BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A02

Length=552
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_010327242.1|  PREDICTED: polyadenylate-binding protein RBP...    157   1e-42   
ref|XP_009631417.1|  PREDICTED: polyadenylate-binding protein RBP...    157   2e-42   
ref|XP_009631416.1|  PREDICTED: polyadenylate-binding protein RBP...    157   3e-42   Nicotiana tomentosiformis
ref|XP_004232721.1|  PREDICTED: polyadenylate-binding protein RBP45     157   3e-42   Solanum lycopersicum
ref|XP_009631415.1|  PREDICTED: polyadenylate-binding protein RBP...    157   3e-42   Nicotiana tomentosiformis
ref|XP_009776437.1|  PREDICTED: polyadenylate-binding protein RBP...    156   5e-42   Nicotiana sylvestris
ref|XP_009776429.1|  PREDICTED: polyadenylate-binding protein RBP...    156   5e-42   Nicotiana sylvestris
ref|XP_009614215.1|  PREDICTED: polyadenylate-binding protein RBP...    156   5e-42   Nicotiana tomentosiformis
ref|XP_010327241.1|  PREDICTED: polyadenylate-binding protein RBP...    156   7e-42   Solanum lycopersicum
ref|XP_004248403.1|  PREDICTED: polyadenylate-binding protein RBP...    156   7e-42   Solanum lycopersicum
ref|XP_006352618.1|  PREDICTED: polyadenylate-binding protein RBP...    155   8e-42   Solanum tuberosum [potatoes]
ref|XP_006352617.1|  PREDICTED: polyadenylate-binding protein RBP...    155   8e-42   Solanum tuberosum [potatoes]
ref|XP_006348103.1|  PREDICTED: polyadenylate-binding protein RBP...    155   2e-41   Solanum tuberosum [potatoes]
ref|XP_009789022.1|  PREDICTED: polyadenylate-binding protein RBP...    154   4e-41   Nicotiana sylvestris
emb|CDP04386.1|  unnamed protein product                                151   4e-41   Coffea canephora [robusta coffee]
ref|XP_009772575.1|  PREDICTED: polyadenylate-binding protein RBP...    153   6e-41   Nicotiana sylvestris
ref|XP_009772574.1|  PREDICTED: polyadenylate-binding protein RBP...    153   7e-41   Nicotiana sylvestris
ref|XP_009595795.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-40   Nicotiana tomentosiformis
ref|XP_004234481.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-40   Solanum lycopersicum
ref|XP_006343293.1|  PREDICTED: polyadenylate-binding protein RBP...    151   4e-40   Solanum tuberosum [potatoes]
ref|XP_009795696.1|  PREDICTED: polyadenylate-binding protein RBP45     151   5e-40   Nicotiana sylvestris
sp|Q9LEB4.1|RBP45_NICPL  RecName: Full=Polyadenylate-binding prot...    150   6e-40   Nicotiana plumbaginifolia [leadwort-leaved tobacco]
ref|XP_009600135.1|  PREDICTED: polyadenylate-binding protein RBP45     150   7e-40   Nicotiana tomentosiformis
ref|XP_011037672.1|  PREDICTED: polyadenylate-binding protein RBP...    147   8e-40   Populus euphratica
ref|XP_010101438.1|  Polyadenylate-binding protein RBP45B               150   1e-39   
ref|XP_011096084.1|  PREDICTED: polyadenylate-binding protein RBP...    150   1e-39   Sesamum indicum [beniseed]
ref|XP_011096085.1|  PREDICTED: polyadenylate-binding protein RBP...    150   1e-39   Sesamum indicum [beniseed]
ref|XP_011037673.1|  PREDICTED: polyadenylate-binding protein RBP...    146   2e-39   Populus euphratica
ref|XP_010278713.1|  PREDICTED: polyadenylate-binding protein RBP...    147   3e-39   Nelumbo nucifera [Indian lotus]
ref|XP_011037671.1|  PREDICTED: polyadenylate-binding protein RBP...    147   4e-39   Populus euphratica
ref|XP_011097972.1|  PREDICTED: polyadenylate-binding protein RBP...    147   6e-39   
gb|EYU33637.1|  hypothetical protein MIMGU_mgv1a007175mg                148   8e-39   Erythranthe guttata [common monkey flower]
ref|XP_004153512.1|  PREDICTED: polyadenylate-binding protein RBP...    141   1e-38   
ref|XP_008349308.1|  PREDICTED: polyadenylate-binding protein RBP...    143   2e-38   
ref|XP_004244127.1|  PREDICTED: polyadenylate-binding protein RBP45     147   2e-38   Solanum lycopersicum
ref|XP_006346222.1|  PREDICTED: polyadenylate-binding protein RBP...    147   2e-38   Solanum tuberosum [potatoes]
ref|XP_011037670.1|  PREDICTED: polyadenylate-binding protein RBP...    146   2e-38   Populus euphratica
ref|XP_002305583.2|  RNA-binding protein 45                             146   3e-38   Populus trichocarpa [western balsam poplar]
ref|XP_006449040.1|  hypothetical protein CICLE_v10015407mg             144   3e-38   
ref|XP_007153936.1|  hypothetical protein PHAVU_003G077700g             146   3e-38   Phaseolus vulgaris [French bean]
ref|XP_010278711.1|  PREDICTED: polyadenylate-binding protein RBP...    146   3e-38   Nelumbo nucifera [Indian lotus]
gb|KJB69302.1|  hypothetical protein B456_011G015300                    143   4e-38   Gossypium raimondii
gb|KDP20762.1|  hypothetical protein JCGZ_21233                         146   4e-38   Jatropha curcas
ref|XP_010278708.1|  PREDICTED: polyadenylate-binding protein RBP...    146   5e-38   Nelumbo nucifera [Indian lotus]
ref|XP_008349307.1|  PREDICTED: polyadenylate-binding protein RBP...    143   5e-38   
ref|XP_004158014.1|  PREDICTED: polyadenylate-binding protein RBP...    142   5e-38   
gb|KJB69304.1|  hypothetical protein B456_011G015300                    143   6e-38   Gossypium raimondii
ref|XP_009357435.1|  PREDICTED: polyadenylate-binding protein RBP...    143   7e-38   Pyrus x bretschneideri [bai li]
gb|KJB69305.1|  hypothetical protein B456_011G015300                    142   7e-38   Gossypium raimondii
gb|KDO75474.1|  hypothetical protein CISIN_1g015091mg                   143   8e-38   Citrus sinensis [apfelsine]
gb|KDO75475.1|  hypothetical protein CISIN_1g015091mg                   143   8e-38   Citrus sinensis [apfelsine]
ref|NP_567764.1|  polyadenylate-binding protein RBP45C                  145   1e-37   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003529629.1|  PREDICTED: polyadenylate-binding protein RBP45     144   1e-37   Glycine max [soybeans]
gb|KHN35750.1|  Polyadenylate-binding protein RBP45                     144   1e-37   Glycine soja [wild soybean]
ref|XP_010675694.1|  PREDICTED: polyadenylate-binding protein RBP45     144   1e-37   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB81765.1|  hypothetical protein B456_013G160200                    142   1e-37   Gossypium raimondii
ref|XP_004295261.2|  PREDICTED: polyadenylate-binding protein RBP45B    144   2e-37   Fragaria vesca subsp. vesca
gb|EPS64177.1|  hypothetical protein M569_10604                         144   2e-37   Genlisea aurea
ref|XP_007026047.1|  RNA-binding family protein                         144   2e-37   Theobroma cacao [chocolate]
ref|XP_003549897.1|  PREDICTED: polyadenylate-binding protein RBP...    144   2e-37   Glycine max [soybeans]
emb|CAB36546.1|  putative DNA binding protein                           144   2e-37   Arabidopsis thaliana [mouse-ear cress]
gb|KFK29206.1|  hypothetical protein AALP_AA7G103000                    144   2e-37   Arabis alpina [alpine rockcress]
gb|KDO61276.1|  hypothetical protein CISIN_1g014513mg                   143   3e-37   Citrus sinensis [apfelsine]
ref|XP_008224811.1|  PREDICTED: polyadenylate-binding protein RBP...    142   3e-37   Prunus mume [ume]
ref|XP_002518499.1|  nuclear acid binding protein, putative             144   3e-37   Ricinus communis
ref|XP_006449039.1|  hypothetical protein CICLE_v10015407mg             143   3e-37   Citrus clementina [clementine]
ref|XP_006446110.1|  hypothetical protein CICLE_v10015576mg             143   3e-37   
ref|XP_006449038.1|  hypothetical protein CICLE_v10015407mg             143   3e-37   Citrus clementina [clementine]
gb|KJB81762.1|  hypothetical protein B456_013G160200                    142   4e-37   Gossypium raimondii
gb|KDO61275.1|  hypothetical protein CISIN_1g014513mg                   143   4e-37   Citrus sinensis [apfelsine]
ref|XP_006370698.1|  hypothetical protein POPTR_0001s45000g             143   5e-37   
ref|XP_008349306.1|  PREDICTED: polyadenylate-binding protein RBP...    142   5e-37   
ref|XP_007211969.1|  hypothetical protein PRUPE_ppa006617mg             143   5e-37   Prunus persica
gb|EYU27806.1|  hypothetical protein MIMGU_mgv1a007668mg                142   5e-37   Erythranthe guttata [common monkey flower]
gb|KJB69303.1|  hypothetical protein B456_011G015300                    143   6e-37   Gossypium raimondii
gb|KGN64531.1|  hypothetical protein Csa_1G063550                       142   6e-37   Cucumis sativus [cucumbers]
ref|XP_010545222.1|  PREDICTED: polyadenylate-binding protein RBP...    142   6e-37   Tarenaya hassleriana [spider flower]
gb|KCW70174.1|  hypothetical protein EUGRSUZ_F03462                     139   7e-37   Eucalyptus grandis [rose gum]
gb|KEH36838.1|  polyadenylate-binding protein RBP47B                    139   7e-37   Medicago truncatula
gb|KJB69301.1|  hypothetical protein B456_011G015300                    143   7e-37   Gossypium raimondii
ref|XP_004145107.1|  PREDICTED: polyadenylate-binding protein RBP...    142   8e-37   Cucumis sativus [cucumbers]
ref|XP_004145109.1|  PREDICTED: polyadenylate-binding protein RBP...    142   9e-37   Cucumis sativus [cucumbers]
ref|XP_006850190.1|  hypothetical protein AMTR_s00022p00247520          143   9e-37   Amborella trichopoda
ref|XP_008441142.1|  PREDICTED: polyadenylate-binding protein RBP...    142   9e-37   Cucumis melo [Oriental melon]
ref|XP_008441150.1|  PREDICTED: polyadenylate-binding protein RBP...    142   9e-37   Cucumis melo [Oriental melon]
ref|XP_006468022.1|  PREDICTED: polyadenylate-binding protein RBP...    142   9e-37   Citrus sinensis [apfelsine]
ref|XP_008441139.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Cucumis melo [Oriental melon]
ref|XP_008441138.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Cucumis melo [Oriental melon]
ref|XP_009120896.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Brassica rapa
ref|XP_006470600.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Citrus sinensis [apfelsine]
ref|XP_009120895.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Brassica rapa
gb|KJB81761.1|  hypothetical protein B456_013G160200                    142   1e-36   Gossypium raimondii
emb|CDY13992.1|  BnaC09g38340D                                          142   1e-36   Brassica napus [oilseed rape]
ref|XP_004507696.1|  PREDICTED: polyadenylate-binding protein RBP...    141   1e-36   
ref|XP_008441163.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Cucumis melo [Oriental melon]
ref|XP_006468021.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Citrus sinensis [apfelsine]
ref|XP_011010322.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Populus euphratica
ref|XP_011010320.1|  PREDICTED: polyadenylate-binding protein RBP...    142   1e-36   Populus euphratica
gb|KFK43438.1|  hypothetical protein AALP_AA1G125300                    142   1e-36   Arabis alpina [alpine rockcress]
ref|XP_007147735.1|  hypothetical protein PHAVU_006G150400g             142   1e-36   Phaseolus vulgaris [French bean]
emb|CDX92537.1|  BnaA10g15760D                                          142   1e-36   
gb|KJB81764.1|  hypothetical protein B456_013G160200                    142   1e-36   Gossypium raimondii
gb|AGV54881.1|  RNA-binding post-transcriptional regulator csx1-l...    142   1e-36   Phaseolus vulgaris [French bean]
gb|KEH36837.1|  polyadenylate-binding protein RBP47B                    139   2e-36   Medicago truncatula
gb|AGV54456.1|  RNA-binding post-transcriptional regulator csx1-l...    141   2e-36   Phaseolus vulgaris [French bean]
ref|XP_008224810.1|  PREDICTED: polyadenylate-binding protein RBP...    141   2e-36   Prunus mume [ume]
ref|XP_010265753.1|  PREDICTED: polyadenylate-binding protein RBP...    141   3e-36   Nelumbo nucifera [Indian lotus]
gb|KJB13664.1|  hypothetical protein B456_002G088100                    141   3e-36   Gossypium raimondii
gb|KJB13665.1|  hypothetical protein B456_002G088100                    141   3e-36   Gossypium raimondii
ref|XP_010265752.1|  PREDICTED: polyadenylate-binding protein RBP...    141   3e-36   Nelumbo nucifera [Indian lotus]
ref|XP_004507695.1|  PREDICTED: polyadenylate-binding protein RBP...    140   3e-36   Cicer arietinum [garbanzo]
gb|KJB13666.1|  hypothetical protein B456_002G088100                    141   3e-36   Gossypium raimondii
gb|KHG01774.1|  Polyadenylate-binding RBP45C -like protein              141   3e-36   Gossypium arboreum [tree cotton]
gb|KHG16958.1|  Polyadenylate-binding RBP45B -like protein              141   4e-36   Gossypium arboreum [tree cotton]
ref|XP_010031800.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-36   Eucalyptus grandis [rose gum]
ref|XP_010923889.1|  PREDICTED: polyadenylate-binding protein RBP...    140   4e-36   
gb|KHG22988.1|  Polyadenylate-binding RBP45C -like protein              140   4e-36   Gossypium arboreum [tree cotton]
ref|XP_006417333.1|  hypothetical protein EUTSA_v10007819mg             140   5e-36   Eutrema salsugineum [saltwater cress]
dbj|BAH56983.1|  AT1G11650                                              137   5e-36   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010930147.1|  PREDICTED: polyadenylate-binding protein RBP45     140   7e-36   Elaeis guineensis
ref|XP_009118182.1|  PREDICTED: polyadenylate-binding protein RBP...    139   7e-36   Brassica rapa
ref|XP_009118181.1|  PREDICTED: polyadenylate-binding protein RBP...    139   7e-36   Brassica rapa
ref|XP_003610418.1|  RNA-binding protein                                138   8e-36   
gb|KHN37596.1|  Polyadenylate-binding protein RBP45B                    139   9e-36   Glycine soja [wild soybean]
emb|CDY34835.1|  BnaA09g47610D                                          139   1e-35   Brassica napus [oilseed rape]
ref|NP_849641.1|  polyadenylate-binding protein RBP45B                  137   1e-35   Arabidopsis thaliana [mouse-ear cress]
gb|KEH36836.1|  polyadenylate-binding protein RBP47B                    139   1e-35   Medicago truncatula
gb|KJB22074.1|  hypothetical protein B456_004G028000                    139   1e-35   Gossypium raimondii
ref|XP_006413118.1|  hypothetical protein EUTSA_v10025342mg             139   1e-35   Eutrema salsugineum [saltwater cress]
ref|XP_007020874.1|  RNA-binding family protein                         139   2e-35   
ref|XP_010276065.1|  PREDICTED: polyadenylate-binding protein RBP...    139   2e-35   Nelumbo nucifera [Indian lotus]
ref|XP_007015035.1|  RNA-binding family protein isoform 3               139   2e-35   
ref|XP_007015034.1|  RNA-binding family protein isoform 2               139   2e-35   
ref|XP_007209154.1|  hypothetical protein PRUPE_ppa005940mg             139   2e-35   Prunus persica
gb|KFK26199.1|  hypothetical protein AALP_AA8G215500                    139   2e-35   Arabis alpina [alpine rockcress]
ref|XP_010276064.1|  PREDICTED: polyadenylate-binding protein RBP...    139   2e-35   Nelumbo nucifera [Indian lotus]
emb|CDY34639.1|  BnaC08g41980D                                          139   2e-35   Brassica napus [oilseed rape]
ref|XP_009420609.1|  PREDICTED: polyadenylate-binding protein RBP45     139   2e-35   
ref|XP_003610417.1|  RNA-binding protein                                138   3e-35   Medicago truncatula
ref|XP_010062999.1|  PREDICTED: polyadenylate-binding protein RBP45C    138   3e-35   Eucalyptus grandis [rose gum]
ref|XP_002285479.1|  PREDICTED: polyadenylate-binding protein RBP...    139   3e-35   Vitis vinifera
ref|XP_003546146.1|  PREDICTED: polyadenylate-binding protein RBP...    138   3e-35   Glycine max [soybeans]
emb|CBI16387.3|  unnamed protein product                                138   3e-35   Vitis vinifera
ref|XP_006594429.1|  PREDICTED: polyadenylate-binding protein RBP...    136   4e-35   Glycine max [soybeans]
ref|XP_008437079.1|  PREDICTED: polyadenylate-binding protein RBP...    138   4e-35   Cucumis melo [Oriental melon]
ref|XP_007132012.1|  hypothetical protein PHAVU_011G059300g             137   4e-35   Phaseolus vulgaris [French bean]
ref|XP_004152401.1|  PREDICTED: polyadenylate-binding protein RBP...    137   4e-35   Cucumis sativus [cucumbers]
ref|XP_008437076.1|  PREDICTED: polyadenylate-binding protein RBP...    137   5e-35   Cucumis melo [Oriental melon]
gb|KFK27101.1|  hypothetical protein AALP_AA8G334500                    137   5e-35   Arabis alpina [alpine rockcress]
ref|XP_004164285.1|  PREDICTED: LOW QUALITY PROTEIN: polyadenylat...    137   5e-35   
gb|KFK27100.1|  hypothetical protein AALP_AA8G334500                    137   5e-35   Arabis alpina [alpine rockcress]
ref|XP_010448184.1|  PREDICTED: polyadenylate-binding protein RBP...    137   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008437078.1|  PREDICTED: polyadenylate-binding protein RBP...    137   5e-35   Cucumis melo [Oriental melon]
ref|XP_010438672.1|  PREDICTED: polyadenylate-binding protein RBP45C    137   5e-35   Camelina sativa [gold-of-pleasure]
ref|XP_009412453.1|  PREDICTED: polyadenylate-binding protein RBP45     138   5e-35   Musa acuminata subsp. malaccensis [pisang utan]
gb|KGN50253.1|  hypothetical protein Csa_5G162020                       137   5e-35   Cucumis sativus [cucumbers]
ref|XP_002316998.2|  RNA-binding protein 45                             137   6e-35   Populus trichocarpa [western balsam poplar]
ref|XP_003597428.1|  RNA-binding protein                                137   6e-35   Medicago truncatula
gb|AFK41944.1|  unknown                                                 137   6e-35   Medicago truncatula
ref|XP_011030800.1|  PREDICTED: polyadenylate-binding protein RBP...    137   7e-35   Populus euphratica
ref|NP_001078604.1|  polyadenylate-binding protein RBP47B'              137   7e-35   Arabidopsis thaliana [mouse-ear cress]
ref|NP_197436.1|  polyadenylate-binding protein RBP47B'                 137   8e-35   Arabidopsis thaliana [mouse-ear cress]
ref|XP_011025522.1|  PREDICTED: polyadenylate-binding protein RBP...    137   8e-35   Populus euphratica
ref|XP_002871881.1|  hypothetical protein ARALYDRAFT_488820             137   8e-35   
ref|XP_002313332.2|  hypothetical protein POPTR_0009s05920g             137   9e-35   
dbj|BAE71189.1|  putative DNA binding protein                           134   9e-35   Trifolium pratense [peavine clover]
ref|XP_010454207.1|  PREDICTED: polyadenylate-binding protein RBP...    137   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_008812246.1|  PREDICTED: polyadenylate-binding protein RBP...    137   9e-35   Phoenix dactylifera
ref|XP_009406503.1|  PREDICTED: polyadenylate-binding protein RBP...    137   9e-35   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010458570.1|  PREDICTED: polyadenylate-binding protein RBP45B    137   9e-35   Camelina sativa [gold-of-pleasure]
ref|XP_010495305.1|  PREDICTED: polyadenylate-binding protein RBP...    137   9e-35   Camelina sativa [gold-of-pleasure]
ref|NP_172630.1|  polyadenylate-binding protein RBP45B                  137   1e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009406502.1|  PREDICTED: polyadenylate-binding protein RBP...    137   1e-34   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010052834.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-34   Eucalyptus grandis [rose gum]
ref|XP_010108648.1|  Polyadenylate-binding protein RBP47B'              137   1e-34   
ref|XP_004486120.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-34   Cicer arietinum [garbanzo]
ref|XP_002280601.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-34   Vitis vinifera
gb|KHG09232.1|  Polyadenylate-binding RBP47B' -like protein             136   1e-34   Gossypium arboreum [tree cotton]
ref|XP_010493089.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010433418.1|  PREDICTED: polyadenylate-binding protein RBP45C    136   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_010476096.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-34   Camelina sativa [gold-of-pleasure]
gb|KDP22083.1|  hypothetical protein JCGZ_25914                         136   1e-34   Jatropha curcas
ref|XP_010476097.1|  PREDICTED: polyadenylate-binding protein RBP...    136   1e-34   Camelina sativa [gold-of-pleasure]
ref|XP_008796097.1|  PREDICTED: polyadenylate-binding protein RBP45     136   2e-34   Phoenix dactylifera
ref|XP_006283830.1|  hypothetical protein CARUB_v10004931mg             136   2e-34   Capsella rubella
ref|XP_009376881.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-34   Pyrus x bretschneideri [bai li]
gb|AEW68341.1|  putative nuclear acid binding protein                   136   2e-34   Medicago sativa [alfalfa]
ref|XP_008345010.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-34   Malus domestica [apple tree]
ref|XP_008377253.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-34   Malus domestica [apple tree]
ref|XP_009375056.1|  PREDICTED: polyadenylate-binding protein RBP...    136   2e-34   Pyrus x bretschneideri [bai li]
ref|XP_003542872.1|  PREDICTED: polyadenylate-binding protein RBP...    135   2e-34   Glycine max [soybeans]
ref|XP_006307499.1|  hypothetical protein CARUB_v10009124mg             136   2e-34   
ref|XP_006401514.1|  hypothetical protein EUTSA_v10013710mg             135   2e-34   Eutrema salsugineum [saltwater cress]
ref|XP_010052833.1|  PREDICTED: polyadenylate-binding protein RBP...    134   2e-34   Eucalyptus grandis [rose gum]
emb|CDX88893.1|  BnaA03g07560D                                          136   2e-34   
ref|XP_010546929.1|  PREDICTED: polyadenylate-binding protein RBP45B    135   3e-34   Tarenaya hassleriana [spider flower]
ref|XP_006401513.1|  hypothetical protein EUTSA_v10013710mg             135   3e-34   Eutrema salsugineum [saltwater cress]
ref|XP_006400492.1|  hypothetical protein EUTSA_v10013617mg             135   3e-34   Eutrema salsugineum [saltwater cress]
ref|XP_008238181.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   
emb|CDX70874.1|  BnaC03g09580D                                          135   3e-34   
ref|XP_010665562.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010673626.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_010420736.1|  PREDICTED: polyadenylate-binding protein RBP...    135   3e-34   Camelina sativa [gold-of-pleasure]
ref|XP_002867529.1|  hypothetical protein ARALYDRAFT_913848             135   4e-34   Arabidopsis lyrata subsp. lyrata
ref|XP_006858185.1|  hypothetical protein AMTR_s00062p00161920          135   4e-34   
ref|XP_003543537.1|  PREDICTED: polyadenylate-binding protein RBP...    135   4e-34   Glycine max [soybeans]
ref|XP_009418782.1|  PREDICTED: polyadenylate-binding protein RBP...    135   5e-34   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAE71244.1|  putative DNA binding protein                           134   5e-34   Trifolium pratense [peavine clover]
ref|XP_004486967.1|  PREDICTED: polyadenylate-binding protein RBP...    135   5e-34   
ref|XP_004486966.1|  PREDICTED: polyadenylate-binding protein RBP...    135   5e-34   Cicer arietinum [garbanzo]
gb|KJB21879.1|  hypothetical protein B456_004G019500                    135   5e-34   Gossypium raimondii
gb|KJB21880.1|  hypothetical protein B456_004G019500                    135   6e-34   Gossypium raimondii
emb|CAN83958.1|  hypothetical protein VITISV_039907                     134   6e-34   Vitis vinifera
ref|XP_003543536.1|  PREDICTED: polyadenylate-binding protein RBP...    134   6e-34   Glycine max [soybeans]
gb|KHG00069.1|  Polyadenylate-binding RBP47B' -like protein             135   6e-34   Gossypium arboreum [tree cotton]
ref|XP_010092144.1|  Polyadenylate-binding protein RBP45                135   7e-34   
ref|XP_002513488.1|  nuclear acid binding protein, putative             134   7e-34   
gb|AAM64532.1|  putative DNA binding protein                            134   8e-34   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010523211.1|  PREDICTED: polyadenylate-binding protein RBP...    134   8e-34   Tarenaya hassleriana [spider flower]
ref|XP_001777334.1|  predicted protein                                  134   8e-34   
ref|XP_010938882.1|  PREDICTED: polyadenylate-binding protein RBP...    134   8e-34   Elaeis guineensis
ref|XP_010052832.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-33   Eucalyptus grandis [rose gum]
emb|CDY46671.1|  BnaA03g48370D                                          134   1e-33   Brassica napus [oilseed rape]
emb|CDX92786.1|  BnaC07g40440D                                          134   1e-33   
ref|NP_568815.1|  RNA-binding protein 45A                               133   1e-33   Arabidopsis thaliana [mouse-ear cress]
