 [Taeniopygia 
guttata]
 gb|ACH44857.1| putative dynein cytoplasmic light peptide transcript variant 
5 [Taeniopygia guttata]
 gb|ACH44858.1| putative dynein cytoplasmic light peptide transcript variant 
6 [Taeniopygia guttata]
 gb|ACH44859.1| putative dynein cytoplasmic light peptide transcript variant 
6 [Taeniopygia guttata]
 gb|KFO11207.1| Dynein light chain 1, cytoplasmic [Balearica regulorum gibbericeps]
 gb|KFO65124.1| Dynein light chain 1, cytoplasmic [Corvus brachyrhynchos]
 gb|KFP07831.1| Dynein light chain 1, cytoplasmic [Calypte anna]
 gb|KFP19322.1| Dynein light chain 1, cytoplasmic [Egretta garzetta]
 gb|KFP27310.1| Dynein light chain 1, cytoplasmic [Colius striatus]
 gb|KFP37284.1| Dynein light chain 1, cytoplasmic [Chlamydotis macqueenii]
 gb|KFP70028.1| Dynein light chain 1, cytoplasmic [Acanthisitta chloris]
 gb|KFQ21942.1| Dynein light chain 1, cytoplasmic [Mesitornis unicolor]
 gb|KFQ43381.1| Dynein light chain 1, cytoplasmic [Nestor notabilis]
 gb|KFV77371.1| Dynein light chain 1, cytoplasmic [Picoides pubescens]
 gb|KFV87777.1| Dynein light chain 1, cytoplasmic [Struthio camelus australis]
 gb|KFW71941.1| Dynein light chain 1, cytoplasmic [Pygoscelis adeliae]
 gb|KFW82509.1| Dynein light chain 1, cytoplasmic [Manacus vitellinus]
 gb|KGL74608.1| Dynein light chain 1, cytoplasmic [Tinamus guttatus]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>gb|ACO14507.1| Dynein light chain 2, cytoplasmic [Esox lucius]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTW CIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVDCATQAMEKYNIEKDIAAYIKKEFDKKYNPTWRCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_002771658.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
 ref|XP_002781976.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
 ref|XP_002787902.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER03474.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER13771.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
 gb|EER19698.1| dynein light chain motor protein, putative [Perkinsus marinus 
ATCC 50983]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A+D A  A EK N+EKD+A +IKKEFDKK+ PTWHC+VG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAIDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCVVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHE+ HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHESKHFIYFYLGQVAILLFKSG  89