dbj|BAB08769.1|  unnamed protein product                                133   1e-33   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003518846.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-33   Glycine max [soybeans]
ref|XP_009137630.1|  PREDICTED: polyadenylate-binding protein RBP...    134   1e-33   Brassica rapa
ref|XP_008226922.1|  PREDICTED: polyadenylate-binding protein RBP45C    133   1e-33   Prunus mume [ume]
ref|XP_007156541.1|  hypothetical protein PHAVU_003G294800g             132   1e-33   Phaseolus vulgaris [French bean]
ref|XP_007156542.1|  hypothetical protein PHAVU_003G294800g             133   2e-33   Phaseolus vulgaris [French bean]
ref|XP_003529385.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-33   Glycine max [soybeans]
ref|XP_007213954.1|  hypothetical protein PRUPE_ppa006577mg             133   2e-33   Prunus persica
ref|XP_002889883.1|  ATRBP45B                                           133   2e-33   Arabidopsis lyrata subsp. lyrata
ref|XP_002522953.1|  nuclear acid binding protein, putative             133   2e-33   Ricinus communis
ref|XP_010910520.1|  PREDICTED: polyadenylate-binding protein RBP...    132   2e-33   
ref|XP_010268853.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-33   Nelumbo nucifera [Indian lotus]
gb|ABR18422.1|  unknown                                                 133   2e-33   Picea sitchensis
ref|XP_004294372.1|  PREDICTED: polyadenylate-binding protein RBP45C    133   2e-33   Fragaria vesca subsp. vesca
ref|XP_010268845.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_009131734.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-33   Brassica rapa
ref|XP_008349848.1|  PREDICTED: polyadenylate-binding protein RBP...    130   2e-33   
ref|XP_003537962.1|  PREDICTED: polyadenylate-binding protein RBP...    133   2e-33   
emb|CDY66423.1|  BnaAnng22220D                                          133   3e-33   Brassica napus [oilseed rape]
ref|XP_006287675.1|  hypothetical protein CARUB_v10000890mg             133   3e-33   
ref|XP_007150369.1|  hypothetical protein PHAVU_005G147800g             133   3e-33   Phaseolus vulgaris [French bean]
ref|XP_004505196.1|  PREDICTED: polyadenylate-binding protein RBP...    133   3e-33   Cicer arietinum [garbanzo]
ref|NP_001168324.1|  hypothetical protein                               132   3e-33   Zea mays [maize]
gb|ABK25253.1|  unknown                                                 133   4e-33   Picea sitchensis
ref|XP_006452315.1|  hypothetical protein CICLE_v10008440mg             131   4e-33   
ref|XP_009372712.1|  PREDICTED: polyadenylate-binding protein RBP...    132   4e-33   Pyrus x bretschneideri [bai li]
gb|KHN25246.1|  Polyadenylate-binding protein RBP47B'                   132   4e-33   Glycine soja [wild soybean]
ref|XP_009414748.1|  PREDICTED: polyadenylate-binding protein RBP...    132   4e-33   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_003539457.1|  PREDICTED: polyadenylate-binding protein RBP...    132   5e-33   Glycine max [soybeans]
ref|NP_001275480.1|  DNA binding protein ACBF-like                      131   5e-33   Solanum tuberosum [potatoes]
ref|XP_001784132.1|  predicted protein                                  132   6e-33   
ref|XP_009380242.1|  PREDICTED: polyadenylate-binding protein RBP...    132   6e-33   Musa acuminata subsp. malaccensis [pisang utan]
gb|ACR34003.1|  unknown                                                 132   6e-33   Zea mays [maize]
ref|NP_001152183.1|  LOC100285821                                       132   6e-33   Zea mays [maize]
ref|XP_002468416.1|  hypothetical protein SORBIDRAFT_01g045570          132   7e-33   Sorghum bicolor [broomcorn]
ref|XP_010275609.1|  PREDICTED: polyadenylate-binding protein RBP...    132   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010275610.1|  PREDICTED: polyadenylate-binding protein RBP...    131   7e-33   Nelumbo nucifera [Indian lotus]
ref|XP_004985527.1|  PREDICTED: polyadenylate-binding protein RBP...    131   8e-33   Setaria italica
ref|XP_002464324.1|  hypothetical protein SORBIDRAFT_01g016170          131   8e-33   Sorghum bicolor [broomcorn]
gb|ACN40970.1|  unknown                                                 131   8e-33   Picea sitchensis
ref|XP_010540323.1|  PREDICTED: polyadenylate-binding protein RBP47B    131   8e-33   Tarenaya hassleriana [spider flower]
gb|KJB09398.1|  hypothetical protein B456_001G139100                    130   9e-33   Gossypium raimondii
gb|KJB09397.1|  hypothetical protein B456_001G139100                    131   9e-33   Gossypium raimondii
gb|ACN39849.1|  unknown                                                 131   9e-33   Picea sitchensis
ref|XP_006845940.1|  hypothetical protein AMTR_s00157p00080130          129   1e-32   
ref|XP_004288602.1|  PREDICTED: polyadenylate-binding protein RBP...    131   1e-32   Fragaria vesca subsp. vesca
gb|KCW63816.1|  hypothetical protein EUGRSUZ_G01492                     131   1e-32   Eucalyptus grandis [rose gum]
gb|KJB09396.1|  hypothetical protein B456_001G139100                    131   1e-32   Gossypium raimondii
ref|XP_010536076.1|  PREDICTED: polyadenylate-binding protein RBP...    131   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_009352469.1|  PREDICTED: polyadenylate-binding protein RBP...    131   1e-32   Pyrus x bretschneideri [bai li]
ref|XP_010066047.1|  PREDICTED: polyadenylate-binding protein RBP47     131   1e-32   
ref|XP_010536077.1|  PREDICTED: polyadenylate-binding protein RBP...    131   1e-32   Tarenaya hassleriana [spider flower]
ref|XP_006649483.1|  PREDICTED: polyadenylate-binding protein RBP...    130   2e-32   Oryza brachyantha
ref|XP_006452313.1|  hypothetical protein CICLE_v10008440mg             130   2e-32   Citrus clementina [clementine]
ref|XP_006346456.1|  PREDICTED: polyadenylate-binding protein RBP47     130   2e-32   
ref|XP_008385660.1|  PREDICTED: polyadenylate-binding protein RBP...    130   2e-32   
ref|XP_009109155.1|  PREDICTED: polyadenylate-binding protein RBP...    130   2e-32   
ref|XP_006452314.1|  hypothetical protein CICLE_v10008440mg             130   2e-32   
ref|XP_009590296.1|  PREDICTED: polyadenylate-binding protein RBP47     130   2e-32   
gb|AAC49850.1|  DNA binding protein ACBF                                130   2e-32   
gb|KDP39118.1|  hypothetical protein JCGZ_00875                         130   2e-32   
ref|XP_004230808.1|  PREDICTED: polyadenylate-binding protein RBP47     130   2e-32   
emb|CDY14290.1|  BnaA08g14210D                                          130   2e-32   
gb|EAZ27536.1|  hypothetical protein OsJ_11491                          127   2e-32   
ref|XP_004982540.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-32   
ref|XP_008365193.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-32   
ref|XP_011461514.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-32   
emb|CDY19874.1|  BnaC09g31400D                                          130   3e-32   
emb|CAL25353.1|  ACBF-like dna binding protein                          126   3e-32   
gb|AAB92518.1|  putative RNA binding protein                            130   3e-32   
ref|XP_009120017.1|  PREDICTED: polyadenylate-binding protein RBP45A    129   3e-32   
ref|XP_004294842.1|  PREDICTED: polyadenylate-binding protein RBP...    130   3e-32   
ref|XP_004153285.1|  PREDICTED: polyadenylate-binding protein RBP...    126   3e-32   
emb|CDY17286.1|  BnaA10g09200D                                          129   4e-32   
ref|XP_009628458.1|  PREDICTED: polyadenylate-binding protein RBP...    129   5e-32   
gb|KJB79290.1|  hypothetical protein B456_013G042300                    127   5e-32   
ref|XP_009783557.1|  PREDICTED: polyadenylate-binding protein RBP...    129   5e-32   
ref|XP_009783555.1|  PREDICTED: polyadenylate-binding protein RBP...    129   6e-32   
ref|XP_008806741.1|  PREDICTED: polyadenylate-binding protein RBP45     129   6e-32   
ref|XP_002979510.1|  hypothetical protein SELMODRAFT_111082             129   7e-32   
ref|XP_002864364.1|  hypothetical protein ARALYDRAFT_495572             129   7e-32   
ref|XP_002977811.1|  hypothetical protein SELMODRAFT_232989             129   7e-32   
gb|ABF94248.1|  RNA recognition motif family protein, expressed         129   8e-32   
ref|NP_001049124.1|  Os03g0174100                                       129   8e-32   
gb|EEC74608.1|  hypothetical protein OsI_10216                          129   8e-32   
ref|XP_007015033.1|  RNA-binding family protein isoform 1               129   8e-32   
ref|XP_009404023.1|  PREDICTED: polyadenylate-binding protein RBP...    128   9e-32   
gb|EPS57677.1|  hypothetical protein M569_17140                         128   1e-31   
ref|XP_009794615.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-31   
ref|XP_009794616.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-31   
sp|Q9LEB3.1|RBP47_NICPL  RecName: Full=Polyadenylate-binding prot...    128   1e-31   
ref|XP_006349627.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-31   
ref|XP_006349628.1|  PREDICTED: polyadenylate-binding protein RBP...    128   1e-31   
emb|CBI32444.3|  unnamed protein product                                127   1e-31   
ref|XP_010327389.1|  PREDICTED: DNA-binding protein isoform X1          128   2e-31   
dbj|BAD05744.1|  putative RNA Binding Protein 45                        128   2e-31   
ref|XP_010327390.1|  PREDICTED: DNA-binding protein isoform X2          128   2e-31   
emb|CDY29263.1|  BnaC01g19150D                                          128   2e-31   
ref|NP_001234487.1|  DNA-binding protein                                128   2e-31   
gb|EEC75600.1|  hypothetical protein OsI_12307                          127   2e-31   
gb|ABK24911.1|  unknown                                                 127   2e-31   
ref|XP_006280607.1|  hypothetical protein CARUB_v10026566mg             127   2e-31   
gb|KJB47423.1|  hypothetical protein B456_008G025400                    127   2e-31   
gb|KJB47422.1|  hypothetical protein B456_008G025400                    127   2e-31   
ref|XP_010926371.1|  PREDICTED: leucine-rich repeat extensin-like...    130   2e-31   
gb|ABF97193.1|  RNA recognition motif family protein, expressed         127   2e-31   
ref|XP_010443072.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-31   
gb|AAG59664.1|AC084319_22  putative RNA binding protein                 127   2e-31   
gb|KJB79291.1|  hypothetical protein B456_013G042300                    127   2e-31   
ref|NP_001275430.1|  DNA-binding protein-like                           127   2e-31   
ref|XP_008782204.1|  PREDICTED: polyadenylate-binding protein RBP...    127   2e-31   
ref|XP_004972674.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-31   
ref|XP_004972673.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-31   
ref|XP_010482899.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-31   
gb|KEH35744.1|  polyadenylate-binding protein RBP47C                    125   3e-31   
ref|XP_007042377.1|  RNA-binding protein 47A                            127   3e-31   
gb|KJB79289.1|  hypothetical protein B456_013G042300                    127   3e-31   
ref|XP_008782206.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-31   
ref|XP_010647773.1|  PREDICTED: polyadenylate-binding protein RBP...    127   3e-31   
gb|AFW58430.1|  nucleic acid binding protein                            124   3e-31   
ref|NP_001050516.1|  Os03g0569900                                       127   3e-31   
emb|CDO97156.1|  unnamed protein product                                127   4e-31   
ref|XP_009142977.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   
ref|XP_011088289.1|  PREDICTED: polyadenylate-binding protein RBP47     127   4e-31   
ref|XP_009417617.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   
ref|XP_008792645.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   
ref|XP_009358068.1|  PREDICTED: polyadenylate-binding protein RBP...    126   4e-31   
ref|XP_008236617.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   
ref|XP_008236618.1|  PREDICTED: polyadenylate-binding protein RBP...    127   4e-31   
ref|XP_007199852.1|  hypothetical protein PRUPE_ppa005661mg             127   4e-31   
gb|KDP23018.1|  hypothetical protein JCGZ_01681                         127   5e-31   
gb|EYU37704.1|  hypothetical protein MIMGU_mgv1a006826mg                127   5e-31   
ref|XP_008392304.1|  PREDICTED: polyadenylate-binding protein RBP47     127   5e-31   
ref|XP_003608019.1|  RNA Binding Protein                                127   6e-31   
gb|AFK40720.1|  unknown                                                 126   6e-31   
gb|AIN39817.1|  hypothetical protein                                    124   6e-31   
emb|CDY28101.1|  BnaC06g02820D                                          126   6e-31   
emb|CDY50959.1|  BnaA06g37550D                                          126   6e-31   
ref|XP_004145357.1|  PREDICTED: polyadenylate-binding protein RBP...    126   7e-31   
ref|XP_009147873.1|  PREDICTED: polyadenylate-binding protein RBP47A    126   7e-31   
ref|XP_004168889.1|  PREDICTED: polyadenylate-binding protein RBP...    126   7e-31   
ref|XP_008459212.1|  PREDICTED: polyadenylate-binding protein RBP47     126   8e-31   
ref|XP_010466046.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|XP_003558701.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|XP_010487839.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|XP_010487840.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|NP_001144988.1|  uncharacterized protein LOC100278143               125   1e-30   
ref|XP_010507446.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|XP_010507452.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
ref|XP_010448802.1|  PREDICTED: polyadenylate-binding protein RBP...    125   1e-30   
emb|CDX89287.1|  BnaA01g16060D                                          125   2e-30   
ref|XP_006406534.1|  hypothetical protein EUTSA_v10020763mg             124   2e-30   
dbj|BAB02953.1|  DNA/RNA binding protein-like                           125   2e-30   
ref|XP_009135617.1|  PREDICTED: polyadenylate-binding protein RBP...    125   2e-30   
ref|XP_002885294.1|  RNA-binding protein 47B                            125   2e-30   
gb|ACF87959.1|  unknown                                                 125   2e-30   
ref|XP_002518798.1|  nuclear acid binding protein, putative             125   2e-30   
ref|XP_003603009.1|  RNA-binding protein                                125   2e-30   
ref|XP_011092726.1|  PREDICTED: polyadenylate-binding protein RBP...    125   2e-30   
ref|XP_011092727.1|  PREDICTED: polyadenylate-binding protein RBP...    124   2e-30   
gb|AAM67293.1|  nuclear acid binding protein, putative                  124   2e-30   
dbj|BAK03410.1|  predicted protein                                      125   2e-30   
gb|ACG32072.1|  nucleic acid binding protein                            124   2e-30   
gb|AFW61057.1|  hypothetical protein ZEAMMB73_234884                    123   2e-30   
ref|NP_188544.1|  RNA-binding protein 47B                               125   2e-30   
emb|CDY22988.1|  BnaC03g40810D                                          124   3e-30   
emb|CDX99265.1|  BnaC05g33800D                                          124   3e-30   
ref|XP_006393234.1|  hypothetical protein EUTSA_v10011485mg             124   3e-30   
emb|CDX92304.1|  BnaA05g21030D                                          124   3e-30   
ref|XP_002446570.1|  hypothetical protein SORBIDRAFT_06g018280          124   3e-30   
ref|NP_001150649.1|  nucleic acid binding protein                       124   4e-30   
gb|ACF85767.1|  unknown                                                 124   4e-30   
ref|XP_009356988.1|  PREDICTED: polyadenylate-binding protein RBP...    124   4e-30   
ref|XP_006660711.1|  PREDICTED: polyadenylate-binding protein RBP...    123   4e-30   
ref|XP_009145825.1|  PREDICTED: polyadenylate-binding protein RBP...    124   4e-30   
emb|CDY16528.1|  BnaA08g02390D                                          124   4e-30   
ref|XP_002963882.1|  hypothetical protein SELMODRAFT_80061              123   5e-30   
ref|XP_009107272.1|  PREDICTED: polyadenylate-binding protein RBP...    124   5e-30   
ref|XP_003580589.1|  PREDICTED: polyadenylate-binding protein RBP...    124   5e-30   
gb|EYU42664.1|  hypothetical protein MIMGU_mgv1a008163mg                123   5e-30   
ref|XP_003573391.1|  PREDICTED: polyadenylate-binding protein RBP...    124   5e-30   
ref|XP_002973844.1|  hypothetical protein SELMODRAFT_100454             123   6e-30   
ref|XP_010240455.1|  PREDICTED: polyadenylate-binding protein RBP...    124   6e-30   
ref|XP_009145104.1|  PREDICTED: polyadenylate-binding protein RBP...    123   6e-30   
ref|NP_001132004.1|  uncharacterized protein LOC100193409               123   6e-30   
emb|CDY29341.1|  BnaA05g16080D                                          123   7e-30   
ref|NP_175383.1|  RNA-binding protein 47A                               124   7e-30   
ref|NP_001141359.1|  uncharacterized protein LOC100273450               123   7e-30   
ref|XP_004957051.1|  PREDICTED: polyadenylate-binding protein RBP...    123   7e-30   
ref|NP_001063403.1|  Os09g0462700                                       123   7e-30   
gb|AFW61056.1|  hypothetical protein ZEAMMB73_234884                    123   8e-30   
gb|AAG13046.1|AC011807_5  Putative RNA binding protein                  123   8e-30   
ref|XP_006406535.1|  hypothetical protein EUTSA_v10020763mg             123   8e-30   
ref|XP_006297696.1|  hypothetical protein CARUB_v10013726mg             123   8e-30   
ref|XP_004975779.1|  PREDICTED: polyadenylate-binding protein RBP...    123   8e-30   
ref|XP_006297697.1|  hypothetical protein CARUB_v10013726mg             123   8e-30   
ref|XP_008676816.1|  PREDICTED: uncharacterized protein LOC100273...    123   8e-30   
emb|CDY32840.1|  BnaC08g02620D                                          123   8e-30   
ref|XP_010668311.1|  PREDICTED: polyadenylate-binding protein RBP...    123   8e-30   
ref|XP_006659900.1|  PREDICTED: polyadenylate-binding protein RBP...    123   9e-30   
ref|XP_002894197.1|  hypothetical protein ARALYDRAFT_474095             123   9e-30   
ref|XP_010500505.1|  PREDICTED: polyadenylate-binding protein RBP...    123   9e-30   
gb|KFK39248.1|  hypothetical protein AALP_AA3G219800                    123   9e-30   
ref|XP_010479396.1|  PREDICTED: polyadenylate-binding protein RBP...    123   9e-30   
gb|KFK39249.1|  hypothetical protein AALP_AA3G219800                    123   9e-30   
ref|XP_002313840.2|  RNA-binding protein 47                             123   9e-30   
gb|EMS68789.1|  Uncharacterized RNA-binding protein C23E6.01c           122   9e-30   
ref|XP_003549410.2|  PREDICTED: polyadenylate-binding protein RBP...    123   1e-29   
ref|XP_010461802.1|  PREDICTED: polyadenylate-binding protein RBP...    123   1e-29   
ref|XP_006653468.1|  PREDICTED: polyadenylate-binding protein RBP...    123   1e-29   
dbj|BAG87507.1|  unnamed protein product                                122   1e-29   
ref|XP_009390905.1|  PREDICTED: polyadenylate-binding protein RBP...    122   1e-29   
ref|XP_002447134.1|  hypothetical protein SORBIDRAFT_06g029180          123   1e-29   
gb|KFK35996.1|  hypothetical protein AALP_AA4G064500                    123   1e-29   
emb|CDX95462.1|  BnaC01g33540D                                          123   1e-29   
ref|XP_008667171.1|  PREDICTED: uncharacterized protein LOC100193...    122   1e-29   
gb|KJB63806.1|  hypothetical protein B456_010G017300                    122   1e-29   
gb|KDO49118.1|  hypothetical protein CISIN_1g013061mg                   122   1e-29   
ref|XP_003578248.1|  PREDICTED: polyadenylate-binding protein RBP...    122   1e-29   
ref|XP_008220171.1|  PREDICTED: polyadenylate-binding protein RBP...    122   1e-29   
ref|XP_003579863.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
ref|XP_008220170.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
ref|XP_004976877.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
ref|XP_007222286.1|  hypothetical protein PRUPE_ppa005903mg             122   2e-29   
gb|KDO49120.1|  hypothetical protein CISIN_1g013061mg                   121   2e-29   
ref|NP_001052934.2|  Os04g0449900                                       122   2e-29   
emb|CDY18570.1|  BnaA01g26250D                                          122   2e-29   
ref|XP_009112131.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
gb|KDO49121.1|  hypothetical protein CISIN_1g013061mg                   121   2e-29   
ref|XP_006307519.1|  hypothetical protein CARUB_v10009142mg             122   2e-29   
ref|XP_009112124.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
dbj|BAJ85879.1|  predicted protein                                      122   2e-29   
gb|EAY94326.1|  hypothetical protein OsI_16094                          122   2e-29   
emb|CAH67097.1|  H0818E04.14                                            122   2e-29   
ref|XP_002285031.1|  PREDICTED: polyadenylate-binding protein RBP...    122   2e-29   
ref|XP_007160823.1|  hypothetical protein PHAVU_001G019600g             122   2e-29   
ref|XP_002510266.1|  nuclear acid binding protein, putative             122   2e-29   
ref|XP_002500674.1|  predicted protein                                  122   2e-29   
ref|XP_002988285.1|  hypothetical protein SELMODRAFT_447249             121   2e-29   
gb|KDO49119.1|  hypothetical protein CISIN_1g013061mg                   121   2e-29   
ref|XP_006423053.1|  hypothetical protein CICLE_v10028454mg             121   2e-29   
ref|XP_006374988.1|  RNA-binding protein 47                             122   2e-29   
dbj|BAJ93453.1|  predicted protein                                      122   3e-29   
ref|XP_010907889.1|  PREDICTED: polyadenylate-binding protein RBP47     121   3e-29   
gb|KHG27259.1|  Polyadenylate-binding RBP47                             121   3e-29   
ref|XP_011030480.1|  PREDICTED: polyadenylate-binding protein RBP...    121   3e-29   
ref|XP_011030472.1|  PREDICTED: polyadenylate-binding protein RBP...    121   3e-29   
ref|XP_011030463.1|  PREDICTED: polyadenylate-binding protein RBP...    121   3e-29   
ref|XP_008813039.1|  PREDICTED: polyadenylate-binding protein RBP...    120   3e-29   
ref|XP_008813037.1|  PREDICTED: polyadenylate-binding protein RBP...    120   4e-29   
gb|KDO49116.1|  hypothetical protein CISIN_1g013061mg                   121   4e-29   
ref|XP_006480131.1|  PREDICTED: polyadenylate-binding protein RBP...    121   4e-29   
ref|XP_006423054.1|  hypothetical protein CICLE_v10028454mg             121   4e-29   
ref|XP_003544447.1|  PREDICTED: polyadenylate-binding protein RBP...    121   4e-29   
gb|KJB63805.1|  hypothetical protein B456_010G017300                    121   5e-29   
ref|XP_007017334.1|  RNA-binding protein 47C isoform 6                  119   5e-29   
ref|XP_008797245.1|  PREDICTED: polyadenylate-binding protein RBP...    120   5e-29   
gb|KJB32440.1|  hypothetical protein B456_005G240800                    119   5e-29   
gb|KJB32439.1|  hypothetical protein B456_005G240800                    119   6e-29   
gb|KDO84283.1|  hypothetical protein CISIN_1g037458mg                   117   6e-29   
gb|KJB32436.1|  hypothetical protein B456_005G240800                    119   6e-29   
gb|AFW59518.1|  hypothetical protein ZEAMMB73_768040                    119   7e-29   
dbj|BAJ85753.1|  predicted protein                                      120   7e-29   
gb|KHN22302.1|  Polyadenylate-binding protein RBP47C                    120   7e-29   
ref|XP_003528246.1|  PREDICTED: polyadenylate-binding protein RBP...    120   7e-29   
ref|NP_001168401.1|  hypothetical protein                               120   7e-29   
gb|KJB32437.1|  hypothetical protein B456_005G240800                    120   8e-29   
ref|XP_006384437.1|  hypothetical protein POPTR_0004s15080g             120   8e-29   
ref|XP_008813036.1|  PREDICTED: polyadenylate-binding protein RBP...    120   9e-29   
gb|KDP38389.1|  hypothetical protein JCGZ_04314                         120   9e-29   
ref|XP_006354957.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   
ref|XP_004238180.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   
gb|KCW68769.1|  hypothetical protein EUGRSUZ_F02369                     120   1e-28   
dbj|BAJ87828.1|  predicted protein                                      120   1e-28   
ref|XP_009367486.1|  PREDICTED: polyadenylate-binding protein RBP...    120   1e-28   