>gb|ABN13588.1| dynein light chain [Artemia franciscana]
Length=89

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+  +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDITAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>ref|NP_003737.1| dynein light chain 1, cytoplasmic [Homo sapiens]
 ref|NP_445771.1| dynein light chain 1, cytoplasmic [Rattus norvegicus]
 ref|NP_001003901.1| dynein light chain 1, cytoplasmic [Bos taurus]
 ref|NP_001032583.1| dynein light chain 1, cytoplasmic [Homo sapiens]
 ref|NP_001032584.1| dynein light chain 1, cytoplasmic [Homo sapiens]
 ref|NP_001075487.1| dynein light chain 1, cytoplasmic [Oryctolagus cuniculus]
 ref|NP_062656.3| dynein light chain 1, cytoplasmic [Mus musculus]
 ref|NP_001182043.1| dynein light chain 1, cytoplasmic [Sus scrofa]
 ref|NP_001254529.1| dynein light chain 1, cytoplasmic [Macaca mulatta]
 ref|XP_851264.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 3 [Canis 
lupus familiaris]
 ref|XP_863417.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 4 [Canis 
lupus familiaris]
 ref|XP_001162657.1| PREDICTED: dynein light chain 1, cytoplasmic [Pan troglodytes]
 ref|XP_001365264.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Monodelphis 
domestica]
 ref|XP_001506020.1| PREDICTED: dynein light chain 1, cytoplasmic [Ornithorhynchus 
anatinus]
 ref|XP_001488984.1| PREDICTED: dynein light chain 1, cytoplasmic [Equus caballus]
 ref|XP_003478485.1| PREDICTED: dynein light chain 1, cytoplasmic [Cavia porcellus]
 ref|XP_003778188.1| PREDICTED: dynein light chain 1, cytoplasmic [Pongo abelii]
 ref|XP_003789961.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Otolemur garnettii]
 ref|XP_003789962.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Otolemur garnettii]
 ref|XP_003832438.1| PREDICTED: dynein light chain 1, cytoplasmic [Pan paniscus]
 ref|XP_003994773.1| PREDICTED: dynein light chain 1, cytoplasmic [Felis catus]
 ref|XP_004002254.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Ovis aries]
 ref|XP_004017468.1| PREDICTED: dynein light chain 1, cytoplasmic [Ovis aries]
 ref|XP_004054058.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 1 [Gorilla 
gorilla gorilla]
 ref|XP_004054059.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 2 [Gorilla 
gorilla gorilla]
 ref|XP_004054060.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 3 [Gorilla 
gorilla gorilla]
 ref|XP_004054061.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 4 [Gorilla 
gorilla gorilla]
 ref|XP_004054062.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 5 [Gorilla 
gorilla gorilla]
 ref|XP_004054063.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 6 [Gorilla 
gorilla gorilla]
 ref|XP_004281466.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 1 [Orcinus 
orca]
 ref|XP_004281467.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 2 [Orcinus 
orca]
 ref|XP_004379071.1| PREDICTED: dynein light chain 1, cytoplasmic [Trichechus manatus 
latirostris]
 ref|XP_004396721.1| PREDICTED: dynein light chain 1, cytoplasmic [Odobenus rosmarus 
divergens]
 ref|XP_004429966.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 1 [Ceratotherium 
simum simum]
 ref|XP_004429967.1| PREDICTED: dynein light chain 1, cytoplasmic isoform 2 [Ceratotherium 
simum simum]
 ref|XP_004464714.1| PREDICTED: dynein light chain 1, cytoplasmic [Dasypus novemcinctus]
 ref|XP_004591950.1| PREDICTED: dynein light chain 1, cytoplasmic [Ochotona princeps]
 ref|XP_004611137.1| PREDICTED: dynein light chain 1, cytoplasmic [Sorex araneus]
 ref|XP_004664188.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Jaculus 
jaculus]
 ref|XP_004664189.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Jaculus 
jaculus]
 ref|XP_004623864.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Octodon degus]
 ref|XP_004636311.1| PREDICTED: dynein light chain 1, cytoplasmic [Octodon degus]
 ref|XP_004709625.1| PREDICTED: dynein light chain 1, cytoplasmic [Echinops telfairi]
 ref|XP_004691037.1| PREDICTED: dynein light chain 1, cytoplasmic [Condylura cristata]
 ref|XP_004753422.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Mustela 
putorius furo]
 ref|XP_004753423.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Mustela 