>ref|XP_010327242.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Solanum lycopersicum]
Length=354

 Score =   157 bits (396),  Expect = 1e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  70   TSADEVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  130  AERNLQAYNGTLMPNIEQNFRLNWASLG  157



>ref|XP_009631417.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nicotiana tomentosiformis]
Length=396

 Score =   157 bits (396),  Expect = 2e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIRSLWIGDLQ+WMDE YL+ CF  +GEVV+AKVIRNKQT QSEGYGF+EF +HAA
Sbjct  67   TTADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAA  126

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  127  AERNLQAYNGTLMPNTEQNFRLNWASLG  154



>ref|XP_009631416.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana tomentosiformis]
Length=398

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIRSLWIGDLQ+WMDE YL+ CF  +GEVV+AKVIRNKQT QSEGYGF+EF +HAA
Sbjct  67   TTADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAA  126

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  127  AERNLQAYNGTLMPNTEQNFRLNWASLG  154



>ref|XP_004232721.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=413

 Score =   157 bits (397),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADEIRSLWIGDLQ+WMDE YL+ CF  +GEV SAKVIRNKQ+ QSEGYGFIEF++HAA
Sbjct  73   TSADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAA  132

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  133  AERNLQAYNGTLMPNIEQNFRLNWASLG  160



>ref|XP_009631415.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana tomentosiformis]
Length=399

 Score =   157 bits (396),  Expect = 3e-42, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 79/88 (90%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIRSLWIGDLQ+WMDE YL+ CF  +GEVV+AKVIRNKQT QSEGYGF+EF +HAA
Sbjct  67   TTADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFVEFNSHAA  126

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  127  AERNLQAYNGTLMPNTEQNFRLNWASLG  154



>ref|XP_009776437.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=414

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADEIR+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  74   TSADEIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  133

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  134  AERNLQAYNGTLMPNIEQNFRLNWASLG  161



>ref|XP_009776429.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=415

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADEIR+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  74   TSADEIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  133

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  134  AERNLQAYNGTLMPNIEQNFRLNWASLG  161



>ref|XP_009614215.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=415

 Score =   156 bits (395),  Expect = 5e-42, Method: Compositional matrix adjust.
 Identities = 72/88 (82%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADEIR+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  74   TSADEIRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  133

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  134  AERNLQAYNGTLMPNIEQNFRLNWASLG  161



>ref|XP_010327241.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum lycopersicum]
Length=411

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  70   TSADEVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  130  AERNLQAYNGTLMPNIEQNFRLNWASLG  157



>ref|XP_004248403.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum lycopersicum]
Length=410

 Score =   156 bits (394),  Expect = 7e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  70   TSADEVRTLWIGDLQFWMDEQYLYSCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  130  AERNLQAYNGTLMPNIEQNFRLNWASLG  157



>ref|XP_006352618.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Solanum tuberosum]
Length=411

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  71   TSADEVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  130

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  131  AERNLQAYNGTLMPNIEQNFRLNWASLG  158



>ref|XP_006352617.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Solanum tuberosum]
Length=412

 Score =   155 bits (393),  Expect = 8e-42, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQ+WMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAA
Sbjct  71   TSADEVRTLWIGDLQFWMDEQYLYNCFAQTGEVVSAKVIRNKQTQQSEGYGFIEFNSHAA  130

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  131  AERNLQAYNGTLMPNIEQNFRLNWASLG  158



>ref|XP_006348103.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=413

 Score =   155 bits (391),  Expect = 2e-41, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DEIRSLWIGDLQ+WMDE Y++ CF  +GEV SAKVIRNKQ+ QSEGYGFIEF++HAA
Sbjct  73   TSVDEIRSLWIGDLQFWMDEQYILNCFAQTGEVTSAKVIRNKQSGQSEGYGFIEFISHAA  132

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQ YNGT MPN +QNFRLNWASLG
Sbjct  133  AERNLQAYNGTLMPNIEQNFRLNWASLG  160



>ref|XP_009789022.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
sylvestris]
Length=413

 Score =   154 bits (389),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 71/88 (81%), Positives = 77/88 (88%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADEIRSLWIGDLQ+WMDE Y+  CF  +GEVVS KVIRNKQT QSEGYGFIEF++HAA
Sbjct  70   TSADEIRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AEKNLQTYNGT MPN +Q FRLNWAS G
Sbjct  130  AEKNLQTYNGTLMPNIEQPFRLNWASPG  157



>emb|CDP04386.1| unnamed protein product [Coffea canephora]
Length=278

 Score =   151 bits (381),  Expect = 4e-41, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 77/87 (89%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            ++D IRSLWIGDLQYWMDE YL+ CF  +GEV+SAKVIRNKQT QSEGYGFIEF++HA A
Sbjct  75   ASDGIRSLWIGDLQYWMDEQYLLSCFSQTGEVLSAKVIRNKQTGQSEGYGFIEFVSHAGA  134

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+NLQ YNGT MPN +Q+FRLNWAS+G
Sbjct  135  ERNLQAYNGTLMPNVEQHFRLNWASMG  161



>ref|XP_009772575.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nicotiana sylvestris]
Length=410

 Score =   153 bits (387),  Expect = 6e-41, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIRSLWIGDLQ+WMDE YL+ CF  +GEVV+AKVIRNKQT QSEGYGFIEF +HAA
Sbjct  70   TTADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NL  YNGT MPN +QNFRLNWASLG
Sbjct  130  AERNLLAYNGTLMPNIEQNFRLNWASLG  157



>ref|XP_009772574.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nicotiana sylvestris]
Length=411

 Score =   153 bits (387),  Expect = 7e-41, Method: Compositional matrix adjust.
 Identities = 70/88 (80%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIRSLWIGDLQ+WMDE YL+ CF  +GEVV+AKVIRNKQT QSEGYGFIEF +HAA
Sbjct  70   TTADEIRSLWIGDLQFWMDEQYLLNCFAQTGEVVNAKVIRNKQTGQSEGYGFIEFNSHAA  129

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NL  YNGT MPN +QNFRLNWASLG
Sbjct  130  AERNLLAYNGTLMPNIEQNFRLNWASLG  157



>ref|XP_009595795.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nicotiana 
tomentosiformis]
Length=409

 Score =   151 bits (382),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 69/88 (78%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+RSLWIGDLQ+WMDE Y+  CF  +GEVVS KVIRNKQT QSEGYGFIEF++HAA
Sbjct  68   TSADELRSLWIGDLQFWMDEQYIHNCFAHTGEVVSVKVIRNKQTGQSEGYGFIEFISHAA  127

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AEKNLQ YNGT MPN +Q FRLNWAS G
Sbjct  128  AEKNLQAYNGTLMPNIEQPFRLNWASPG  155



>ref|XP_004234481.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
lycopersicum]
Length=405

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS+DEIRSLWIGDLQ+WMDE Y+  CF  +GEV S KVIRNKQ+ QSEGYGF+EF++HAA
Sbjct  66   TSSDEIRSLWIGDLQFWMDEQYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAA  125

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQTYNG+ MPN++Q FRLNWASLG
Sbjct  126  AERNLQTYNGSMMPNSEQPFRLNWASLG  153



>ref|XP_006343293.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=411

 Score =   151 bits (381),  Expect = 4e-40, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 78/88 (89%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS+DEIRSLWIGDLQ+WMDE Y+  CF  +GEV S KVIRNKQ+ QSEGYGF+EF++HAA
Sbjct  72   TSSDEIRSLWIGDLQFWMDEPYIQNCFAHTGEVASVKVIRNKQSGQSEGYGFVEFISHAA  131

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+NLQTYNG+ MPN++Q FRLNWASLG
Sbjct  132  AERNLQTYNGSMMPNSEQPFRLNWASLG  159



>ref|XP_009795696.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana sylvestris]
Length=409

 Score =   151 bits (381),  Expect = 5e-40, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+RSLWIGDLQYWMDE+YL  CFY +GE+VSAKVIRNKQT QSEGYGF+EF +HAAAE 
Sbjct  81   NEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAET  140

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MPN +QNFR+NWASLG
Sbjct  141  ILQTYNGTLMPNVEQNFRMNWASLG  165



>sp|Q9LEB4.1|RBP45_NICPL RecName: Full=Polyadenylate-binding protein RBP45; Short=Poly(A)-binding 
protein RBP45; AltName: Full=RNA-binding protein 
45; Short=NplRBP45 [Nicotiana plumbaginifolia]
 emb|CAC01237.1| RNA Binding Protein 45 [Nicotiana plumbaginifolia]
Length=409

 Score =   150 bits (380),  Expect = 6e-40, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+RSLWIGDLQYWMDE+YL  CFY +GE+VSAKVIRNKQT QSEGYGF+EF +HAAAE 
Sbjct  81   NEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAET  140

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MPN +QNFR+NWASLG
Sbjct  141  ILQTYNGTLMPNVEQNFRMNWASLG  165



>ref|XP_009600135.1| PREDICTED: polyadenylate-binding protein RBP45 [Nicotiana tomentosiformis]
Length=410

 Score =   150 bits (380),  Expect = 7e-40, Method: Compositional matrix adjust.
 Identities = 67/85 (79%), Positives = 76/85 (89%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+RSLWIGDLQYWMDE+YL  CFY +GE+VSAKVIRNKQT QSEGYGF+EF +HAAAE 
Sbjct  82   NEVRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQTGQSEGYGFLEFRSHAAAET  141

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MPN +QNFR+NWASLG
Sbjct  142  ILQTYNGTLMPNVEQNFRMNWASLG  166



>ref|XP_011037672.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Populus 
euphratica]
Length=280

 Score =   147 bits (372),  Expect = 8e-40, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S K+IRNKQTSQ EGYGFIE  +H AA
Sbjct  72   TADEVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  132  ERILQTYNGTPMPNGEQNFRLNWASF  157



>ref|XP_010101438.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
 gb|EXB88421.1| Polyadenylate-binding protein RBP45B [Morus notabilis]
Length=398

 Score =   150 bits (378),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 76/88 (86%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWM+E+YL  CF  +GEVVS KVIRNKQT QSEGYGFIEF++  A
Sbjct  59   TSADEVRTLWIGDLQYWMEENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRPA  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQT+NG+PMPN  QNFRLNWAS G
Sbjct  119  AERALQTFNGSPMPNGAQNFRLNWASAG  146



>ref|XP_011096084.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Sesamum 
indicum]
Length=422

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            D IRSLWIGDLQYWMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAAAE+
Sbjct  84   DGIRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAER  143

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
            NLQTYNG+ MPN +Q FRLNWAS+G
Sbjct  144  NLQTYNGSLMPNVEQTFRLNWASMG  168



>ref|XP_011096085.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Sesamum 
indicum]
Length=420