putorius furo]
 ref|XP_004753424.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X3 [Mustela 
putorius furo]
 ref|XP_004798435.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Mustela 
putorius furo]
 ref|XP_004798436.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Mustela 
putorius furo]
 ref|XP_004798437.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X3 [Mustela 
putorius furo]
 ref|XP_004888201.1| PREDICTED: dynein light chain 1, cytoplasmic [Heterocephalus 
glaber]
 ref|XP_004843719.1| PREDICTED: dynein light chain 1, cytoplasmic [Heterocephalus 
glaber]
 ref|XP_005079030.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Mesocricetus 
auratus]
 ref|XP_005079031.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Mesocricetus 
auratus]
 ref|XP_005081453.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Mesocricetus 
auratus]
 ref|XP_005372201.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Microtus ochrogaster]
 ref|XP_005336864.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Ictidomys 
tridecemlineatus]
 ref|XP_005336865.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Ictidomys 
tridecemlineatus]
 ref|XP_005396560.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Chinchilla 
lanigera]
 ref|XP_005396561.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Chinchilla 
lanigera]
 ref|XP_005572459.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Macaca 
fascicularis]
 ref|XP_005572460.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Macaca 
fascicularis]
 ref|XP_005670764.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Sus 
scrofa]
 ref|XP_005691624.1| PREDICTED: dynein light chain 1, cytoplasmic [Capra hircus]
 ref|XP_005891544.1| PREDICTED: dynein light chain 1, cytoplasmic [Bos mutus]
 ref|XP_005895839.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Bos mutus]
 ref|XP_005899341.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Bos mutus]
 ref|XP_006019901.1| PREDICTED: dynein light chain 1, cytoplasmic [Alligator sinensis]
 ref|XP_006114820.1| PREDICTED: dynein light chain 1, cytoplasmic [Pelodiscus sinensis]
 ref|XP_006096603.1| PREDICTED: dynein light chain 1, cytoplasmic [Myotis lucifugus]
 ref|XP_006178170.1| PREDICTED: dynein light chain 1, cytoplasmic [Camelus ferus]
 ref|XP_006204872.1| PREDICTED: dynein light chain 1, cytoplasmic [Vicugna pacos]
 ref|XP_006151588.1| PREDICTED: dynein light chain 1, cytoplasmic [Tupaia chinensis]
 ref|XP_006259202.1| PREDICTED: dynein light chain 1, cytoplasmic [Alligator mississippiensis]
 ref|XP_006770365.1| PREDICTED: dynein light chain 1, cytoplasmic [Myotis davidii]
 ref|XP_006745377.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Leptonychotes 
weddellii]
 ref|XP_006880924.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Elephantulus 
edwardii]
 ref|XP_006890490.1| PREDICTED: dynein light chain 1, cytoplasmic [Elephantulus edwardii]
 ref|XP_006865504.1| PREDICTED: dynein light chain 1, cytoplasmic [Chrysochloris asiatica]
 ref|XP_006908676.1| PREDICTED: dynein light chain 1, cytoplasmic [Pteropus alecto]
 ref|XP_006995862.1| PREDICTED: dynein light chain 1, cytoplasmic [Peromyscus maniculatus 
bairdii]
 ref|XP_007093614.1| PREDICTED: dynein light chain 1, cytoplasmic [Panthera tigris 
altaica]
 ref|XP_007061609.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Chelonia mydas]
 ref|XP_007130048.1| PREDICTED: dynein light chain 1, cytoplasmic [Physeter catodon]
 ref|XP_006053017.1| PREDICTED: dynein light chain 1, cytoplasmic [Bubalus bubalis]
 ref|XP_007184035.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007184036.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Balaenoptera 
acutorostrata scammoni]
 ref|XP_007448251.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X1 [Lipotes 
vexillifer]
 ref|XP_007448252.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Lipotes 
vexillifer]
 ref|XP_007490042.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Monodelphis 
domestica]
 ref|XP_007525338.1| PREDICTED: dynein light chain 1, cytoplasmic [Erinaceus europaeus]
 ref|XP_007607161.1| PREDICTED: dynein light chain 1, cytoplasmic [Cricetulus griseus]
 ref|XP_007936414.1| PREDICTED: dynein light chain 1, cytoplasmic [Orycteropus afer 
afer]
 ref|XP_008071753.1| PREDICTED: dynein light chain 1, cytoplasmic [Tarsius syrichta]
 ref|XP_008170263.1| PREDICTED: dynein light chain 1, cytoplasmic [Chrysemys picta 
bellii]
 ref|XP_008567579.1| PREDICTED: dynein light chain 1, cytoplasmic [Galeopterus variegatus]
 ref|XP_008567580.1| PREDICTED: dynein light chain 1, cytoplasmic [Galeopterus variegatus]
 ref|XP_008838814.1| PREDICTED: dynein light chain 1, cytoplasmic [Nannospalax galili]
 ref|XP_009003028.1| PREDICTED: dynein light chain 1, cytoplasmic [Callithrix jacchus]
 ref|XP_008983470.1| PREDICTED: dynein light chain 1, cytoplasmic [Callithrix jacchus]
 ref|XP_008956027.1| PREDICTED: dynein light chain 1, cytoplasmic [Pan paniscus]
 ref|XP_009180103.1| PREDICTED: dynein light chain 1, cytoplasmic [Papio anubis]
 ref|XP_009180104.1| PREDICTED: dynein light chain 1, cytoplasmic [Papio anubis]
 ref|XP_009246592.1| PREDICTED: dynein light chain 1, cytoplasmic [Pongo abelii]
 ref|XP_009424672.1| PREDICTED: dynein light chain 1, cytoplasmic [Pan troglodytes]
 ref|XP_010366594.1| PREDICTED: dynein light chain 1, cytoplasmic [Rhinopithecus roxellana]
 ref|XP_010366595.1| PREDICTED: dynein light chain 1, cytoplasmic [Rhinopithecus roxellana]
 ref|XP_010602352.1| PREDICTED: dynein light chain 1, cytoplasmic [Fukomys damarensis]
 ref|XP_010602353.1| PREDICTED: dynein light chain 1, cytoplasmic [Fukomys damarensis]
 ref|XP_010796262.1| PREDICTED: LOW QUALITY PROTEIN: dynein light chain 1, cytoplasmic 
[Bos taurus]
 ref|XP_010823013.1| PREDICTED: LOW QUALITY PROTEIN: dynein light chain 1, cytoplasmic 
[Bos taurus]
 ref|XP_010797000.1| PREDICTED: dynein light chain 1, cytoplasmic [Bos taurus]
 ref|XP_010804565.1| PREDICTED: dynein light chain 1, cytoplasmic [Bos taurus]
 ref|XP_010815015.1| PREDICTED: dynein light chain 1, cytoplasmic [Bos taurus]
 ref|XP_010826930.1| PREDICTED: dynein light chain 1, cytoplasmic [Bison bison bison]
 ref|XP_010967890.1| PREDICTED: dynein light chain 1, cytoplasmic [Camelus bactrianus]
 ref|XP_011215493.1| PREDICTED: dynein light chain 1, cytoplasmic isoform X2 [Ailuropoda 
melanoleuca]
 ref|XP_011354179.1| PREDICTED: dynein light chain 1, cytoplasmic [Pteropus vampyrus]
 sp|P61273.1|DYL1_MACFA RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=Dynein 
light chain LC8-type 1 [Macaca fascicularis]
 sp|P61285.1|DYL1_BOVIN RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=Dynein 
light chain LC8-type 1 [Bos taurus]
 sp|P63170.1|DYL1_RAT RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=8 
kDa dynein light chain; Short=DLC8; AltName: Full=Dynein 
light chain LC8-type 1; AltName: Full=Protein inhibitor of 
neuronal nitric oxide synthase; Short=PIN [Rattus norvegicus]
 sp|P63167.1|DYL1_HUMAN RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=8 
kDa dynein light chain; Short=DLC8; AltName: Full=Dynein 
light chain LC8-type 1; AltName: Full=Protein inhibitor of 
neuronal nitric oxide synthase; Short=PIN [Homo sapiens]
 sp|P63168.1|DYL1_MOUSE RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=8 
kDa dynein light chain; Short=DLC8; AltName: Full=Dynein 
light chain LC8-type 1; AltName: Full=Protein inhibitor of 
neuronal nitric oxide synthase; Short=PIN; Short=mPIN [Mus musculus]
 sp|P63169.1|DYL1_RABIT RecName: Full=Dynein light chain 1, cytoplasmic; AltName: Full=8 
kDa dynein light chain; Short=DLC8; AltName: Full=Dynein 
light chain LC8-type 1; AltName: Full=Protein inhibitor of 
neuronal nitric oxide synthase; Short=PIN [Oryctolagus cuniculus]
 pdb|1F3C|A Chain A, Refined Solution Structure Of 8kda Dynein Light Chain 
(Dlc8)
 pdb|1F3C|B Chain B, Refined Solution Structure Of 8kda Dynein Light Chain 
(Dlc8)
 pdb|1F95|A Chain A, Solution Structure Of Dynein Light Chain 8 (Dlc8) And 
Bim Peptide Complex
 pdb|1F95|B Chain B, Solution Structure Of Dynein Light Chain 8 (Dlc8) And 
Bim Peptide Complex
 pdb|1F96|A Chain A, Solution Structure Of Dynein Light Chain 8 (Dlc8) And 
Nnos Peptide Complex
 pdb|1F96|B Chain B, Solution Structure Of Dynein Light Chain 8 (Dlc8) And 
Nnos Peptide Complex