 Score =   150 bits (379),  Expect = 1e-39, Method: Compositional matrix adjust.
 Identities = 68/85 (80%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            D IRSLWIGDLQYWMDE YL  CF  +GEVVSAKVIRNKQT QSEGYGFIEF +HAAAE+
Sbjct  84   DGIRSLWIGDLQYWMDEQYLYNCFAATGEVVSAKVIRNKQTGQSEGYGFIEFASHAAAER  143

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
            NLQTYNG+ MPN +Q FRLNWAS+G
Sbjct  144  NLQTYNGSLMPNVEQTFRLNWASMG  168



>ref|XP_011037673.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X4 [Populus 
euphratica]
Length=273

 Score =   146 bits (369),  Expect = 2e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S K+IRNKQTSQ EGYGFIE  +H AA
Sbjct  72   TADEVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  132  ERILQTYNGTPMPNGEQNFRLNWASF  157



>ref|XP_010278713.1| PREDICTED: polyadenylate-binding protein RBP45-like [Nelumbo 
nucifera]
Length=310

 Score =   147 bits (370),  Expect = 3e-39, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWM+E Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   A
Sbjct  91   TSADEVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPA  150

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MPNA+QNFRLNWAS G
Sbjct  151  AERILQTYNGTLMPNAEQNFRLNWASFG  178



>ref|XP_011037671.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Populus 
euphratica]
Length=321

 Score =   147 bits (370),  Expect = 4e-39, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S K+IRNKQTSQ EGYGFIE  +H AA
Sbjct  72   TADEVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  132  ERILQTYNGTPMPNGEQNFRLNWASF  157



>ref|XP_011097972.1| PREDICTED: polyadenylate-binding protein RBP45-like [Sesamum 
indicum]
Length=376

 Score =   147 bits (372),  Expect = 6e-39, Method: Compositional matrix adjust.
 Identities = 66/85 (78%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE+RSLWIGDLQYWMDE+YL  CFY +GE+VSAK+IRNKQT QSEGYGF+EF  HA AE 
Sbjct  49   DEVRSLWIGDLQYWMDENYLTSCFYHTGELVSAKIIRNKQTGQSEGYGFLEFRTHATAEN  108

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPNA Q FRLNWASLG
Sbjct  109  ILQTYNGAMMPNADQTFRLNWASLG  133



>gb|EYU33637.1| hypothetical protein MIMGU_mgv1a007175mg [Erythranthe guttata]
Length=416

 Score =   148 bits (373),  Expect = 8e-39, Method: Compositional matrix adjust.
 Identities = 67/86 (78%), Positives = 75/86 (87%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DEIRSLWIGDLQYWMDE+YL  CFY +GE+VSAKVIRNKQ+ QSEGYGF+EF  HAAAE
Sbjct  75   VDEIRSLWIGDLQYWMDENYLNTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRTHAAAE  134

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
              LQTYNG  MPNA+Q+FR+NWASLG
Sbjct  135  TILQTYNGAMMPNAEQSFRMNWASLG  160



>ref|XP_004153512.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Cucumis sativus]
Length=176

 Score =   141 bits (356),  Expect = 1e-38, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_008349308.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X3 [Malus domestica]
Length=238

 Score =   143 bits (360),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E+YL   F  +GEVVS KVIRNKQT QSEGYGFIEF + AAA
Sbjct  31   SADEVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAA  90

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NGTPMPN  QNFRLNWAS G
Sbjct  91   ERVLQAFNGTPMPNGAQNFRLNWASTG  117



>ref|XP_004244127.1| PREDICTED: polyadenylate-binding protein RBP45 [Solanum lycopersicum]
Length=410

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 74/85 (87%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+RSLWIGDLQYWMDE YL  CFY +GE+VSAKVIRNKQ+ QSEGYGF+EF +HAAAE 
Sbjct  78   NEVRSLWIGDLQYWMDESYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAET  137

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPN +QNFR+NWASLG
Sbjct  138  VLQTYNGALMPNVEQNFRMNWASLG  162



>ref|XP_006346222.1| PREDICTED: polyadenylate-binding protein RBP45-like [Solanum 
tuberosum]
Length=414

 Score =   147 bits (370),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 65/85 (76%), Positives = 75/85 (88%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+RSLWIGDLQYWMDE+YL  CFY +GE+VSAKVIRNKQ+ QSEGYGF+EF +HAAAE 
Sbjct  82   NELRSLWIGDLQYWMDENYLSTCFYHTGELVSAKVIRNKQSGQSEGYGFLEFRSHAAAET  141

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPN +QNFR+NWASLG
Sbjct  142  VLQTYNGALMPNVEQNFRMNWASLG  166



>ref|XP_011037670.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Populus 
euphratica]
Length=409

 Score =   146 bits (369),  Expect = 2e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S K+IRNKQTSQ EGYGFIE  +H AA
Sbjct  72   TADEVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIELTSHGAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  132  ERILQTYNGTPMPNGEQNFRLNWASF  157



>ref|XP_002305583.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE86094.2| RNA-binding protein 45 [Populus trichocarpa]
Length=409

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S K+IRNKQTSQ EGYGFIE  +H AA
Sbjct  72   TADEVRTLWIGDLQYWMDENYIASCFAHTGEVASVKIIRNKQTSQIEGYGFIEMTSHGAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  132  ERILQTYNGTPMPNGEQNFRLNWASF  157



>ref|XP_006449040.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62280.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=305

 Score =   144 bits (363),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQTYNGTPMPN +QNFRLNWAS G
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFG  163



>ref|XP_007153936.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
 gb|ESW25930.1| hypothetical protein PHAVU_003G077700g [Phaseolus vulgaris]
Length=398

 Score =   146 bits (368),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 67/87 (77%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A 
Sbjct  57   TSADEVRTLWIGDLQYWMDENYLYTCFAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAG  116

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNGT MPN  QNFRLNWAS 
Sbjct  117  AERILQTYNGTIMPNGGQNFRLNWASF  143



>ref|XP_010278711.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Nelumbo nucifera]
 ref|XP_010278712.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Nelumbo nucifera]
Length=423

 Score =   146 bits (369),  Expect = 3e-38, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWM+E Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   A
Sbjct  91   TSADEVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPA  150

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MPNA+QNFRLNWAS G
Sbjct  151  AERILQTYNGTLMPNAEQNFRLNWASFG  178



>gb|KJB69302.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=294

 Score =   143 bits (361),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++ AAAE
Sbjct  86   ADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAE  145

Query  473  KNLQTYNGTPMPNAQQNFRLNWASL  547
            + LQTYNGTPMPN + N+RLNWAS 
Sbjct  146  RVLQTYNGTPMPNGESNYRLNWASF  170



>gb|KDP20762.1| hypothetical protein JCGZ_21233 [Jatropha curcas]
Length=431

 Score =   146 bits (368),  Expect = 4e-38, Method: Compositional matrix adjust.
 Identities = 64/86 (74%), Positives = 73/86 (85%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SAD++R+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF +H +A
Sbjct  89   SADDVRTLWIGDLQYWMDESYLHSCFAQTGEVVNVKVIRNKQTGQVEGYGFIEFNSHGSA  148

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  149  ERVLQTYNGTPMPNGEQNFRLNWASF  174



>ref|XP_010278708.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Nelumbo nucifera]
 ref|XP_010278709.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Nelumbo nucifera]
Length=430

 Score =   146 bits (368),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 66/88 (75%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWM+E Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   A
Sbjct  91   TSADEVRTLWIGDLQYWMEESYIHSCFAHTGEVASVKVIRNKQTGQSEGYGFIEFVTRPA  150

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MPNA+QNFRLNWAS G
Sbjct  151  AERILQTYNGTLMPNAEQNFRLNWASFG  178



>ref|XP_008349307.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Malus domestica]
Length=280

 Score =   143 bits (360),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E+YL   F  +GEVVS KVIRNKQT QSEGYGFIEF + AAA
Sbjct  31   SADEVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAA  90

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NGTPMPN  QNFRLNWAS G
Sbjct  91   ERVLQAFNGTPMPNGAQNFRLNWASTG  117



>ref|XP_004158014.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=260

 Score =   142 bits (358),  Expect = 5e-38, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>gb|KJB69304.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=292

 Score =   143 bits (360),  Expect = 6e-38, Method: Compositional matrix adjust.
 Identities = 62/85 (73%), Positives = 73/85 (86%), Gaps = 0/85 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++ AAAE
Sbjct  86   ADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAAE  145

Query  473  KNLQTYNGTPMPNAQQNFRLNWASL  547
            + LQTYNGTPMPN + N+RLNWAS 
Sbjct  146  RVLQTYNGTPMPNGESNYRLNWASF  170



>ref|XP_009357435.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Pyrus x 
bretschneideri]
Length=315

 Score =   143 bits (361),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E+YL   F  +GEVVS KVIRNKQT QSEGYGFIEF + AAA
Sbjct  66   SADEVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAA  125

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NGTPMPN  QNFRLNWAS G
Sbjct  126  ERVLQAFNGTPMPNGAQNFRLNWASTG  152



>gb|KJB69305.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=286

 Score =   142 bits (359),  Expect = 7e-38, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++ AAA
Sbjct  85   NADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN + N+RLNWAS 
Sbjct  145  ERVLQTYNGTPMPNGESNYRLNWASF  170



>gb|KDO75474.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=303

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQT+NGTPMPN +QNFRLNWAS G
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFG  163



>gb|KDO75475.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
 gb|KDO75476.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=305

 Score =   143 bits (360),  Expect = 8e-38, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQT+NGTPMPN +QNFRLNWAS G
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFG  163



>ref|NP_567764.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
 sp|Q93W34.1|RP45C_ARATH RecName: Full=Polyadenylate-binding protein RBP45C; Short=Poly(A)-binding 
protein RBP45C; AltName: Full=RNA-binding protein 
45C; Short=AtRBP45C [Arabidopsis thaliana]
 gb|AAK44154.1|AF370339_1 putative DNA binding protein [Arabidopsis thaliana]
 gb|AAK96678.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAL34173.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AAM13291.1| putative DNA binding protein [Arabidopsis thaliana]
 gb|AEE85282.1| polyadenylate-binding protein RBP45C [Arabidopsis thaliana]
Length=415

 Score =   145 bits (365),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F L+GE  +AKVIRNKQ   SEGYGFIEF+NHA A
Sbjct  75   SAGEIRSLWIGDLQPWMDENYLMNVFGLTGEATAAKVIRNKQNGYSEGYGFIEFVNHATA  134

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+NLQTYNG PMP+++Q FRLNWA LG
Sbjct  135  ERNLQTYNGAPMPSSEQAFRLNWAQLG  161



>ref|XP_003529629.1| PREDICTED: polyadenylate-binding protein RBP45 [Glycine max]
Length=397

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  C   +GEV S KVIRNKQTSQSEGYGFIEF + A 
Sbjct  55   TSADEVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAG  114

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNGT MPN  QNFRLNWA+L
Sbjct  115  AERVLQTYNGTIMPNGGQNFRLNWATL  141



>gb|KHN35750.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=397

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  C   +GEV S KVIRNKQTSQSEGYGFIEF + A 
Sbjct  55   TSADEVRTLWIGDLQYWMDENYLYTCLAHTGEVASVKVIRNKQTSQSEGYGFIEFTSRAG  114

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNGT MPN  QNFRLNWA+L
Sbjct  115  AERVLQTYNGTIMPNGGQNFRLNWATL  141



>ref|XP_010675694.1| PREDICTED: polyadenylate-binding protein RBP45 [Beta vulgaris 
subsp. vulgaris]
Length=417

 Score =   144 bits (364),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ DEIRSLWIGDLQYWMDE+Y+  CF  SGEVVS K+IRNKQT+ SEGYGF+EF+N AA
Sbjct  85   STPDEIRSLWIGDLQYWMDENYVFSCFATSGEVVSVKIIRNKQTNLSEGYGFVEFVNRAA  144

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L TYNGT MP  +Q FRLNWASLG
Sbjct  145  AERTLATYNGTVMPQTEQAFRLNWASLG  172



>gb|KJB81765.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=286

 Score =   142 bits (357),  Expect = 1e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  80   EIRSLWIGDLQPWMDENYLMNIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSQAAAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPN++QNFRLNWA+LG
Sbjct  140  LQSYNGVPMPNSEQNFRLNWAALG  163



>ref|XP_004295261.2| PREDICTED: polyadenylate-binding protein RBP45B [Fragaria vesca 
subsp. vesca]
Length=410

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E YL   F  +GEVV+ KVIRNKQT+QSEGYGFIEF+N AAA
Sbjct  66   SADEVRTLWIGDLQYWMEETYLFNIFASTGEVVNVKVIRNKQTNQSEGYGFIEFVNRAAA  125

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGTPMPN  Q FRLNWAS G
Sbjct  126  ERVLQTYNGTPMPNCGQPFRLNWASAG  152



>gb|EPS64177.1| hypothetical protein M569_10604, partial [Genlisea aurea]
Length=438

 Score =   144 bits (364),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 64/83 (77%), Positives = 71/83 (86%), Gaps = 0/83 (0%)
 Frame = +2

Query  302  IRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKNL  481
            IRSLWIGDLQYWMDE YL  CF  +GEV SAKVIRN+ T QSEGYGFIEF++HAAAE+NL
Sbjct  89   IRSLWIGDLQYWMDEQYLYSCFAHTGEVASAKVIRNRHTGQSEGYGFIEFVSHAAAERNL  148

Query  482  QTYNGTPMPNAQQNFRLNWASLG  550
            QTYNG  MPN +Q FRLNWAS+G
Sbjct  149  QTYNGALMPNVEQTFRLNWASMG  171



>ref|XP_007026047.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY28669.1| RNA-binding family protein [Theobroma cacao]
Length=421

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQY+MDE+YL+ CF  +GEVVS KVIRNKQT Q EGYGFIEF++  AA
Sbjct  85   SADEVRTLWIGDLQYYMDENYLLGCFAQTGEVVSVKVIRNKQTGQVEGYGFIEFVSRGAA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN + N+RLNWAS 
Sbjct  145  ERVLQTYNGTPMPNGENNYRLNWASF  170



>ref|XP_003549897.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
 gb|KHN03463.1| Polyadenylate-binding protein RBP45 [Glycine soja]
Length=402

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  CF  +GE+ S KVIRNKQTSQSEGYGFIEF + A 
Sbjct  59   TSADEVRTLWIGDLQYWMDENYLYTCFAHTGELASVKVIRNKQTSQSEGYGFIEFTSRAG  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNGT MPN  QNFRLNWA+ 
Sbjct  119  AERVLQTYNGTIMPNGGQNFRLNWATF  145



>emb|CAB36546.1| putative DNA binding protein [Arabidopsis thaliana]
 emb|CAB79555.1| putative DNA binding protein [Arabidopsis thaliana]
Length=427

 Score =   144 bits (363),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F L+GE  +AKVIRNKQ   SEGYGFIEF+NHA A
Sbjct  75   SAGEIRSLWIGDLQPWMDENYLMNVFGLTGEATAAKVIRNKQNGYSEGYGFIEFVNHATA  134

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+NLQTYNG PMP+++Q FRLNWA LG
Sbjct  135  ERNLQTYNGAPMPSSEQAFRLNWAQLG  161



>gb|KFK29206.1| hypothetical protein AALP_AA7G103000 [Arabis alpina]
Length=401

 Score =   144 bits (362),  Expect = 2e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F L+G+  SAKVIRNKQ+  SEGYGFIEF++HAAA
Sbjct  62   SAGEIRSLWIGDLQPWMDENYLMSIFALTGDAQSAKVIRNKQSGYSEGYGFIEFVSHAAA  121

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+NLQTYNG PMP+ +Q FRLNWA LG
Sbjct  122  ERNLQTYNGNPMPSCEQTFRLNWAQLG  148



>gb|KDO61276.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=394

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW DE+YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  21   EEVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAER  80

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  +QNFRLNWAS G
Sbjct  81   VLQTYNGTPMPGTEQNFRLNWASFG  105



>ref|XP_008224811.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Prunus 
mume]
Length=311

 Score =   142 bits (357),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E YL      +GE+VS KVIRNKQT+QSEGYGFIEF + AAA
Sbjct  62   SADEVRTLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAAA  121

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ+YNGTPMPN  QNFRLNWAS G
Sbjct  122  ERVLQSYNGTPMPNGAQNFRLNWASAG  148



>ref|XP_002518499.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF43886.1| nuclear acid binding protein, putative [Ricinus communis]
Length=430

 Score =   144 bits (362),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 72/86 (84%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT Q EGYGFIEF +H  A
Sbjct  84   NADEVRTLWIGDLQYWMDENYINSCFAHTGEVTSVKVIRNKQTGQVEGYGFIEFGSHGTA  143

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN +QNFRLNWAS 
Sbjct  144  ERILQTYNGTPMPNGEQNFRLNWASF  169



>ref|XP_006449039.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62279.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=406

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQTYNGTPMPN +QNFRLNWAS G
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFG  163



>ref|XP_006446110.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
 gb|ESR59350.1| hypothetical protein CICLE_v10015576mg [Citrus clementina]
Length=385

 Score =   143 bits (360),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW DE+YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  21   EEVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAER  80

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  +QNFRLNWAS G
Sbjct  81   VLQTYNGTPMPGTEQNFRLNWASFG  105



>ref|XP_006449038.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
 gb|ESR62278.1| hypothetical protein CICLE_v10015407mg [Citrus clementina]
Length=413

 Score =   143 bits (361),  Expect = 3e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQTYNGTPMPN +QNFRLNWAS G
Sbjct  140  LQTYNGTPMPNGEQNFRLNWASFG  163



>gb|KJB81762.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=328

 Score =   142 bits (357),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  80   EIRSLWIGDLQPWMDENYLMNIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSQAAAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPN++QNFRLNWA+LG
Sbjct  140  LQSYNGVPMPNSEQNFRLNWAALG  163



>gb|KDO61275.1| hypothetical protein CISIN_1g014513mg [Citrus sinensis]
Length=423

 Score =   143 bits (361),  Expect = 4e-37, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW DE+YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  21   EEVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAAER  80

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  +QNFRLNWAS G
Sbjct  81   VLQTYNGTPMPGTEQNFRLNWASFG  105



>ref|XP_006370698.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
 gb|ERP67267.1| hypothetical protein POPTR_0001s45000g [Populus trichocarpa]
Length=430

 Score =   143 bits (361),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DEI+SLWIGDLQ WMDE+Y++  F  +GEVV AKVIRNKQT   EGYGFIEF++HAAAE
Sbjct  63   GDEIKSLWIGDLQQWMDENYILSIFSTTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAE  122

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNGTPMPN++Q FRLNWA+LG
Sbjct  123  RILQTYNGTPMPNSEQTFRLNWATLG  148



>ref|XP_008349306.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Malus domestica]
Length=377

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E+YL   F  +GEVVS KVIRNKQT QSEGYGFIEF + AAA
Sbjct  31   SADEVRTLWIGDLQYWMEENYLYNIFLHTGEVVSVKVIRNKQTCQSEGYGFIEFNSRAAA  90

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NGTPMPN  QNFRLNWAS G
Sbjct  91   ERVLQAFNGTPMPNGAQNFRLNWASTG  117



>ref|XP_007211969.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
 gb|EMJ13168.1| hypothetical protein PRUPE_ppa006617mg [Prunus persica]
Length=403

 Score =   143 bits (360),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWM+E YL      +GE+VS KVIRNKQT+QSEGYGFIEF + AA
Sbjct  61   TSADEVRTLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAA  120

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ+YNGTPMPN  QNFRLNWAS G
Sbjct  121  AERVLQSYNGTPMPNGAQNFRLNWASAG  148



>gb|EYU27806.1| hypothetical protein MIMGU_mgv1a007668mg [Erythranthe guttata]
Length=399

 Score =   142 bits (359),  Expect = 5e-37, Method: Compositional matrix adjust.
 Identities = 64/85 (75%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            D ++SLWIGDLQYWMDE YL  CF  +GEVVSAKVIRNKQ+ QSEGYGFI F +HAAAE+
Sbjct  70   DGVKSLWIGDLQYWMDEQYLCSCFPAAGEVVSAKVIRNKQSGQSEGYGFIRFASHAAAER  129

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPNA+Q FRLNWAS+G
Sbjct  130  ILQTYNGALMPNAEQTFRLNWASMG  154



>gb|KJB69303.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=419

 Score =   143 bits (360),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++ AAA
Sbjct  85   NADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN + N+RLNWAS 
Sbjct  145  ERVLQTYNGTPMPNGESNYRLNWASF  170



>gb|KGN64531.1| hypothetical protein Csa_1G063550 [Cucumis sativus]
Length=369

 Score =   142 bits (358),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AAE
Sbjct  163  GDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAAE  222

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNGT MPN  QNFRLNWAS G
Sbjct  223  RVLQTYNGTAMPNGAQNFRLNWASAG  248



>ref|XP_010545222.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Tarenaya 
hassleriana]
Length=411

 Score =   142 bits (359),  Expect = 6e-37, Method: Compositional matrix adjust.
 Identities = 66/87 (76%), Positives = 75/87 (86%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F  +GE+ SAKVIR+KQT  SEGYGFIEF+NH+AA
Sbjct  72   SAGEIRSLWIGDLQSWMDENYLMSIFAHTGEIQSAKVIRSKQTGYSEGYGFIEFVNHSAA  131

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN +QNFRLNWA+LG
Sbjct  132  ERILQTYNGTQMPNTEQNFRLNWAALG  158



>gb|KCW70174.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=268

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +A EI+SLWIGDLQ  MDE YL+ CF  SGEV+SAKVIRNKQT+  EGYGFIEFM  AAA
Sbjct  59   AAAEIKSLWIGDLQPHMDETYLLNCFAHSGEVLSAKVIRNKQTALPEGYGFIEFMTRAAA  118

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN+ QNFRLNWA+LG
Sbjct  119  ERILQTYNGTLMPNSDQNFRLNWATLG  145



>gb|KEH36838.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=271

 Score =   139 bits (351),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GE+ S KVIRNKQTSQSEGYGFIEF   A A
Sbjct  55   SADEVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATA  114

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGT MPN  QN+RLNWA+ 
Sbjct  115  ERVLQTYNGTIMPNGGQNYRLNWATF  140



>gb|KJB69301.1| hypothetical protein B456_011G015300 [Gossypium raimondii]
Length=427

 Score =   143 bits (360),  Expect = 7e-37, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++ AAA
Sbjct  85   NADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRAAA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGTPMPN + N+RLNWAS 
Sbjct  145  ERVLQTYNGTPMPNGESNYRLNWASF  170



>ref|XP_004145107.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
 ref|XP_004153511.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
sativus]
Length=408

 Score =   142 bits (359),  Expect = 8e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_004145109.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Cucumis 
sativus]
Length=404

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_006850190.1| hypothetical protein AMTR_s00022p00247520 [Amborella trichopoda]
 gb|ERN11771.1| hypothetical protein AMTR_s00022p00247520 [Amborella trichopoda]
Length=451

 Score =   143 bits (360),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 61/88 (69%), Positives = 74/88 (84%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +EIR+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  39   TSVEEIRTLWIGDLQYWVDENYLHTCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  98

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGTPMP  +Q FR+NWAS G
Sbjct  99   AERILQTYNGTPMPGTEQCFRMNWASFG  126



>ref|XP_008441142.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X3 
[Cucumis melo]
Length=403

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_008441150.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X4 
[Cucumis melo]
Length=402

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_006468022.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Citrus sinensis]
 gb|KDO75472.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=406

 Score =   142 bits (358),  Expect = 9e-37, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQT+NGTPMPN +QNFRLNWAS G
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFG  163



>ref|XP_008441139.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Cucumis melo]
Length=404

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_008441138.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Cucumis melo]
Length=405

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_009120896.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Brassica 
rapa]
Length=409

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  + NFRLNWAS G
Sbjct  79   TLQTYNGTPMPGTEINFRLNWASFG  103



>ref|XP_006470600.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Citrus 
sinensis]
Length=424

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + +E+R+LWIGDLQYW DE+YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAA
Sbjct  19   TLEEVRTLWIGDLQYWFDENYLSSCFAHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAAA  78

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGTPMP  +QNFRLNWAS G
Sbjct  79   ERVLQTYNGTPMPGTEQNFRLNWASFG  105



>ref|XP_009120895.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Brassica 
rapa]
Length=419

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  + NFRLNWAS G
Sbjct  79   TLQTYNGTPMPGTEINFRLNWASFG  103



>gb|KJB81761.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
 gb|KJB81763.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=415

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  80   EIRSLWIGDLQPWMDENYLMNIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSQAAAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPN++QNFRLNWA+LG
Sbjct  140  LQSYNGVPMPNSEQNFRLNWAALG  163



>emb|CDY13992.1| BnaC09g38340D [Brassica napus]
Length=419

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  + NFRLNWAS G
Sbjct  79   TLQTYNGTPMPGTEINFRLNWASFG  103



>ref|XP_004507696.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Cicer arietinum]
Length=361

 Score =   141 bits (355),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQT+QSEGYGFIEF + A 
Sbjct  59   TSADEVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAG  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQT+NGT MPN  QNFRLNWA+ 
Sbjct  119  AERVLQTFNGTIMPNGGQNFRLNWATF  145



>ref|XP_008441163.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cucumis 
melo]
Length=407

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DE+R+LWIGDLQYWMDE+Y+  CF  +GEV S KVIRNKQT QSEGYGFIEF+   AA
Sbjct  61   NGDEVRTLWIGDLQYWMDENYIFNCFAHTGEVSSVKVIRNKQTGQSEGYGFIEFLTRPAA  120

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN  QNFRLNWAS G
Sbjct  121  ERVLQTYNGTAMPNGAQNFRLNWASAG  147



>ref|XP_006468021.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Citrus sinensis]
 gb|KDO75473.1| hypothetical protein CISIN_1g015091mg [Citrus sinensis]
Length=413

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIR+LWIGDLQYWMDE YL  CF  +GEVV+ KVIRNKQT Q EGYGFIEF++ A AE+ 
Sbjct  80   EIRTLWIGDLQYWMDETYLNTCFAHTGEVVAVKVIRNKQTGQIEGYGFIEFISRAGAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQT+NGTPMPN +QNFRLNWAS G
Sbjct  140  LQTFNGTPMPNGEQNFRLNWASFG  163



>ref|XP_011010322.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X3 [Populus euphratica]
Length=427

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DEI+SLWIGDLQ WMDE+Y++  F  +GEVV AKVIRNKQT   EGYGFIEF++HAAAE
Sbjct  63   GDEIKSLWIGDLQQWMDENYILSIFSNTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAE  122

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNGTPMPN++Q FRLNWA+LG
Sbjct  123  RILQTYNGTPMPNSEQTFRLNWATLG  148



>ref|XP_011010320.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X1 [Populus euphratica]
 ref|XP_011010321.1| PREDICTED: polyadenylate-binding protein RBP45C-like isoform 
X2 [Populus euphratica]
Length=428

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DEI+SLWIGDLQ WMDE+Y++  F  +GEVV AKVIRNKQT   EGYGFIEF++HAAAE
Sbjct  63   GDEIKSLWIGDLQQWMDENYILSIFSNTGEVVQAKVIRNKQTGYPEGYGFIEFVSHAAAE  122

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNGTPMPN++Q FRLNWA+LG
Sbjct  123  RILQTYNGTPMPNSEQTFRLNWATLG  148



>gb|KFK43438.1| hypothetical protein AALP_AA1G125300 [Arabis alpina]
Length=403

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE++L  CF  +GEVVSAKVIRNKQT Q EGYGFIEF++HAAA
Sbjct  57   TADEIRTLWIGDLQFWMDENFLFGCFAHTGEVVSAKVIRNKQTGQVEGYGFIEFVSHAAA  116

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQTYN TP+PN   Q FRLNWASL
Sbjct  117  ERALQTYNNTPIPNVPDQLFRLNWASL  143



>ref|XP_007147735.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
 gb|ESW19729.1| hypothetical protein PHAVU_006G150400g [Phaseolus vulgaris]
Length=399

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + AA
Sbjct  59   TSVDEVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAA  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNG  MPN  Q+FRLNWAS 
Sbjct  119  AERILQTYNGAIMPNGGQSFRLNWASF  145



>emb|CDX92537.1| BnaA10g15760D [Brassica napus]
Length=419

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  + NFRLNWAS G
Sbjct  79   TLQTYNGTPMPGTEINFRLNWASFG  103



>gb|KJB81764.1| hypothetical protein B456_013G160200 [Gossypium raimondii]
Length=420

 Score =   142 bits (358),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 74/84 (88%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  80   EIRSLWIGDLQPWMDENYLMNIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSQAAAERV  139

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPN++QNFRLNWA+LG
Sbjct  140  LQSYNGVPMPNSEQNFRLNWAALG  163



>gb|AGV54881.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   142 bits (357),  Expect = 1e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + AA
Sbjct  59   TSVDEVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAA  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNG  MPN  Q+FRLNWAS 
Sbjct  119  AERILQTYNGAIMPNGGQSFRLNWASF  145



>gb|KEH36837.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=284

 Score =   139 bits (350),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GE+ S KVIRNKQTSQSEGYGFIEF   A A
Sbjct  55   SADEVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATA  114

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGT MPN  QN+RLNWA+ 
Sbjct  115  ERVLQTYNGTIMPNGGQNYRLNWATF  140



>gb|AGV54456.1| RNA-binding post-transcriptional regulator csx1-like protein 
[Phaseolus vulgaris]
Length=399

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + AA
Sbjct  59   TSVDEVRTLWIGDLQYWMDENYLYTCFASTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAA  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNG  MPN  Q+FRLNWAS 
Sbjct  119  AERILQTYNGAIMPNGGQSFRLNWASF  145



>ref|XP_008224810.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Prunus 
mume]
Length=403

 Score =   141 bits (356),  Expect = 2e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWM+E YL      +GE+VS KVIRNKQT+QSEGYGFIEF + AAA
Sbjct  62   SADEVRTLWIGDLQYWMEETYLYNILVHTGELVSVKVIRNKQTTQSEGYGFIEFSSRAAA  121

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ+YNGTPMPN  QNFRLNWAS G
Sbjct  122  ERVLQSYNGTPMPNGAQNFRLNWASAG  148



>ref|XP_010265753.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Nelumbo 
nucifera]
Length=448

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DEIR+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  37   TSIDEIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAA  96

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  97   AERILQTYNGTQMPGTEQTFRLNWASFG  124



>gb|KJB13664.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=413

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ YNG PMPN++QNFRLNWA+LG
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALG  162



>gb|KJB13665.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=415

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ YNG PMPN++QNFRLNWA+LG
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALG  162



>ref|XP_010265752.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Nelumbo 
nucifera]
Length=449

 Score =   141 bits (356),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS DEIR+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  37   TSIDEIRTLWIGDLQYWVDESYLHSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHAA  96

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  97   AERILQTYNGTQMPGTEQTFRLNWASFG  124



>ref|XP_004507695.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Cicer arietinum]
Length=400

 Score =   140 bits (354),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQT+QSEGYGFIEF + A 
Sbjct  59   TSADEVRTLWIGDLQYWMDENYLYTCFSHTGEVGSIKVIRNKQTNQSEGYGFIEFTSRAG  118

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQT+NGT MPN  QNFRLNWA+ 
Sbjct  119  AERVLQTFNGTIMPNGGQNFRLNWATF  145



>gb|KJB13666.1| hypothetical protein B456_002G088100 [Gossypium raimondii]
Length=418

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ YNG PMPN++QNFRLNWA+LG
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALG  162



>gb|KHG01774.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=413

 Score =   141 bits (355),  Expect = 3e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YLM  F  +GEVVSAKVIRNKQT+  EGYGFIEF++ AAAE+ 
Sbjct  79   EIRSLWIGDLQPWMDENYLMSIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRAAAERV  138

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ YNG PMPN++QNFRLNWA+LG
Sbjct  139  LQLYNGVPMPNSEQNFRLNWAALG  162


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 27/78 (35%), Positives = 43/78 (55%), Gaps = 8/78 (10%)
 Frame = +2

Query  308  SLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKNLQT  487
            ++++G L   + ED L + F   GEVV  K+  NK        GF+++ N A+AE++L  
Sbjct  283  TIFVGGLDPSVSEDQLKQIFSQLGEVVHVKIPANKHC------GFVQYANRASAEQSLSV  336

Query  488  YNGTPMPNAQQNFRLNWA  541
             NGT +    +N RL+W 
Sbjct  337  LNGTVL--GGRNVRLSWG  352



>gb|KHG16958.1| Polyadenylate-binding RBP45B -like protein [Gossypium arboreum]
Length=465

 Score =   141 bits (355),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 72/85 (85%), Gaps = 0/85 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            ADE+R+LWIGDLQY+MDE+YL+ CF  +GEV S KVIRNKQT Q EGYGFIEF++  AAE
Sbjct  77   ADEVRTLWIGDLQYYMDENYLLSCFAQTGEVASVKVIRNKQTGQVEGYGFIEFVSRVAAE  136

Query  473  KNLQTYNGTPMPNAQQNFRLNWASL  547
            + LQTYNGTPMPN + N+RLNWAS 
Sbjct  137  RVLQTYNGTPMPNGESNYRLNWASF  161



>ref|XP_010031800.1| PREDICTED: polyadenylate-binding protein RBP47B' [Eucalyptus 
grandis]
 gb|KCW51191.1| hypothetical protein EUGRSUZ_J00778 [Eucalyptus grandis]
Length=421

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA+E+++LWIGDLQYW+DE YL  CF  +GEVVS K+IRNK T Q EGYGF+EFM+HAAA
Sbjct  17   SAEEVKTLWIGDLQYWVDESYLYGCFAHTGEVVSVKIIRNKLTGQPEGYGFVEFMSHAAA  76

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  77   ERILQTYNGTQMPGTEQTFRLNWASFG  103



>ref|XP_010923889.1| PREDICTED: polyadenylate-binding protein RBP45-like [Elaeis guineensis]
Length=432

 Score =   140 bits (354),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDLQYWMDE+YL  CF  SGEV+S K+IRNKQT QSEGYGFIEF   A+A
Sbjct  92   SADEIRTLWIGDLQYWMDENYLYGCFVQSGEVLSVKIIRNKQTGQSEGYGFIEFATRASA  151

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA+ G
Sbjct  152  ERVLQTYNGQMMPNVEQTFRLNWATSG  178



>gb|KHG22988.1| Polyadenylate-binding RBP45C -like protein [Gossypium arboreum]
Length=415

 Score =   140 bits (353),  Expect = 4e-36, Method: Compositional matrix adjust.
 Identities = 64/84 (76%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YL+  F  +GEVVSAKVIRNKQT+  EGYGFIEF++  AAE+ 
Sbjct  79   EIRSLWIGDLQPWMDENYLINIFAQTGEVVSAKVIRNKQTALPEGYGFIEFVSRVAAERV  138

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPNA+QNFRLNWASLG
Sbjct  139  LQSYNGLPMPNAEQNFRLNWASLG  162



>ref|XP_006417333.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
 gb|ESQ35686.1| hypothetical protein EUTSA_v10007819mg [Eutrema salsugineum]
Length=397

 Score =   140 bits (352),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 75/87 (86%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE++L  CF  +GEVVSAKVIRNKQT+Q EGYGFIEF++HAAA
Sbjct  58   TADEIRTLWIGDLQFWMDENFLYSCFAHTGEVVSAKVIRNKQTAQVEGYGFIEFVSHAAA  117

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQTYN TP+P    Q FRLNWASL
Sbjct  118  ERALQTYNNTPVPGLPDQLFRLNWASL  144



>dbj|BAH56983.1| AT1G11650 [Arabidopsis thaliana]
Length=271

 Score =   137 bits (345),  Expect = 5e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIR+LWIGDLQYWMDE++L  CF  +GE+VSAKVIRNKQT Q EGYGFIEF +HAA
Sbjct  56   TTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAA  115

Query  467  AEKNLQTYNGTPMPN-AQQNFRLNWASL  547
            AE+ LQT+N  P+P+   Q FRLNWASL
Sbjct  116  AERVLQTFNNAPIPSFPDQLFRLNWASL  143



>ref|XP_010930147.1| PREDICTED: polyadenylate-binding protein RBP45 [Elaeis guineensis]
Length=418

 Score =   140 bits (352),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDLQYWMDE+YL  CF  +GEV+S K+IRNKQT QSEGYGFIEF   A A
Sbjct  78   SADEIRTLWIGDLQYWMDENYLFGCFVSTGEVLSVKIIRNKQTGQSEGYGFIEFATRATA  137

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA+ G
Sbjct  138  ERVLQTYNGQMMPNIEQTFRLNWATCG  164



>ref|XP_009118182.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Brassica 
rapa]
Length=388

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE++L  CF  +GEV+S KVIRNKQTSQ EGYGFIEF++HAAA
Sbjct  55   TADEIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAA  114

Query  470  EKNLQTYNGTPMPNAQQN-FRLNWASLG  550
            E+ LQTYN TP+P    + FRLNWASLG
Sbjct  115  ERALQTYNNTPIPGLPDHLFRLNWASLG  142



>ref|XP_009118181.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Brassica 
rapa]
Length=394

 Score =   139 bits (351),  Expect = 7e-36, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE++L  CF  +GEV+S KVIRNKQTSQ EGYGFIEF++HAAA
Sbjct  55   TADEIRTLWIGDLQFWMDENFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAA  114

Query  470  EKNLQTYNGTPMPNAQQN-FRLNWASLG  550
            E+ LQTYN TP+P    + FRLNWASLG
Sbjct  115  ERALQTYNNTPIPGLPDHLFRLNWASLG  142



>ref|XP_003610418.1| RNA-binding protein [Medicago truncatula]
Length=319

 Score =   138 bits (347),  Expect = 8e-36, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            +SADE+++LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQT+QSEGYGF+EF++ A 
Sbjct  68   SSADEVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAG  127

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQT+NGT MPN  QNFRLNWA+ 
Sbjct  128  AERVLQTFNGTIMPNGGQNFRLNWATF  154



>gb|KHN37596.1| Polyadenylate-binding protein RBP45B, partial [Glycine soja]
Length=357

 Score =   139 bits (349),  Expect = 9e-36, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A A
Sbjct  7    SADEVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGA  66

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNG  MPN  Q+FRLNWA+ 
Sbjct  67   ERILQTYNGAIMPNGGQSFRLNWATF  92



>emb|CDY34835.1| BnaA09g47610D [Brassica napus]
Length=393

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 75/88 (85%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE++L  CF  +GEV+S KVIRNKQTSQ EGYGFIEF++HAAA
Sbjct  54   TADEIRTLWIGDLQFWMDENFLYGCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAA  113

Query  470  EKNLQTYNGTPMPNAQQN-FRLNWASLG  550
            E+ LQTYN TP+P    + FRLNWASLG
Sbjct  114  ERALQTYNNTPIPGLPDHLFRLNWASLG  141



>ref|NP_849641.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 gb|AEE28765.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=306

 Score =   137 bits (345),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIR+LWIGDLQYWMDE++L  CF  +GE+VSAKVIRNKQT Q EGYGFIEF +HAA
Sbjct  56   TTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAA  115

Query  467  AEKNLQTYNGTPMPN-AQQNFRLNWASL  547
            AE+ LQT+N  P+P+   Q FRLNWASL
Sbjct  116  AERVLQTFNNAPIPSFPDQLFRLNWASL  143



>gb|KEH36836.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=401

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GE+ S KVIRNKQTSQSEGYGFIEF   A A
Sbjct  55   SADEVRTLWIGDLQYWMDENYLYTCFGNTGELTSVKVIRNKQTSQSEGYGFIEFNTRATA  114

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGT MPN  QN+RLNWA+ 
Sbjct  115  ERVLQTYNGTIMPNGGQNYRLNWATF  140



>gb|KJB22074.1| hypothetical protein B456_004G028000 [Gossypium raimondii]
Length=414

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 63/84 (75%), Positives = 73/84 (87%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EIRSLWIGDLQ WMDE+YL+  F  +GEVVSAKVIRNKQ++  EGYGFIEF++  AAE+ 
Sbjct  78   EIRSLWIGDLQPWMDENYLINIFAQTGEVVSAKVIRNKQSALPEGYGFIEFVSRVAAERV  137

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQ+YNG PMPNA+QNFRLNWASLG
Sbjct  138  LQSYNGLPMPNAEQNFRLNWASLG  161



>ref|XP_006413118.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
 gb|ESQ54571.1| hypothetical protein EUTSA_v10025342mg [Eutrema salsugineum]
Length=408

 Score =   139 bits (350),  Expect = 1e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F L+GE  SAKVIRNKQ+  SEGYGFIEF++HAAA
Sbjct  65   SAGEIRSLWIGDLQPWMDENYLMSIFALTGEAQSAKVIRNKQSGYSEGYGFIEFVSHAAA  124

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MP+++Q FRLNWA LG
Sbjct  125  ERILQTYNGAQMPSSEQTFRLNWAQLG  151



>ref|XP_007020874.1| RNA-binding family protein [Theobroma cacao]
 gb|EOY12399.1| RNA-binding family protein [Theobroma cacao]
Length=417