 pdb|3ZKE|A Chain A, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKE|C Chain C, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKE|E Chain E, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKE|G Chain G, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKE|I Chain I, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKE|K Chain K, Structure Of Lc8 In Complex With Nek9 Peptide
 pdb|3ZKF|A Chain A, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 pdb|3ZKF|C Chain C, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 pdb|3ZKF|E Chain E, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 pdb|3ZKF|G Chain G, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 pdb|3ZKF|I Chain I, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 pdb|3ZKF|K Chain K, Structure Of Lc8 In Complex With Nek9 Phosphopeptide
 gb|AAB04149.1| cytoplasmic dynein light chain 1 [Homo sapiens]
 gb|AAB38257.1| protein inhibitor of neuronal nitric oxide synthase [Rattus norvegicus]
 gb|AAC32530.1| protein inhibitor of neuronal nitric oxide synthase [Oryctolagus 
cuniculus]
 gb|AAC32531.1| protein inhibitor of neuronal nitric oxide synthase [Oryctolagus 
cuniculus]
 gb|AAD01643.1| protein inhibitor of nitric oxide synthase [Mus musculus]
 dbj|BAB22160.1| unnamed protein product [Mus musculus]
 dbj|BAB27063.1| unnamed protein product [Mus musculus]
 dbj|BAB27117.1| unnamed protein product [Mus musculus]
 dbj|BAB28970.1| unnamed protein product [Mus musculus]
 dbj|BAB33053.1| hypothetical protein [Macaca fascicularis]
 gb|AAH08106.1| Dynein light chain LC8-type 1 [Mus musculus]
 gb|AAH34258.1| Dynein light chain LC8-type 1 [Mus musculus]
 dbj|BAC38691.1| unnamed protein product [Mus musculus]
 dbj|BAC56576.1| similar to cytoplasmic dynein light chain 1 [Bos taurus]
 gb|AAH63183.1| Dynein light chain LC8-type 1 [Rattus norvegicus]
 emb|CAG28600.1| DNCL1 [Homo sapiens]
 emb|CAG46925.1| DNCL1 [Homo sapiens]
 gb|AAT84371.1| cytoplasmic dynein light polypeptide 1 [Bos taurus]
 gb|AAX09047.1| cytoplasmic dynein light polypeptide [Bos taurus]
 dbj|BAE00930.1| unnamed protein product [Macaca fascicularis]
 gb|AAI00290.1| Dynein, light chain, LC8-type 1 [Homo sapiens]
 dbj|BAE28262.1| unnamed protein product [Mus musculus]
 gb|AAI04246.1| Dynein, light chain, LC8-type 1 [Homo sapiens]
 gb|AAI02873.1| Dynein, light chain, LC8-type 1 [Bos taurus]
 gb|AAI04245.1| Dynein, light chain, LC8-type 1 [Homo sapiens]
 dbj|BAE89357.1| unnamed protein product [Macaca fascicularis]
 gb|EAW98195.1| dynein, light chain, LC8-type 1, isoform CRA_a [Homo sapiens]
 gb|EAW98196.1| dynein, light chain, LC8-type 1, isoform CRA_a [Homo sapiens]
 gb|EAW98197.1| dynein, light chain, LC8-type 1, isoform CRA_a [Homo sapiens]
 gb|EDL19868.1| mCG19227 [Mus musculus]
 gb|EDM13893.1| dynein light chain LC8-type 1, isoform CRA_a [Rattus norvegicus]
 gb|EDM13894.1| dynein light chain LC8-type 1, isoform CRA_a [Rattus norvegicus]
 dbj|BAG34733.1| unnamed protein product [Homo sapiens]
 gb|ACT64411.1| dynein, light chain, LC8-type 1 protein [synthetic construct]
 gb|ACT64412.1| dynein, light chain, LC8-type 1 protein [synthetic construct]
 gb|EFB16415.1| hypothetical protein PANDA_020889 [Ailuropoda melanoleuca]
 tpg|DAA20577.1| TPA: dynein light chain 1, cytoplasmic [Bos taurus]
 emb|CAZ64801.1| dynein, light chain, LC8-type 1 [Sus scrofa]
 emb|CAZ64802.1| dynein, light chain, LC8-type 1 [Phacochoerus africanus]
 emb|CAZ64803.1| dynein, light chain, LC8-type 1 [Babyrousa babyrussa]
 dbj|BAJ20967.1| dynein, light chain, LC8-type 1 [synthetic construct]
 gb|EHB05132.1| Dynein light chain 1, cytoplasmic [Heterocephalus glaber]
 gb|EHH66773.1| hypothetical protein EGM_03826 [Macaca fascicularis]
 gb|ELK15531.1| Dynein light chain 1, cytoplasmic [Pteropus alecto]
 gb|ELK25218.1| Dynein light chain 1, cytoplasmic [Myotis davidii]
 gb|ELR56352.1| hypothetical protein M91_12790 [Bos mutus]
 gb|ELW63839.1| Dynein light chain 1, cytoplasmic [Tupaia chinensis]
 gb|EQB77406.1| dynein light chain 1, cytoplasmic-like protein [Camelus ferus]
 gb|AIC50172.1| DYNLL1, partial [synthetic construct]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>pdb|3BRL|A Chain A, Crystal Structure Of Lc8 S88e  SWA
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFK G
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKEG  89