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 74/86 (86%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            + EIRSLWIGDLQ WMDE+YL+  F  +GEV SAKVIRNKQT+  EGYGFIEF++ AAAE
Sbjct  80   SSEIRSLWIGDLQQWMDENYLINIFAHTGEVASAKVIRNKQTALPEGYGFIEFVSRAAAE  139

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQ+YNG PMPN++QNFRLNWA+LG
Sbjct  140  RVLQSYNGVPMPNSEQNFRLNWAALG  165



>ref|XP_010276065.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Nelumbo 
nucifera]
Length=417

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDLQYWM+E+YL  CF  +GEV S KVI NKQT QSEGYGFIEF+  A A
Sbjct  85   SADEIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGT MPN +QNFRLNWA+ 
Sbjct  145  ERILQTYNGTLMPNVEQNFRLNWATF  170



>ref|XP_007015035.1| RNA-binding family protein isoform 3 [Theobroma cacao]
 gb|EOY32654.1| RNA-binding family protein isoform 3 [Theobroma cacao]
Length=423

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TSLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGTPMP   Q FRLNWAS G
Sbjct  74   AERILQTYNGTPMPGTDQMFRLNWASFG  101



>ref|XP_007015034.1| RNA-binding family protein isoform 2 [Theobroma cacao]
 gb|EOY32653.1| RNA-binding family protein isoform 2 [Theobroma cacao]
Length=423

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TSLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGTPMP   Q FRLNWAS G
Sbjct  74   AERILQTYNGTPMPGTDQMFRLNWASFG  101



>ref|XP_007209154.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
 gb|EMJ10353.1| hypothetical protein PRUPE_ppa005940mg [Prunus persica]
Length=436

 Score =   139 bits (350),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  27   TSVEEVRTLWIGDLQYWVDENYLTTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  86

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +QNFRLNWAS G
Sbjct  87   AERVLHAYNGTLMPGTEQNFRLNWASFG  114



>gb|KFK26199.1| hypothetical protein AALP_AA8G215500 [Arabis alpina]
Length=429

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++H AAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHPAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGTPMP  +  FRLNWAS G
Sbjct  80   ALQTYNGTPMPGTEVTFRLNWASFG  104



>ref|XP_010276064.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Nelumbo 
nucifera]
Length=425

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDLQYWM+E+YL  CF  +GEV S KVI NKQT QSEGYGFIEF+  A A
Sbjct  85   SADEIRTLWIGDLQYWMEENYLHSCFAHTGEVASIKVIHNKQTGQSEGYGFIEFLTRAIA  144

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNGT MPN +QNFRLNWA+ 
Sbjct  145  ERILQTYNGTLMPNVEQNFRLNWATF  170



>emb|CDY34639.1| BnaC08g41980D [Brassica napus]
Length=507

 Score =   139 bits (351),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQ+WMDE +L  CF  +GEV+S KVIRNKQTSQ EGYGFIEF++HAAA
Sbjct  164  TADEIRTLWIGDLQFWMDESFLYSCFAHTGEVLSVKVIRNKQTSQVEGYGFIEFVSHAAA  223

Query  470  EKNLQTYNGTPMPNAQQN-FRLNWASLG  550
            E+ LQTYN TP+P    + FRLNWASLG
Sbjct  224  ERALQTYNNTPIPGLPDHLFRLNWASLG  251



>ref|XP_009420609.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=430

 Score =   139 bits (349),  Expect = 2e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S+DEIR+LW+GDLQYWMDE+YL  CF  +GEVVS KVIRNKQT QSEGYGFIEF++  AA
Sbjct  90   SSDEIRTLWVGDLQYWMDENYLYSCFVHTGEVVSVKVIRNKQTGQSEGYGFIEFVSRVAA  149

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            ++ LQTYNG  MPN++Q FR+NWA+ G
Sbjct  150  DRILQTYNGQIMPNSEQAFRMNWATCG  176



>ref|XP_003610417.1| RNA-binding protein [Medicago truncatula]
 gb|AES92614.1| polyadenylate-binding protein RBP47C [Medicago truncatula]
Length=411

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 74/87 (85%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            +SADE+++LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQT+QSEGYGF+EF++ A 
Sbjct  68   SSADEVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAG  127

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQT+NGT MPN  QNFRLNWA+ 
Sbjct  128  AERVLQTFNGTIMPNGGQNFRLNWATF  154



>ref|XP_010062999.1| PREDICTED: polyadenylate-binding protein RBP45C [Eucalyptus grandis]
 gb|KCW70173.1| hypothetical protein EUGRSUZ_F03462 [Eucalyptus grandis]
Length=397

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 65/87 (75%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +A EI+SLWIGDLQ  MDE YL+ CF  SGEV+SAKVIRNKQT+  EGYGFIEFM  AAA
Sbjct  59   AAAEIKSLWIGDLQPHMDETYLLNCFAHSGEVLSAKVIRNKQTALPEGYGFIEFMTRAAA  118

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MPN+ QNFRLNWA+LG
Sbjct  119  ERILQTYNGTLMPNSDQNFRLNWATLG  145



>ref|XP_002285479.1| PREDICTED: polyadenylate-binding protein RBP47B' [Vitis vinifera]
Length=447

 Score =   139 bits (349),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  35   TSVEEVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  94

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ YNGT MP  +Q FRLNWAS G
Sbjct  95   AERILQAYNGTQMPGTEQTFRLNWASFG  122



>ref|XP_003546146.1| PREDICTED: polyadenylate-binding protein RBP45-like [Glycine 
max]
Length=411

 Score =   138 bits (347),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 63/86 (73%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A A
Sbjct  62   SADEVRTLWIGDLQYWMDENYLYTCFAHTGEVSSVKVIRNKQTSQSEGYGFIEFNSRAGA  121

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNG  MPN  Q+FRLNWA+ 
Sbjct  122  ERILQTYNGAIMPNGGQSFRLNWATF  147



>emb|CBI16387.3| unnamed protein product [Vitis vinifera]
Length=445

 Score =   138 bits (348),  Expect = 3e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  35   TSVEEVRTLWIGDLQYWVDENYLHSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  94

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ YNGT MP  +Q FRLNWAS G
Sbjct  95   AERILQAYNGTQMPGTEQTFRLNWASFG  122



>ref|XP_006594429.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X2 [Glycine 
max]
Length=314

 Score =   136 bits (342),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A AE+
Sbjct  63   DEVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAER  122

Query  476  NLQTYNGTPMPNAQQNFRLNWASL  547
             LQTYNG  MPN  Q+FRLNWA+ 
Sbjct  123  ILQTYNGAIMPNGGQSFRLNWATF  146



>ref|XP_008437079.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X3 [Cucumis 
melo]
Length=422

 Score =   138 bits (347),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>ref|XP_007132012.1| hypothetical protein PHAVU_011G059300g [Phaseolus vulgaris]
 gb|ESW04006.1| hypothetical protein PHAVU_011G059300g [Phaseolus vulgaris]
Length=401

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL +CF  SGEVVS K+IRNK T Q EGYGF+EF++HAA
Sbjct  4    TAIEEVRTLWIGDLQYWVDESYLSQCFAHSGEVVSIKIIRNKMTGQPEGYGFVEFVSHAA  63

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE  L+TYNGT MP  +Q FRLNWAS G
Sbjct  64   AEAFLRTYNGTQMPGTEQTFRLNWASFG  91



>ref|XP_004152401.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Cucumis 
sativus]
Length=422

 Score =   137 bits (346),  Expect = 4e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>ref|XP_008437076.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
 ref|XP_008437077.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X1 [Cucumis 
melo]
Length=427

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>gb|KFK27101.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=405

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S  EIRSLWIGDLQ WMDE+YL   F  SGEV S KVIRNKQ+ Q+EGYGFIEF NHAAA
Sbjct  69   SDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAA  128

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ+YNGTPMP+  QNFRLNWA  G
Sbjct  129  ERFLQSYNGTPMPSGDQNFRLNWAQAG  155



>ref|XP_004164285.1| PREDICTED: LOW QUALITY PROTEIN: polyadenylate-binding protein 
RBP47B'-like [Cucumis sativus]
Length=427

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>gb|KFK27100.1| hypothetical protein AALP_AA8G334500 [Arabis alpina]
Length=407

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 64/87 (74%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S  EIRSLWIGDLQ WMDE+YL   F  SGEV S KVIRNKQ+ Q+EGYGFIEF NHAAA
Sbjct  69   SDGEIRSLWIGDLQPWMDENYLNSIFAQSGEVQSVKVIRNKQSGQTEGYGFIEFANHAAA  128

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ+YNGTPMP+  QNFRLNWA  G
Sbjct  129  ERFLQSYNGTPMPSGDQNFRLNWAQAG  155



>ref|XP_010448184.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Camelina 
sativa]
Length=421

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F ++GE  SAKVIRNKQ+  SEGYGFIEF +HA A
Sbjct  77   SAGEIRSLWIGDLQPWMDENYLMTVFNVTGEAQSAKVIRNKQSGYSEGYGFIEFASHATA  136

Query  470  EKNLQTYNGTPMPNA-QQNFRLNWASLG  550
            E+ LQTYNG PMPN+ QQ FRLNWA LG
Sbjct  137  ERVLQTYNGAPMPNSEQQTFRLNWAQLG  164



>ref|XP_008437078.1| PREDICTED: polyadenylate-binding protein RBP47B' isoform X2 [Cucumis 
melo]
Length=425

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>ref|XP_010438672.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=423

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 72/88 (82%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F ++GE  SAKVIRNKQ+  SEGYGFIEF +HA A
Sbjct  77   SAGEIRSLWIGDLQPWMDENYLMTVFNVTGEAQSAKVIRNKQSGYSEGYGFIEFASHATA  136

Query  470  EKNLQTYNGTPMPNA-QQNFRLNWASLG  550
            E+ LQTYNG PMPN+ QQ FRLNWA LG
Sbjct  137  ERVLQTYNGAPMPNSEQQTFRLNWAQLG  164



>ref|XP_009412453.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
 ref|XP_009412454.1| PREDICTED: polyadenylate-binding protein RBP45 [Musa acuminata 
subsp. malaccensis]
Length=453

 Score =   138 bits (347),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDL YWM+E YL  CF  +GE+VS KVIRNKQT QSEGYGFIEF++ AAA
Sbjct  100  SADEIRTLWIGDLPYWMEESYLYSCFVHTGEMVSVKVIRNKQTGQSEGYGFIEFVSRAAA  159

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            ++ LQTYNG  MPN +Q FRLNWAS G
Sbjct  160  DRILQTYNGQVMPNTEQAFRLNWASCG  186


 Score = 49.3 bits (116),  Expect = 6e-04, Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 44/78 (56%), Gaps = 8/78 (10%)
 Frame = +2

Query  308  SLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKNLQT  487
            ++++G L   + +D+L + F   GE+V  K+   K+       GF++F + A AE+ L+ 
Sbjct  308  TIFVGGLDTNVTDDHLRQVFSTYGEIVYVKIPVGKRC------GFVQFASRANAEEALRM  361

Query  488  YNGTPMPNAQQNFRLNWA  541
             NGTP+    QN RL+W 
Sbjct  362  LNGTPL--GGQNIRLSWG  377



>gb|KGN50253.1| hypothetical protein Csa_5G162020 [Cucumis sativus]
Length=420

 Score =   137 bits (346),  Expect = 5e-35, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  14   TTVEEVRTLWIGDLQYWVDESYLNSCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  74   AERILQTYNGTQMPGTEQTFRLNWASFG  101



>ref|XP_002316998.2| RNA-binding protein 45 [Populus trichocarpa]
 gb|EEE97610.2| RNA-binding protein 45 [Populus trichocarpa]
Length=404

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EI+SLWIGDLQ WMDE+YL+  F  +GE+V AKVIRNKQT   EGYGFIEF++ AAAE+ 
Sbjct  68   EIKSLWIGDLQQWMDENYLLSIFSATGEIVQAKVIRNKQTGYPEGYGFIEFVSRAAAERI  127

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQTYNGTPMPN++Q FRLNWA+LG
Sbjct  128  LQTYNGTPMPNSEQAFRLNWATLG  151



>ref|XP_003597428.1| RNA-binding protein [Medicago truncatula]
 gb|AES67679.1| polyadenylate-binding protein RBP47B [Medicago truncatula]
Length=428

 Score =   137 bits (346),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGFIEF++H+AA
Sbjct  10   SLEEVRTLWIGDLQYWVDENYLTHCFSHTGEVISIKIIRNKITGQPEGYGFIEFVSHSAA  69

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGT MP  +Q FRLNWAS G
Sbjct  70   ERVLQTYNGTQMPGTEQTFRLNWASFG  96



>gb|AFK41944.1| unknown [Medicago truncatula]
Length=411

 Score =   137 bits (345),  Expect = 6e-35, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            +SADE+ +LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQT+QSEGYGF+EF++ A 
Sbjct  68   SSADEVETLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKQTNQSEGYGFLEFISRAG  127

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQT+NGT MPN  QNFRLNWA+ 
Sbjct  128  AERVLQTFNGTIMPNGGQNFRLNWATF  154



>ref|XP_011030800.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Populus 
euphratica]
Length=402

 Score =   137 bits (344),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 72/84 (86%), Gaps = 0/84 (0%)
 Frame = +2

Query  299  EIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKN  478
            EI+SLWIGDLQ WMDE+YL+  F  +GE+V AKVIRNKQT   EGYGFIEF++ AAAE+ 
Sbjct  67   EIKSLWIGDLQQWMDENYLLSIFSATGEIVQAKVIRNKQTGYPEGYGFIEFVSRAAAERI  126

Query  479  LQTYNGTPMPNAQQNFRLNWASLG  550
            LQTYNGTPMPN++Q FRLNWA+LG
Sbjct  127  LQTYNGTPMPNSEQAFRLNWATLG  150



>ref|NP_001078604.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 gb|AED92690.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=421

 Score =   137 bits (345),  Expect = 7e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  21   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  80

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  81   TLQTYNGTQMPGTELTFRLNWASFG  105



>ref|NP_197436.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
 sp|Q8VXZ9.1|R47BP_ARATH RecName: Full=Polyadenylate-binding protein RBP47B'; Short=Poly(A)-binding 
protein RBP47B'; AltName: Full=RNA-binding protein 
47B'; Short=AtRBP47B prime; Short=AtRBP47B' [Arabidopsis 
thaliana]
 gb|AAL67015.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AAM45052.1| putative DNA binding protein ACBF [Arabidopsis thaliana]
 gb|AED92689.1| polyadenylate-binding protein RBP47B' [Arabidopsis thaliana]
Length=425

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  21   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  80

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  81   TLQTYNGTQMPGTELTFRLNWASFG  105



>ref|XP_011025522.1| PREDICTED: polyadenylate-binding protein RBP47B' [Populus euphratica]
Length=416

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW DE YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  17   EEVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAER  76

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +Q FRLNWAS G
Sbjct  77   ILQTYNGTQMPGTEQTFRLNWASFG  101



>ref|XP_002871881.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH48140.1| hypothetical protein ARALYDRAFT_488820 [Arabidopsis lyrata subsp. 
lyrata]
Length=426

 Score =   137 bits (345),  Expect = 8e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFISHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTQMPGTELTFRLNWASFG  104



>ref|XP_002313332.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
 gb|EEE87287.2| hypothetical protein POPTR_0009s05920g [Populus trichocarpa]
Length=416

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW DE YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  17   EEVRTLWIGDLQYWADESYLTSCFAHTGEVVSIKIIRNKLTGQPEGYGFVEFVSHAAAER  76

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +Q FRLNWAS G
Sbjct  77   ILQTYNGTQMPGTEQTFRLNWASFG  101



>dbj|BAE71189.1| putative DNA binding protein [Trifolium pratense]
Length=253

 Score =   134 bits (336),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADE+R+LWIGDLQYWMDE+YL +CF  +GEV + KVIRNKQT+QSEGYGF+EF + A A
Sbjct  63   TADEVRTLWIGDLQYWMDENYLYQCFSHTGEVGNVKVIRNKQTNQSEGYGFLEFTSRAGA  122

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQ YNG  MPN  QNFRLNWA+ 
Sbjct  123  ERILQQYNGNIMPNGGQNFRLNWATF  148



>ref|XP_010454207.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=424

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTQMPGTELTFRLNWASFG  104



>ref|XP_008812246.1| PREDICTED: polyadenylate-binding protein RBP47B' [Phoenix dactylifera]
Length=447

 Score =   137 bits (345),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE YL  CF  +GEVVS KVIRNK T   EGYGF+EF++HAA
Sbjct  41   TSLEEVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAA  100

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNG+ MP  +Q FRLNWAS G
Sbjct  101  AERILQTYNGSQMPGTEQAFRLNWASFG  128



>ref|XP_009406503.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X2 
[Musa acuminata subsp. malaccensis]
Length=430

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIG LQ+WMDE+YL  CF  +GEVVS K+IRNKQ+ QSEGYGF+EF++HA A
Sbjct  91   SADEIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGA  150

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            ++ LQTYNG  MPN +Q FRLNWA+ G
Sbjct  151  DRILQTYNGQVMPNTEQAFRLNWATCG  177



>ref|XP_010458570.1| PREDICTED: polyadenylate-binding protein RBP45B [Camelina sativa]
Length=406

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 74/87 (85%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQYWMDE++L  CF  +GE++SAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  58   TADEIRTLWIGDLQYWMDENFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAA  117

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N TP+P+   Q FRLNWASL
Sbjct  118  ERTLQTFNNTPIPSFPDQLFRLNWASL  144



>ref|XP_010495305.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Camelina 
sativa]
Length=418

 Score =   137 bits (344),  Expect = 9e-35, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTQMPGTELTFRLNWASFG  104



>ref|NP_172630.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
 sp|Q9SAB3.1|RB45B_ARATH RecName: Full=Polyadenylate-binding protein RBP45B; Short=Poly(A)-binding 
protein RBP45B; AltName: Full=RNA-binding protein 
45B; Short=AtRBP45B [Arabidopsis thaliana]
 gb|AAD30259.1|AC007296_20 Similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains. 
ESTs gb|T44278, gb|R65195, gb|N65904, gb|H37499, gb|R90487, 
gb|N95952, gb|T44278, gb|Z20166, gb|N96891, gb|W43137, gb|F15504, 
gb|F15495 and gb|Z30868 come from this gene [Arabidopsis 
thaliana]
 gb|AAM13200.1| similar to gb|U90212 DNA binding protein ACBF from Nicotiana 
tabacum and contains 3 PF|00076 RNA recognition motif domains 
[Arabidopsis thaliana]
 gb|AAP37853.1| At1g11650 [Arabidopsis thaliana]
 gb|AEE28764.1| polyadenylate-binding protein RBP45B [Arabidopsis thaliana]
Length=405

 Score =   137 bits (344),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 74/88 (84%), Gaps = 1/88 (1%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIR+LWIGDLQYWMDE++L  CF  +GE+VSAKVIRNKQT Q EGYGFIEF +HAA
Sbjct  56   TTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAA  115

Query  467  AEKNLQTYNGTPMPN-AQQNFRLNWASL  547
            AE+ LQT+N  P+P+   Q FRLNWASL
Sbjct  116  AERVLQTFNNAPIPSFPDQLFRLNWASL  143



>ref|XP_009406502.1| PREDICTED: polyadenylate-binding protein RBP45-like isoform X1 
[Musa acuminata subsp. malaccensis]
Length=437

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 73/87 (84%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIG LQ+WMDE+YL  CF  +GEVVS K+IRNKQ+ QSEGYGF+EF++HA A
Sbjct  98   SADEIRTLWIGGLQFWMDENYLYSCFAHTGEVVSVKIIRNKQSGQSEGYGFLEFVSHAGA  157

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            ++ LQTYNG  MPN +Q FRLNWA+ G
Sbjct  158  DRILQTYNGQVMPNTEQAFRLNWATCG  184



>ref|XP_010052834.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X3 [Eucalyptus 
grandis]
 gb|KCW76950.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=300

 Score =   134 bits (338),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE+R+LWIGDLQYWMDE YL  CF  +GEV + KVIRNKQT Q EGYGFIEF   AAAE+
Sbjct  89   DEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRAAAER  148

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPN  Q+FRLNWAS G
Sbjct  149  VLQTYNGAIMPNGGQSFRLNWASAG  173



>ref|XP_010108648.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
 gb|EXC19904.1| Polyadenylate-binding protein RBP47B' [Morus notabilis]
Length=469

 Score =   137 bits (345),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQ+W+DE+YL  CF  +GEVVS K+IRNK T Q EGYGF+EF++HAA
Sbjct  30   TTVEEVRTLWIGDLQFWVDENYLNSCFSHTGEVVSIKIIRNKITGQPEGYGFVEFVSHAA  89

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ+YNGT MP  +Q FRLNWAS G
Sbjct  90   AERILQSYNGTKMPGTEQTFRLNWASFG  117



>ref|XP_004486120.1| PREDICTED: polyadenylate-binding protein RBP45-like [Cicer arietinum]
Length=399

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/86 (72%), Positives = 71/86 (83%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A A
Sbjct  51   SADEVRTLWIGDLQYWMDENYLYTCFGQTGEVTSLKVIRNKQTSQSEGYGFIEFNSRATA  110

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTYNG  MPN  Q++RLNWA+ 
Sbjct  111  ERVLQTYNGAIMPNGGQSYRLNWATF  136



>ref|XP_002280601.1| PREDICTED: polyadenylate-binding protein RBP45-like [Vitis vinifera]
Length=417

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ +EIRSLWIGDLQ WM+E+YL  CF  +GEVVS KVIRNKQT Q EGYGFIE    AA
Sbjct  84   SNPEEIRSLWIGDLQPWMEENYLWGCFSQTGEVVSVKVIRNKQTGQCEGYGFIELATRAA  143

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MPN++QNFRLNWA+LG
Sbjct  144  AERILQTYNGTLMPNSEQNFRLNWATLG  171



>gb|KHG09232.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=423

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T Q EGYGF+EF++H A
Sbjct  14   TSLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGQPEGYGFVEFVSHQA  73

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGTPMP   Q FRLNWAS G
Sbjct  74   AERILQTYNGTPMPGTDQMFRLNWASFG  101



>ref|XP_010493089.1| PREDICTED: polyadenylate-binding protein RBP45B-like [Camelina 
sativa]
Length=406

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQYWMDE +L  CF  +GE++SAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  58   TADEIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAA  117

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N TP+P+   Q FRLNWASL
Sbjct  118  ERTLQTFNNTPIPSFPDQLFRLNWASL  144



>ref|XP_010433418.1| PREDICTED: polyadenylate-binding protein RBP45C [Camelina sativa]
Length=419

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 65/88 (74%), Positives = 70/88 (80%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F ++GE  SAKVIRNKQ   SEGYGFIEF +HA A
Sbjct  77   SAGEIRSLWIGDLQPWMDENYLMTVFNVTGEAQSAKVIRNKQNGYSEGYGFIEFASHATA  136

Query  470  EKNLQTYNGTPMPNA-QQNFRLNWASLG  550
            E+ LQTYNG PMPN  QQ FRLNWA LG
Sbjct  137  ERVLQTYNGAPMPNCEQQTFRLNWAQLG  164



>ref|XP_010476096.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X1 [Camelina sativa]
Length=407

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQYWMDE +L  CF  +GE++SAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  58   TADEIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAA  117

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N TP+P+   Q FRLNWASL
Sbjct  118  ERTLQTFNNTPIPSFPDQLFRLNWASL  144



>gb|KDP22083.1| hypothetical protein JCGZ_25914 [Jatropha curcas]
Length=416

 Score =   136 bits (343),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GEVV+ K+IRNK T Q EGYGF+EF++HAAAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFAHTGEVVTIKIIRNKITGQPEGYGFVEFVSHAAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +Q FRLNWAS G
Sbjct  79   ILQTYNGTQMPGTEQTFRLNWASFG  103



>ref|XP_010476097.1| PREDICTED: polyadenylate-binding protein RBP45B-like isoform 
X2 [Camelina sativa]
Length=397

 Score =   136 bits (342),  Expect = 1e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQYWMDE +L  CF  +GE++SAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  58   TADEIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAA  117

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N TP+P+   Q FRLNWASL
Sbjct  118  ERTLQTFNNTPIPSFPDQLFRLNWASL  144



>ref|XP_008796097.1| PREDICTED: polyadenylate-binding protein RBP45 [Phoenix dactylifera]
Length=420

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LW+GDLQYWMDE+YL  CF  +GEV+S K+IRNKQT QSEGYGFIEF   AAA
Sbjct  79   SADEIRTLWVGDLQYWMDENYLFGCFASTGEVLSVKMIRNKQTGQSEGYGFIEFATRAAA  138

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NG  MPN +Q FRLNWA+ G
Sbjct  139  ERVLQAFNGQMMPNIEQTFRLNWATCG  165



>ref|XP_006283830.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
 gb|EOA16728.1| hypothetical protein CARUB_v10004931mg [Capsella rubella]
Length=413

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 64/88 (73%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WMDE+YLM  F ++GE  SAKVIRNKQ+  SEGYGFIEF++HA A
Sbjct  72   SAGEIRSLWIGDLQPWMDENYLMNIFAVTGEAQSAKVIRNKQSGYSEGYGFIEFVSHAIA  131

Query  470  EKNLQTYNGTPMPNA-QQNFRLNWASLG  550
            E+ LQTYNG PMP++ QQ FRLNWA LG
Sbjct  132  ERVLQTYNGAPMPSSEQQTFRLNWAQLG  159



>ref|XP_009376881.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347313.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
 ref|XP_009347319.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  31   TSVEEVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  90

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +Q FRLNWAS G
Sbjct  91   AERVLHAYNGTQMPGTEQTFRLNWASFG  118



>gb|AEW68341.1| putative nuclear acid binding protein [Medicago sativa]
Length=409

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+++LWIGDLQYWMDE+YL  CF  +GEV S KVIRNK  +QSEGYGF+EF++ A 
Sbjct  66   TSADEVKTLWIGDLQYWMDENYLYNCFSHTGEVGSVKVIRNKLNNQSEGYGFLEFISRAG  125

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AE+ LQTYNGT MPN  QNFRLNWA+ 
Sbjct  126  AERVLQTYNGTIMPNGGQNFRLNWATF  152



>ref|XP_008345010.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
 ref|XP_008363573.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Malus 
domestica]
Length=442

 Score =   136 bits (343),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  31   TSVEEVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  90

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +Q FRLNWAS G
Sbjct  91   AERVLHAYNGTQMPGTEQTFRLNWASFG  118



>ref|XP_008377253.1| PREDICTED: polyadenylate-binding protein RBP47B' [Malus domestica]
Length=431

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  20   TSVEEVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  79

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +Q FRLNWAS G
Sbjct  80   AERVLHAYNGTQMPGTEQTFRLNWASFG  107



>ref|XP_009375056.1| PREDICTED: polyadenylate-binding protein RBP47B'-like [Pyrus 
x bretschneideri]
Length=442

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  31   TSVEEVRTLWIGDLQYWVDENYLNTCFAHTGEVISIKIIRNKITGQPEGYGFVEFVSHAA  90

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +Q FRLNWAS G
Sbjct  91   AERVLHAYNGTQMPGTEQTFRLNWASFG  118



>ref|XP_003542872.1| PREDICTED: polyadenylate-binding protein RBP45B isoform X1 [Glycine 
max]
Length=409

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/84 (73%), Positives = 69/84 (82%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF + A AE+
Sbjct  63   DEVRTLWIGDLQYWMDENYLYTCFAHTGEVTSVKVIRNKQTSQSEGYGFIEFNSRAGAER  122

Query  476  NLQTYNGTPMPNAQQNFRLNWASL  547
             LQTYNG  MPN  Q+FRLNWA+ 
Sbjct  123  ILQTYNGAIMPNGGQSFRLNWATF  146



>ref|XP_006307499.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
 gb|EOA40397.1| hypothetical protein CARUB_v10009124mg, partial [Capsella rubella]
Length=448

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 73/87 (84%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            +ADEIR+LWIGDLQYWMDE +L  CF  +GE++SAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  98   TADEIRTLWIGDLQYWMDESFLYGCFAHTGELLSAKVIRNKQTGQVEGYGFIEFASHAAA  157

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N TP+P+   Q FRLNWASL
Sbjct  158  ERTLQTFNNTPIPSFPDQLFRLNWASL  184



>ref|XP_006401514.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42967.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=403

 Score =   135 bits (341),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S  EIRSLWIGDLQ WMDE+Y+M  F  +GE  SAKVIRNKQT Q EGYGFIEF NHAAA
Sbjct  68   SDGEIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAA  127

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA  G
Sbjct  128  ERVLQTYNGAQMPNCEQTFRLNWAQAG  154



>ref|XP_010052833.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X2 [Eucalyptus 
grandis]
Length=336

 Score =   134 bits (338),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DE+R+LWIGDLQYWMDE YL  CF  +GEV + KVIRNKQT Q EGYGFIEF   AAAE
Sbjct  88   GDEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRAAAE  147

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNG  MPN  Q+FRLNWAS G
Sbjct  148  RVLQTYNGAIMPNGGQSFRLNWASAG  173



>emb|CDX88893.1| BnaA03g07560D [Brassica napus]
Length=430

 Score =   136 bits (342),  Expect = 2e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTLMPGTEVAFRLNWASFG  104



>ref|XP_010546929.1| PREDICTED: polyadenylate-binding protein RBP45B [Tarenaya hassleriana]
Length=416

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/88 (72%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LWIGDLQYWMDE++L  CF  +GEV S KVIRNKQT Q EGYGF+EF++ AAA
Sbjct  72   SADEIRTLWIGDLQYWMDENFLFNCFAHTGEVSSVKVIRNKQTQQIEGYGFLEFVSRAAA  131

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASLG  550
            E+ LQTYNGTP+P+   Q FRLNWAS G
Sbjct  132  ERVLQTYNGTPIPSFPDQLFRLNWASSG  159



>ref|XP_006401513.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
 gb|ESQ42966.1| hypothetical protein EUTSA_v10013710mg [Eutrema salsugineum]
Length=401

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 63/87 (72%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S  EIRSLWIGDLQ WMDE+Y+M  F  +GE  SAKVIRNKQT Q EGYGFIEF NHAAA
Sbjct  68   SDGEIRSLWIGDLQPWMDENYIMSIFAQTGEAQSAKVIRNKQTGQCEGYGFIEFANHAAA  127

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA  G
Sbjct  128  ERVLQTYNGAQMPNCEQTFRLNWAQAG  154



>ref|XP_006400492.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
 gb|ESQ41945.1| hypothetical protein EUTSA_v10013617mg [Eutrema salsugineum]
Length=429

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTQMPGTEIPFRLNWASFG  104



>ref|XP_008238181.1| PREDICTED: polyadenylate-binding protein RBP47B' [Prunus mume]
Length=437

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE+YL  CF  +G ++S K+IRNK T Q EGYGF+EF++HAA
Sbjct  27   TSVEEVRTLWIGDLQYWVDENYLTTCFAHTGSLISIKIIRNKITGQPEGYGFVEFVSHAA  86

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ L  YNGT MP  +QNFRLNWAS G
Sbjct  87   AERVLHAYNGTLMPGTEQNFRLNWASFG  114



>emb|CDX70874.1| BnaC03g09580D [Brassica napus]
Length=430

 Score =   135 bits (341),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLSSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTLMPGTEVAFRLNWASFG  104



>ref|XP_010665562.1| PREDICTED: polyadenylate-binding protein RBP45-like [Beta vulgaris 
subsp. vulgaris]
Length=414

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DEIR+LWIGDLQYWMDE+Y+  CF  SGE+V+ K+IRNKQT QSE YGFIEF  HAAAE+
Sbjct  79   DEIRTLWIGDLQYWMDENYIRTCFAQSGELVNVKIIRNKQTMQSECYGFIEFSTHAAAER  138

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYN T MPN +QN+RLNWA  G
Sbjct  139  ILQTYNNTLMPNVEQNYRLNWAFYG  163



>ref|XP_010673626.1| PREDICTED: polyadenylate-binding protein RBP47B' [Beta vulgaris 
subsp. vulgaris]
Length=429

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 56/85 (66%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQ W+DE Y+  CF  +GEV+S KVIRNK T   EGYGF+EF++HAAAE+
Sbjct  13   EEVRTLWIGDLQIWVDESYIHSCFAQTGEVISVKVIRNKITGHPEGYGFVEFVSHAAAER  72

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQ+YNGTPMP  +Q FRLNWAS G
Sbjct  73   VLQSYNGTPMPGTEQPFRLNWASFG  97



>ref|XP_010420736.1| PREDICTED: polyadenylate-binding protein RBP47B' [Camelina sativa]
Length=423

 Score =   135 bits (340),  Expect = 3e-34, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++H AAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTQMPGTELTFRLNWASFG  104



>ref|XP_002867529.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH43788.1| hypothetical protein ARALYDRAFT_913848 [Arabidopsis lyrata subsp. 
lyrata]
Length=418

 Score =   135 bits (340),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EIRSLWIGDLQ WM+E+YLM  F L+G+  SAKVIRNKQ+  SEGYGFIEF+NHA A
Sbjct  76   SAGEIRSLWIGDLQPWMEENYLMNIFSLTGDATSAKVIRNKQSGYSEGYGFIEFVNHATA  135

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ YNGT MP++ Q FRLNWA LG
Sbjct  136  ERILQAYNGTTMPSSDQAFRLNWAQLG  162



>ref|XP_006858185.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
 gb|ERN19652.1| hypothetical protein AMTR_s00062p00161920 [Amborella trichopoda]
Length=492

 Score =   135 bits (341),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE Y+  CF  +GEV+S K+IRNKQT Q EGYGFIEF + A A
Sbjct  87   SADEVRTLWIGDLQYWMDEAYIHSCFAHTGEVLSVKIIRNKQTGQPEGYGFIEFASRATA  146

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ +QT NGT MPN +Q+FRLNWA+ G
Sbjct  147  ERIIQTVNGTTMPNTEQSFRLNWATFG  173



>ref|XP_003543537.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX2 
[Glycine max]
Length=410

 Score =   135 bits (339),  Expect = 4e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  8    STIEEVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAA  67

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP   Q FRLNWAS G
Sbjct  68   AERVLQTYNGTQMPATDQTFRLNWASFG  95



>ref|XP_009418782.1| PREDICTED: polyadenylate-binding protein RBP45-like [Musa acuminata 
subsp. malaccensis]
Length=443

 Score =   135 bits (340),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADEIR+LW+GDLQYWMDE+YL  CF  +GEV+S K+IRNK   QSEGYGFIEF++ AAA
Sbjct  105  SADEIRTLWVGDLQYWMDENYLYSCFVHTGEVLSVKIIRNKLNGQSEGYGFIEFVSRAAA  164

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            ++ LQT+NG  MPN +Q FRLNWAS G
Sbjct  165  DRVLQTFNGQVMPNTEQAFRLNWASCG  191



>dbj|BAE71244.1| putative DNA binding protein [Trifolium pratense]
Length=402

 Score =   134 bits (338),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LWIGDLQYWMDE+YL  CF  +GEV S KVIRNKQTSQSEGYGFIEF   A+A
Sbjct  52   SADEVRTLWIGDLQYWMDENYLYTCFGNTGEVTSVKVIRNKQTSQSEGYGFIEFNTRASA  111

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQTY G  MPN  Q++RLNWA+ 
Sbjct  112  ERVLQTYQGAIMPNGGQSYRLNWATF  137



>ref|XP_004486967.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X2 [Cicer arietinum]
Length=427

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            +S +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++H A
Sbjct  9    SSLEEVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTA  68

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ+YNGT MP  +Q FRLNWAS G
Sbjct  69   AERVLQSYNGTQMPGTEQTFRLNWASFG  96



>ref|XP_004486966.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
X1 [Cicer arietinum]
Length=429

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            +S +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++H A
Sbjct  9    SSLEEVRTLWIGDLQYWVDETYLTHCFSHTGEVISIKIIRNKITGQPEGYGFVEFVSHTA  68

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ+YNGT MP  +Q FRLNWAS G
Sbjct  69   AERVLQSYNGTQMPGTEQTFRLNWASFG  96



>gb|KJB21879.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
 gb|KJB21881.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=425

 Score =   135 bits (339),  Expect = 5e-34, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T   EGYGF+EF++HAAA
Sbjct  18   SLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAA  77

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGTPMP  +Q FRLNWAS G
Sbjct  78   ERILQTYNGTPMPGTEQMFRLNWASFG  104



>gb|KJB21880.1| hypothetical protein B456_004G019500 [Gossypium raimondii]
Length=424

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T   EGYGF+EF++HAAA
Sbjct  18   SLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAA  77

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGTPMP  +Q FRLNWAS G
Sbjct  78   ERILQTYNGTPMPGTEQMFRLNWASFG  104



>emb|CAN83958.1| hypothetical protein VITISV_039907 [Vitis vinifera]
Length=410

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ +EIRSLWIGDLQ WM+E+Y   CF  +GEVVS KVIRNKQT Q EGYGFIE    AA
Sbjct  69   SNPEEIRSLWIGDLQPWMEENYXWGCFSQTGEVVSVKVIRNKQTGQCEGYGFIELATRAA  128

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MPN++QNFRLNWA+LG
Sbjct  129  AERILQTYNGTLMPNSEQNFRLNWATLG  156



>ref|XP_003543536.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoformX1 
[Glycine max]
Length=419

 Score =   134 bits (338),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HAA
Sbjct  8    STIEEVRTLWIGDLQYWVDEGYLSHCFGHTGEVISIKIIRNKLTGQPEGYGFVEFVSHAA  67

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNGT MP   Q FRLNWAS G
Sbjct  68   AERVLQTYNGTQMPATDQTFRLNWASFG  95



>gb|KHG00069.1| Polyadenylate-binding RBP47B' -like protein [Gossypium arboreum]
Length=441

 Score =   135 bits (339),  Expect = 6e-34, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S +E+R+LWIGDLQ+W+DE YL  CF  +GE+VS K+IRNK T   EGYGF+EF++HAAA
Sbjct  18   SLEEVRTLWIGDLQFWVDESYLNSCFAHTGELVSIKIIRNKITGLPEGYGFVEFVSHAAA  77

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNGTPMP  +Q FRLNWAS G
Sbjct  78   ERILQTYNGTPMPGTEQMFRLNWASFG  104



>ref|XP_010092144.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
 gb|EXB50295.1| Polyadenylate-binding protein RBP45 [Morus notabilis]
Length=543

 Score =   135 bits (340),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 61/85 (72%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DEIRSLWIGDLQ WM+E+YL+ CF  +GE ++AKVIRNKQT   EGYGFIEF + AAAE+
Sbjct  70   DEIRSLWIGDLQQWMEENYLISCFAHTGEALTAKVIRNKQTGLPEGYGFIEFASRAAAER  129

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNG  MPN  QNFRLNWA+LG
Sbjct  130  ALQTYNGALMPNTDQNFRLNWATLG  154



>ref|XP_002513488.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF48891.1| nuclear acid binding protein, putative [Ricinus communis]
Length=412

 Score =   134 bits (338),  Expect = 7e-34, Method: Compositional matrix adjust.
 Identities = 57/85 (67%), Positives = 70/85 (82%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++H AAE+
Sbjct  19   EEVRTLWIGDLQYWVDENYLSSCFAHTGEVLSIKIIRNKITGQPEGYGFVEFVSHVAAER  78

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +Q FRLNWAS G
Sbjct  79   ILQTYNGTQMPGTEQTFRLNWASFG  103



>gb|AAM64532.1| putative DNA binding protein [Arabidopsis thaliana]
Length=404

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 62/88 (70%), Positives = 73/88 (83%), Gaps = 1/88 (1%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ADEIR+LWIGDLQYWMDE++L  CF  +GE+VSAKVIRNKQT Q EGYGFIEF +HAA
Sbjct  55   TTADEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAA  114

Query  467  AEKNLQTYNGTPMPN-AQQNFRLNWASL  547
            AE+ LQT+N  P+P+   Q FRL WASL
Sbjct  115  AERVLQTFNNAPIPSFPDQLFRLXWASL  142



>ref|XP_010523211.1| PREDICTED: polyadenylate-binding protein RBP47B-like [Tarenaya 
hassleriana]
Length=449

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S D++++LW+GDL +WMDE YL  CF  SGEV S KVIRNKQT QSEGYGF+EF + AAA
Sbjct  109  SGDDVKTLWVGDLLHWMDETYLHSCFSHSGEVSSVKVIRNKQTCQSEGYGFVEFFSRAAA  168

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            E+ LQ YNG+PMPNA Q FRLNWAS 
Sbjct  169  EEVLQNYNGSPMPNADQPFRLNWASF  194



>ref|XP_001777334.1| predicted protein [Physcomitrella patens]
 ref|XP_001782740.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ52446.1| predicted protein, partial [Physcomitrella patens]
 gb|EDQ57864.1| predicted protein, partial [Physcomitrella patens]
Length=416