>ref|XP_007897283.1| PREDICTED: dynein light chain 1, cytoplasmic [Callorhinchus milii]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMAEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_801821.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform 2 [Strongylocentrotus 
purpuratus]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++A+D +  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAIDCSNQAMEKFNLEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQIAILLFKSG  89



>ref|XP_006894414.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Elephantulus 
edwardii]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQIAILLFKSG  89



>ref|XP_008610951.1| dynein light chain 2, cytoplasmic [Saprolegnia diclina VS20]
 ref|XP_008914546.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
INRA-310]
 ref|XP_009538102.1| hypothetical protein PHYSODRAFT_289115 [Phytophthora sojae]
 ref|XP_009821947.1| dynein light chain LC6, flagellar outer arm [Aphanomyces astaci]
 gb|EGZ06205.1| hypothetical protein PHYSODRAFT_289115 [Phytophthora sojae]
 gb|EQC35634.1| dynein light chain 2, cytoplasmic [Saprolegnia diclina VS20]
 gb|ETI32172.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
P1569]
 gb|ETK72549.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica]
 gb|ETL26001.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica]
 gb|ETL79214.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica]
 gb|ETM32456.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica]
 gb|ETN00182.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
INRA-310]
 gb|ETO60925.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
P1976]
 gb|ETP02034.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
CJ01A1]
 gb|ETP30193.1| dynein light chain LC6, flagellar outer arm [Phytophthora parasitica 
P10297]
 gb|ETV89547.1| dynein light chain LC6, flagellar outer arm [Aphanomyces astaci]
 gb|KDO22615.1| dynein light chain 2 [Saprolegnia parasitica CBS 223.65]
 gb|KDO24397.1| dynein light chain 2 [Saprolegnia parasitica CBS 223.65]
Length=89

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMHEDMQQDAVDCASQALEKYNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>emb|CDS27671.1| dynein light chain [Hymenolepis microstoma]
Length=92

 Score =   135 bits (341),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ+ AVDIA  A +K N+EKD+A HIKKEFD+++ PTWHCIVG+NFG
Sbjct  7    QKAVIKNADMSEDMQQAAVDIANQAMDKFNIEKDIAAHIKKEFDQRYNPTWHCIVGRNFG  66

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFY+   A+LLFKSG
Sbjct  67   SYVTHETKHFIYFYMGQVAILLFKSG  92



>ref|XP_002990207.1| hypothetical protein SELMODRAFT_131219 [Selaginella moellendorffii]
 ref|XP_002992484.1| hypothetical protein SELMODRAFT_135325 [Selaginella moellendorffii]
 gb|EFJ06422.1| hypothetical protein SELMODRAFT_135325 [Selaginella moellendorffii]
 gb|EFJ08767.1| hypothetical protein SELMODRAFT_131219 [Selaginella moellendorffii]
Length=99

 Score =   136 bits (342),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 60/91 (66%), Positives = 75/91 (82%), Gaps = 0/91 (0%)
 Frame = +3

Query  198  SITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIV  377
            S  + +K IIK+ADM +DMQ+++++ A  A +K NVEKD+A +IKKEFDKK+ PTWHCIV
Sbjct  9    SAVLERKAIIKNADMTEDMQQDSIECASQALDKYNVEKDIAAYIKKEFDKKYNPTWHCIV  68

Query  378  GKNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            G+NFGSYVTHET HF+YFYL   AVLLFKSG
Sbjct  69   GRNFGSYVTHETKHFIYFYLGQVAVLLFKSG  99



>ref|XP_005794902.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Xiphophorus 
maculatus]
 ref|XP_007563510.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Poecilia formosa]
 ref|XP_008416374.1| PREDICTED: dynein light chain 2, cytoplasmic-like [Poecilia reticulata]
Length=89

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKPVIKNADMSEDMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_009082707.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Acanthisitta 
chloris]
 gb|KFP73851.1| Dynein light chain 1, cytoplasmic [Acanthisitta chloris]
Length=89

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV+ A  A +K N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVECATQALDKYNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|NP_998189.1| dynein light chain 1, cytoplasmic [Danio rerio]
 ref|NP_001135068.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 ref|NP_001188181.1| dynein light chain 1 cytoplasmic [Ictalurus punctatus]
 ref|XP_006640363.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Lepisosteus 
oculatus]
 ref|XP_007229191.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Astyanax mexicanus]
 ref|XP_010874809.1| PREDICTED: dynein light chain 1, cytoplasmic [Esox lucius]
 gb|AAH59707.1| Dynein, light chain, LC8-type 2 [Danio rerio]
 gb|ACI67073.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACI69868.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACI70077.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACM09277.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACN09861.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACN10034.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACN12208.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACN12381.1| Dynein light chain 1, cytoplasmic [Salmo salar]
 gb|ACO07625.1| Dynein light chain 1, cytoplasmic [Oncorhynchus mykiss]
 gb|ACO08013.1| Dynein light chain 1, cytoplasmic [Oncorhynchus mykiss]
 gb|ACO08264.1| Dynein light chain 1, cytoplasmic [Oncorhynchus mykiss]
 gb|ACO08720.1| Dynein light chain 1, cytoplasmic [Oncorhynchus mykiss]
 gb|ACO13507.1| Dynein light chain 1, cytoplasmic [Esox lucius]
 gb|ADO29052.1| dynein light chain 1 cytoplasmic [Ictalurus punctatus]
 gb|AGH92562.1| dynein light chain 1 [Salmo salar]
 gb|AGH92579.1| dynein light chain 1 [Salmo salar]
 emb|CDQ75050.1| unnamed protein product [Oncorhynchus mykiss]
Length=89

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVECATQALEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_667783.1| cut up CG6998-PA [Cryptosporidium hominis TU502]
 ref|XP_001388191.1| cut up CG6998-PA [Cryptosporidium parvum Iowa II]
 gb|EAZ51364.1| cut up CG6998-PA, putative [Cryptosporidium parvum Iowa II]
Length=89

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            KK +IK+ADM D+MQ++A+  A +A E++NVEKD+A +IKKEFD+K+ PTWHC+VG+NFG
Sbjct  4    KKAVIKNADMSDEMQQDAISCAAAAIERHNVEKDIAAYIKKEFDRKYNPTWHCVVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFY+   AVLLFKSG
Sbjct  64   SYVTHETRHFIYFYMGQIAVLLFKSG  89



>ref|XP_003511737.1| PREDICTED: dynein light chain 1, cytoplasmic [Cricetulus griseus]
 gb|EGV96041.1| Dynein light chain 1, cytoplasmic [Cricetulus griseus]
Length=89

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ+++V+ A  A EK N+EKD+A HI+KEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDSVECATQALEKYNIEKDIAAHIRKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_004929012.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X1 
[Bombyx mori]
Length=123

 Score =   136 bits (343),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  38   RKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  97

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  98   SYVTHETRHFIYFYLGQVAILLFKSG  123



>gb|EUB57791.1| Dynein light chain, flagellar outer arm [Echinococcus granulosus]
 emb|CDJ01198.1| dynein light chain [Echinococcus multilocularis]
 emb|CDS18150.1| dynein light chain [Echinococcus granulosus]
 emb|CDS38480.1| dynein light chain [Echinococcus multilocularis]
Length=91