 Score =   134 bits (337),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 71/87 (82%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S +E+++LW+GDLQYWMDE+YL   F  +GEV S K+IRNKQT  SEGYGF+EF++HAAA
Sbjct  3    SHEEVKTLWVGDLQYWMDENYLHTAFVHTGEVQSVKIIRNKQTGYSEGYGFVEFVSHAAA  62

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            EK LQ YNGT MPN +Q FRLNWAS G
Sbjct  63   EKILQAYNGTQMPNTEQPFRLNWASFG  89



>ref|XP_010938882.1| PREDICTED: polyadenylate-binding protein RBP47B' [Elaeis guineensis]
Length=448

 Score =   134 bits (338),  Expect = 8e-34, Method: Compositional matrix adjust.
 Identities = 59/88 (67%), Positives = 70/88 (80%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TS +E+R+LWIGDLQYW+DE YL  CF  +GEVVS KVIRNK T   EGYGF+EF++HAA
Sbjct  42   TSLEEVRTLWIGDLQYWVDESYLHSCFAHTGEVVSVKVIRNKITGHPEGYGFVEFVSHAA  101

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ YNG+ MP  +Q FRLNWAS G
Sbjct  102  AERILQMYNGSQMPGTEQAFRLNWASFG  129



>ref|XP_010052832.1| PREDICTED: polyadenylate-binding protein RBP45 isoform X1 [Eucalyptus 
grandis]
 gb|KCW76949.1| hypothetical protein EUGRSUZ_D01310 [Eucalyptus grandis]
Length=427

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 61/86 (71%), Positives = 67/86 (78%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
             DE+R+LWIGDLQYWMDE YL  CF  +GEV + KVIRNKQT Q EGYGFIEF   AAAE
Sbjct  88   GDEVRTLWIGDLQYWMDEAYLGTCFAATGEVANVKVIRNKQTMQPEGYGFIEFYTRAAAE  147

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNG  MPN  Q+FRLNWAS G
Sbjct  148  RVLQTYNGAIMPNGGQSFRLNWASAG  173



>emb|CDY46671.1| BnaA03g48370D [Brassica napus]
Length=429

 Score =   134 bits (337),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EI+SLWIGDLQ WMDE YLM  F ++GEV  AKVIRNK T  +EGYGFIEF++HAAA
Sbjct  67   SAGEIKSLWIGDLQPWMDEGYLMSIFSITGEVQQAKVIRNKLTGLTEGYGFIEFVSHAAA  126

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA LG
Sbjct  127  ERILQTYNGAQMPNCEQTFRLNWAQLG  153



>emb|CDX92786.1| BnaC07g40440D [Brassica napus]
Length=426

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EI+SLWIGDLQ WMDE YLM  F ++GEV  AKVIRNK T  +EGYGFIEF++HAAA
Sbjct  67   SAGEIKSLWIGDLQPWMDEGYLMSIFSITGEVQQAKVIRNKLTGLTEGYGFIEFVSHAAA  126

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA LG
Sbjct  127  ERILQTYNGAQMPNCEQTFRLNWAQLG  153



>ref|NP_568815.1| RNA-binding protein 45A [Arabidopsis thaliana]
 sp|Q9FPJ8.1|RB45A_ARATH RecName: Full=Polyadenylate-binding protein RBP45A; Short=Poly(A)-binding 
protein RBP45A; AltName: Full=RNA-binding protein 
45A; Short=AtRBP45A [Arabidopsis thaliana]
 gb|AAG40335.1|AF324983_1 AT5g54900 [Arabidopsis thaliana]
 gb|ABL66801.1| At5g54900 [Arabidopsis thaliana]
 gb|AED96554.1| RNA-binding protein 45A [Arabidopsis thaliana]
Length=387

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA +++SLWIGDLQ WMDE+Y+M  F  SGE  SAKVIRNK T QSEGYGFIEF++H+ A
Sbjct  55   SASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVA  114

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG PMP+ +Q FRLNWA  G
Sbjct  115  ERVLQTYNGAPMPSTEQTFRLNWAQAG  141



>dbj|BAB08769.1| unnamed protein product [Arabidopsis thaliana]
Length=390

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/87 (68%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA +++SLWIGDLQ WMDE+Y+M  F  SGE  SAKVIRNK T QSEGYGFIEF++H+ A
Sbjct  55   SASDVKSLWIGDLQQWMDENYIMSVFAQSGEATSAKVIRNKLTGQSEGYGFIEFVSHSVA  114

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG PMP+ +Q FRLNWA  G
Sbjct  115  ERVLQTYNGAPMPSTEQTFRLNWAQAG  141



>ref|XP_003518846.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 59/86 (69%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S+DEIR++W+GDL +WMDE+YL  CF  +GEVVSAKVIRNKQT QSEGYGF+EF +   A
Sbjct  95   SSDEIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRGTA  154

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            EK LQ YNGT MPN  Q FRLNWA+ 
Sbjct  155  EKVLQNYNGTMMPNTDQAFRLNWATF  180



>ref|XP_009137630.1| PREDICTED: polyadenylate-binding protein RBP45C-like [Brassica 
rapa]
Length=412

 Score =   134 bits (336),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 62/87 (71%), Positives = 70/87 (80%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SA EI+SLWIGDLQ WMDE YLM  F ++GEV  AKVIRNK T  +EGYGFIEF++HAAA
Sbjct  68   SAGEIKSLWIGDLQPWMDEGYLMSIFSITGEVQQAKVIRNKLTGLTEGYGFIEFVSHAAA  127

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQTYNG  MPN +Q FRLNWA LG
Sbjct  128  ERILQTYNGAQMPNCEQTFRLNWAQLG  154



>ref|XP_008226922.1| PREDICTED: polyadenylate-binding protein RBP45C [Prunus mume]
Length=406

 Score =   133 bits (335),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DEIRSLWIGDL  WMDE+Y++ CF  +GE V+AKVIRNKQT+  EGYGFIEF + +AAE+
Sbjct  66   DEIRSLWIGDLLPWMDENYILSCFGPTGEAVTAKVIRNKQTALPEGYGFIEFRSRSAAEQ  125

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQ YNGT MPN +QNFRLNWA+LG
Sbjct  126  ILQQYNGTLMPNTEQNFRLNWATLG  150



>ref|XP_007156541.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28535.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=363

 Score =   132 bits (333),  Expect = 1e-33, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S+DEIR++W+GDL +WMDE+YL  CF  +GEV+SAKVIRNKQT QSEGYGF+EF     A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            EK LQ YNGT MPN  Q FRLNWA+ 
Sbjct  89   EKVLQNYNGTMMPNTDQAFRLNWATF  114



>ref|XP_007156542.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
 gb|ESW28536.1| hypothetical protein PHAVU_003G294800g [Phaseolus vulgaris]
Length=367

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/86 (67%), Positives = 68/86 (79%), Gaps = 0/86 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S+DEIR++W+GDL +WMDE+YL  CF  +GEV+SAKVIRNKQT QSEGYGF+EF     A
Sbjct  29   SSDEIRTIWLGDLHHWMDENYLHNCFAHTGEVLSAKVIRNKQTGQSEGYGFVEFYTRPTA  88

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASL  547
            EK LQ YNGT MPN  Q FRLNWA+ 
Sbjct  89   EKVLQNYNGTMMPNTDQAFRLNWATF  114



>ref|XP_003529385.1| PREDICTED: polyadenylate-binding protein RBP47-like [Glycine 
max]
Length=431

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 59/84 (70%), Positives = 68/84 (81%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DEIR++W+GDL +WMDE+YL  CF  +GEVVSAKVIRNKQT QSEGYGF+EF + A AEK
Sbjct  98   DEIRTVWLGDLHHWMDENYLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFVEFYSRATAEK  157

Query  476  NLQTYNGTPMPNAQQNFRLNWASL  547
             LQ YNGT MPN  Q FRLNWA+ 
Sbjct  158  VLQNYNGTMMPNTDQAFRLNWATF  181



>ref|XP_007213954.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
 gb|EMJ15153.1| hypothetical protein PRUPE_ppa006577mg [Prunus persica]
Length=405

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/85 (71%), Positives = 71/85 (84%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DEIRSLWIGDL  WMDE+Y++ CF  +GE V+AKVIRNKQT+  EGYGFIEF + +AAE+
Sbjct  65   DEIRSLWIGDLLPWMDENYILSCFGPTGEAVTAKVIRNKQTALPEGYGFIEFRSRSAAEQ  124

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQ YNGT MPN +QNFRLNWA+LG
Sbjct  125  ILQQYNGTLMPNTEQNFRLNWATLG  149



>ref|XP_002889883.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
 gb|EFH66142.1| ATRBP45B [Arabidopsis lyrata subsp. lyrata]
Length=408

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 61/87 (70%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            + DEIR+LWIGDLQYWMDE++L  CF  +GE+VSAKVIRNKQT Q EGYGFIEF +HAAA
Sbjct  59   TVDEIRTLWIGDLQYWMDENFLYGCFAHTGEMVSAKVIRNKQTGQVEGYGFIEFASHAAA  118

Query  470  EKNLQTYNGTPMPN-AQQNFRLNWASL  547
            E+ LQT+N  P+P+   Q FRLNWASL
Sbjct  119  ERVLQTFNNAPIPSFPDQLFRLNWASL  145



>ref|XP_002522953.1| nuclear acid binding protein, putative [Ricinus communis]
 gb|EEF39383.1| nuclear acid binding protein, putative [Ricinus communis]
Length=404

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 62/82 (76%), Positives = 68/82 (83%), Gaps = 0/82 (0%)
 Frame = +2

Query  302  IRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEKNL  481
            I+SLWIGDLQ WMDE YL   F  +GEVVSAKVIRNKQT   EGYGFIEF+N AAAE+ L
Sbjct  65   IKSLWIGDLQQWMDEGYLFNIFSGTGEVVSAKVIRNKQTGMPEGYGFIEFINRAAAERIL  124

Query  482  QTYNGTPMPNAQQNFRLNWASL  547
            QTYNGT MPN +QNFRLNWA+L
Sbjct  125  QTYNGTQMPNTEQNFRLNWATL  146



>ref|XP_010910520.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Elaeis guineensis]
Length=332

 Score =   132 bits (331),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            SADE+R+LW+GDLQYWMDE Y+  CF  +GEVVS K+IR+KQT Q +GYGFIEF  HA+A
Sbjct  105  SADEVRTLWMGDLQYWMDESYVHGCFAHTGEVVSVKLIRDKQTGQLQGYGFIEFATHASA  164

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQ +NG  MPN  Q FRLNWAS G
Sbjct  165  ERVLQAFNGQMMPNVDQVFRLNWASAG  191



>ref|XP_010268853.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X2 [Nelumbo 
nucifera]
Length=408

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE +++W+GDL YWMDE YL  CF  +GEVVS KVIRNKQT QSEGYGF+EF +HAAAEK
Sbjct  67   DENKTIWVGDLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEK  126

Query  476  NLQTYNGTPMPNAQQNFRLNWASL  547
             L  YNGT MPN +  FRLNWAS 
Sbjct  127  VLHNYNGTAMPNTEHPFRLNWASF  150



>gb|ABR18422.1| unknown [Picea sitchensis]
Length=418

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LW+GDLQYWMDE Y+  CF  + EVVS K+IRNKQT QSEGYGF+EF +HA 
Sbjct  73   TSADEVRTLWVGDLQYWMDETYMQSCFGNNQEVVSVKIIRNKQTGQSEGYGFVEFASHAG  132

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ +NG  MPN +Q +RLNWA+ G
Sbjct  133  AERFLQNHNGAQMPNTEQFYRLNWATFG  160



>ref|XP_004294372.1| PREDICTED: polyadenylate-binding protein RBP45C [Fragaria vesca 
subsp. vesca]
Length=415

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 70/86 (81%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            +DEIRSLWIGDL  WMDE+Y++ CF  +GE V+AKVIRNKQT   EGYGFIEF   +AAE
Sbjct  72   SDEIRSLWIGDLLQWMDENYILNCFGPTGEAVNAKVIRNKQTGLPEGYGFIEFRTRSAAE  131

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQ YNGT MPN +QNFRLNWA+LG
Sbjct  132  QVLQNYNGTVMPNTEQNFRLNWATLG  157



>ref|XP_010268845.1| PREDICTED: polyadenylate-binding protein RBP47 isoform X1 [Nelumbo 
nucifera]
Length=413

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/84 (69%), Positives = 66/84 (79%), Gaps = 0/84 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE +++W+GDL YWMDE YL  CF  +GEVVS KVIRNKQT QSEGYGF+EF +HAAAEK
Sbjct  67   DENKTIWVGDLHYWMDESYLHNCFAHTGEVVSIKVIRNKQTGQSEGYGFVEFFSHAAAEK  126

Query  476  NLQTYNGTPMPNAQQNFRLNWASL  547
             L  YNGT MPN +  FRLNWAS 
Sbjct  127  VLHNYNGTAMPNTEHPFRLNWASF  150



>ref|XP_009131734.1| PREDICTED: polyadenylate-binding protein RBP47B' [Brassica rapa]
Length=430

 Score =   133 bits (335),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 69/85 (81%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDLQYW+DE+YL  CF  +GE+VS KVIRNK T Q EGYG IEF++HAAAE+
Sbjct  20   EEVRTLWIGDLQYWVDENYLTSCFSQTGELVSVKVIRNKITGQPEGYGVIEFVSHAAAER  79

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP  +  FRLNWAS G
Sbjct  80   TLQTYNGTLMPGTEVAFRLNWASFG  104



>ref|XP_008349848.1| PREDICTED: polyadenylate-binding protein RBP45-like, partial 
[Malus domestica]
Length=271

 Score =   130 bits (327),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 60/86 (70%), Positives = 69/86 (80%), Gaps = 0/86 (0%)
 Frame = +2

Query  293  ADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAE  472
            +DEIRSLWIGDL  WMDE Y++ CF  +GE V+AKVIRNK T   EGYGFIEF + A AE
Sbjct  64   SDEIRSLWIGDLLQWMDEAYILSCFGPTGEAVNAKVIRNKLTGLPEGYGFIEFRSRAXAE  123

Query  473  KNLQTYNGTPMPNAQQNFRLNWASLG  550
            + LQTYNGT MPN +QNFRLNWA+LG
Sbjct  124  QILQTYNGTLMPNTEQNFRLNWATLG  149



>ref|XP_003537962.1| PREDICTED: polyadenylate-binding protein RBP47B'-like isoform 
1 [Glycine max]
Length=401

 Score =   133 bits (334),  Expect = 2e-33, Method: Compositional matrix adjust.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            T+ +E+R+LWIGDLQYW+DE YL +CF  +GEVVS K+IRNK T Q EGYGF+EF++HA+
Sbjct  4    TAIEEVRTLWIGDLQYWVDESYLSQCFAHNGEVVSIKIIRNKLTGQPEGYGFVEFVSHAS  63

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE  L+TYNG  MP  +Q FRLNWAS G
Sbjct  64   AEAFLRTYNGAQMPGTEQTFRLNWASFG  91



>emb|CDY66423.1| BnaAnng22220D [Brassica napus]
Length=426

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/84 (71%), Positives = 71/84 (85%), Gaps = 0/84 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S DEIRSLWIGDLQ WMDE+YL+  F ++GEV  AKVIRNKQ+  SEGYGFIEF++HAAA
Sbjct  68   SGDEIRSLWIGDLQPWMDENYLVNSFSITGEVQQAKVIRNKQSGYSEGYGFIEFVSHAAA  127

Query  470  EKNLQTYNGTPMPNAQQNFRLNWA  541
            E+ LQTYNG  MPN++Q F+LNWA
Sbjct  128  ERILQTYNGALMPNSEQTFKLNWA  151



>ref|XP_006287675.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
 gb|EOA20573.1| hypothetical protein CARUB_v10000890mg, partial [Capsella rubella]
Length=467

 Score =   133 bits (335),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 58/85 (68%), Positives = 68/85 (80%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            +E+R+LWIGDL YW DE+YL  CF  +GE+VS KVIRNK T Q EGYGFIEF++H AAE+
Sbjct  65   EEVRTLWIGDLLYWADENYLTSCFSQTGELVSVKVIRNKITGQPEGYGFIEFVSHGAAER  124

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQTYNGT MP A+  FRLNWAS G
Sbjct  125  TLQTYNGTQMPGAELTFRLNWASFG  149



>ref|XP_007150369.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
 gb|ESW22363.1| hypothetical protein PHAVU_005G147800g [Phaseolus vulgaris]
Length=424

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 56/88 (64%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            ++ +E+R+LWIGDLQYW+DE YL  CF  +GEV+S K+IRNK T Q EGYGF+EF++HA+
Sbjct  12   STIEEVRTLWIGDLQYWVDEAYLSHCFAHTGEVLSIKIIRNKMTGQPEGYGFVEFVSHAS  71

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQTYNG  MP  +Q FRLNWAS G
Sbjct  72   AERVLQTYNGMQMPGTEQTFRLNWASFG  99



>ref|XP_004505196.1| PREDICTED: polyadenylate-binding protein RBP47-like [Cicer arietinum]
Length=442

 Score =   133 bits (334),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 68/87 (78%), Gaps = 0/87 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
             S DEI+++W+GDL +WMDE +L  CF  +GEVVSAKVIRNKQT QSEGYGFIEF + A 
Sbjct  98   VSPDEIKTIWLGDLHHWMDETFLHNCFAHTGEVVSAKVIRNKQTGQSEGYGFIEFYSRAT  157

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASL  547
            AEK LQ YNGT MPN  Q FRLNWAS 
Sbjct  158  AEKVLQNYNGTMMPNTDQAFRLNWASF  184



>ref|NP_001168324.1| hypothetical protein [Zea mays]
 gb|ACN27804.1| unknown [Zea mays]
 gb|ACN27818.1| unknown [Zea mays]
 gb|AFW68317.1| hypothetical protein ZEAMMB73_975236, partial [Zea mays]
Length=406

 Score =   132 bits (333),  Expect = 3e-33, Method: Compositional matrix adjust.
 Identities = 59/85 (69%), Positives = 67/85 (79%), Gaps = 0/85 (0%)
 Frame = +2

Query  296  DEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAAEK  475
            DE R+LWIGDLQYWMDE+YL  CF  +GEV+S K+IRNKQT Q EGYGFIEF NHA AE+
Sbjct  67   DEARTLWIGDLQYWMDENYLYSCFSQAGEVISVKIIRNKQTGQPEGYGFIEFSNHAVAEQ  126

Query  476  NLQTYNGTPMPNAQQNFRLNWASLG  550
             LQ YNG  MPN  Q F+LNWA+ G
Sbjct  127  VLQNYNGQMMPNVNQPFKLNWATSG  151



>gb|ABK25253.1| unknown [Picea sitchensis]
Length=487

 Score =   133 bits (334),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 58/88 (66%), Positives = 71/88 (81%), Gaps = 0/88 (0%)
 Frame = +2

Query  287  TSADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAA  466
            TSADE+R+LW+GDLQYWMDE Y+  CF  + EVVS K+IRNKQT QSEGYGF+EF +HA 
Sbjct  73   TSADEVRTLWVGDLQYWMDETYMQSCFGNNQEVVSVKIIRNKQTGQSEGYGFVEFASHAG  132

Query  467  AEKNLQTYNGTPMPNAQQNFRLNWASLG  550
            AE+ LQ +NG  MPN +Q +RLNWA+ G
Sbjct  133  AERFLQNHNGAQMPNTEQFYRLNWATFG  160



>ref|XP_006452315.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 ref|XP_006452316.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65555.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|ESR65556.1| hypothetical protein CICLE_v10008440mg [Citrus clementina]
 gb|KDO62644.1| hypothetical protein CISIN_1g015468mg [Citrus sinensis]
Length=320

 Score =   131 bits (329),  Expect = 4e-33, Method: Compositional matrix adjust.
 Identities = 60/87 (69%), Positives = 72/87 (83%), Gaps = 0/87 (0%)
 Frame = +2

Query  290  SADEIRSLWIGDLQYWMDEDYLMKCFYLSGEVVSAKVIRNKQTSQSEGYGFIEFMNHAAA  469
            S+D IRSLWIGDLQ WM+E Y+   F  +GE VS KVIRNKQT+ SEGYGFIEF++HAAA
Sbjct  69   SSDGIRSLWIGDLQPWMEESYIASIFGHTGEFVSGKVIRNKQTNFSEGYGFIEFVSHAAA  128

Query  470  EKNLQTYNGTPMPNAQQNFRLNWASLG  550
            E+ LQT+NGT MP+ +QNFRLNWA+ G
Sbjct  129  ERVLQTFNGTQMPSTEQNFRLNWATYG  155



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 603802497760