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 55/87 (63%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            ++K ++K+ DM ++MQ++A+D+A  AFEK N+EKD+A +IKKEFDK+H PTWHC+VG+NF
Sbjct  5    TRKAVVKNVDMSEEMQQDAIDVATHAFEKFNIEKDIAAYIKKEFDKRHSPTWHCVVGRNF  64

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFY    A+LLFKSG
Sbjct  65   GSYVTHETKHFIYFYAGQVAILLFKSG  91



>gb|EPY31499.1| dynein light chain LC8-type [Strigomonas culicis]
 gb|EPY32797.1| dynein light chain LC8-type [Strigomonas culicis]
Length=90

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/90 (63%), Positives = 76/90 (84%), Gaps = 0/90 (0%)
 Frame = +3

Query  201  ITVSKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVG  380
            ++  +K +IK+ADM +DMQ +A+++A+ A EK N+EKD+A +IKKEFDKK+ PTWHCIVG
Sbjct  1    MSYDRKAVIKNADMSEDMQADAIEVALQALEKFNIEKDIAAYIKKEFDKKYQPTWHCIVG  60

Query  381  KNFGSYVTHETNHFVYFYLDSKAVLLFKSG  470
            +NFGS+VTHET+HFVYFY    A+LLFKSG
Sbjct  61   RNFGSFVTHETHHFVYFYFGQVAILLFKSG  90



>ref|XP_004929014.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X3 
[Bombyx mori]
 ref|XP_004929015.1| PREDICTED: dynein light chain 2, cytoplasmic-like isoform X4 
[Bombyx mori]
 gb|EHJ78994.1| hypothetical protein KGM_15387 [Danaus plexippus]
 dbj|BAM17845.1| cytoplasmic dynein light chain 2 [Papilio xuthus]
 dbj|BAM19183.1| cytoplasmic dynein light chain 2 [Papilio polytes]
Length=89

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM ++MQ++AVD A  A EK N+EKD+A  IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEEMQQDAVDCATQALEKFNIEKDIAAFIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETRHFIYFYLGQVAILLFKSG  89



>gb|ACQ58616.1| Dynein light chain 2, cytoplasmic [Anoplopoma fimbria]
Length=89

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ++AV+ A  A EK N+EKD+A +IKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDAVECATQAGEKYNIEKDIAAYIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFYL   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYLGQVAILLFKSG  89



>ref|XP_003726637.1| PREDICTED: dynein light chain 1, cytoplasmic-like [Strongylocentrotus 
purpuratus]
Length=89

 Score =   135 bits (340),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/86 (66%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +3

Query  213  KKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNFG  392
            +K +IK+ADM +DMQ+++++ A  A EK N+EKD+A HIKKEFDKK+ PTWHCIVG+NFG
Sbjct  4    RKAVIKNADMSEDMQQDSIECATQAMEKFNIEKDIAAHIKKEFDKKYNPTWHCIVGRNFG  63

Query  393  SYVTHETNHFVYFYLDSKAVLLFKSG  470
            SYVTHET HF+YFY+   A+LLFKSG
Sbjct  64   SYVTHETKHFIYFYMGQVAILLFKSG  89



>gb|KGB42146.1| Dynein 8 kDa light chain, flagellar outer arm, partial [Schistosoma 
haematobium]
Length=94

 Score =   135 bits (341),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 57/87 (66%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +3

Query  210  SKKVIIKSADMKDDMQKEAVDIAISAFEKNNVEKDVAEHIKKEFDKKHGPTWHCIVGKNF  389
            S+K +IK+ DM ++MQ++A++ A  AFEK N+EKD+A +IKKEFDKKH PTWHC+VG+NF
Sbjct  8    SRKAVIKNVDMSEEMQQDAIEAATQAFEKYNIEKDIAAYIKKEFDKKHNPTWHCVVGRNF  67

Query  390  GSYVTHETNHFVYFYLDSKAVLLFKSG  470
            GSYVTHET HF+YFY    A+LLFKSG
Sbjct  68   GSYVTHETKHFIYFYAGQVAILLFKSG  94



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 669314531515