BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMFF001A01

Length=536
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_009620841.1|  PREDICTED: sulfate transporter 3.1-like isof...    143   1e-36   Nicotiana tomentosiformis
ref|XP_009620842.1|  PREDICTED: sulfate transporter 3.1-like isof...    143   2e-36   
ref|XP_009620843.1|  PREDICTED: sulfate transporter 3.1-like isof...    143   2e-36   Nicotiana tomentosiformis
ref|XP_009620840.1|  PREDICTED: sulfate transporter 3.1-like isof...    143   2e-36   Nicotiana tomentosiformis
gb|EYU41447.1|  hypothetical protein MIMGU_mgv1a002539mg                141   9e-36   Erythranthe guttata [common monkey flower]
ref|XP_006360746.1|  PREDICTED: sulfate transporter 3.1-like            139   6e-35   Solanum tuberosum [potatoes]
gb|KDP40223.1|  hypothetical protein JCGZ_02221                         137   2e-34   Jatropha curcas
ref|XP_004247591.1|  PREDICTED: sulfate transporter 3.1-like            137   3e-34   Solanum lycopersicum
ref|XP_008224259.1|  PREDICTED: sulfate transporter 3.1-like            136   7e-34   Prunus mume [ume]
ref|XP_009773834.1|  PREDICTED: sulfate transporter 3.1-like isof...    135   1e-33   Nicotiana sylvestris
ref|XP_009773833.1|  PREDICTED: sulfate transporter 3.1-like isof...    135   1e-33   Nicotiana sylvestris
ref|XP_007225118.1|  hypothetical protein PRUPE_ppa002648mg             135   2e-33   Prunus persica
ref|XP_009371954.1|  PREDICTED: sulfate transporter 3.1-like            135   2e-33   Pyrus x bretschneideri [bai li]
ref|XP_008390997.1|  PREDICTED: sulfate transporter 3.1-like isof...    135   2e-33   
ref|XP_010256149.1|  PREDICTED: sulfate transporter 3.1-like isof...    134   2e-33   Nelumbo nucifera [Indian lotus]
ref|XP_010256148.1|  PREDICTED: sulfate transporter 3.1-like isof...    134   2e-33   Nelumbo nucifera [Indian lotus]
gb|KJB72262.1|  hypothetical protein B456_011G167600                    134   3e-33   Gossypium raimondii
ref|XP_009335285.1|  PREDICTED: sulfate transporter 3.1-like            134   4e-33   Pyrus x bretschneideri [bai li]
emb|CBI26298.3|  unnamed protein product                                134   6e-33   Vitis vinifera
ref|XP_002283184.2|  PREDICTED: sulfate transporter 3.1-like            133   7e-33   Vitis vinifera
ref|XP_002314667.1|  hypothetical protein POPTR_0010s09280g             133   9e-33   
ref|XP_002312546.2|  hypothetical protein POPTR_0008s15640g             133   1e-32   
ref|XP_011090680.1|  PREDICTED: sulfate transporter 3.1-like            133   1e-32   Sesamum indicum [beniseed]
ref|XP_007034842.1|  Sulfate transporter, putative isoform 1            133   1e-32   
ref|XP_007034843.1|  Sulfate transporter, putative isoform 2            132   1e-32   
ref|XP_011030640.1|  PREDICTED: sulfate transporter 3.1-like            132   1e-32   Populus euphratica
gb|ABB59577.2|  putative sulfate transporter                            132   2e-32   Populus tremula x Populus alba [gray poplar]
ref|XP_011026981.1|  PREDICTED: sulfate transporter 3.1-like            131   3e-32   Populus euphratica
gb|KDO74470.1|  hypothetical protein CISIN_1g006373mg                   131   3e-32   Citrus sinensis [apfelsine]
ref|XP_006489450.1|  PREDICTED: sulfate transporter 3.1-like            131   3e-32   Citrus sinensis [apfelsine]
ref|XP_006420023.1|  hypothetical protein CICLE_v10004520mg             131   5e-32   Citrus clementina [clementine]
ref|XP_008390930.1|  PREDICTED: sulfate transporter 3.1-like            130   1e-31   Malus domestica [apple tree]
ref|XP_010024227.1|  PREDICTED: sulfate transporter 3.1-like            130   1e-31   Eucalyptus grandis [rose gum]
gb|KHN03817.1|  Sulfate transporter 3.1                                 129   2e-31   Glycine soja [wild soybean]
ref|XP_003536673.1|  PREDICTED: sulfate transporter 3.1-like            129   2e-31   Glycine max [soybeans]
ref|XP_010259124.1|  PREDICTED: sulfate transporter 3.1-like            128   5e-31   Nelumbo nucifera [Indian lotus]
ref|XP_003632327.1|  PREDICTED: sulfate transporter 3.1-like            128   6e-31   Vitis vinifera
emb|CBI28733.3|  unnamed protein product                                128   6e-31   Vitis vinifera
emb|CDO99099.1|  unnamed protein product                                128   7e-31   Coffea canephora [robusta coffee]
ref|XP_009609980.1|  PREDICTED: sulfate transporter 3.1-like            127   1e-30   Nicotiana tomentosiformis
ref|XP_009778206.1|  PREDICTED: sulfate transporter 3.1-like            127   1e-30   Nicotiana sylvestris
ref|XP_002517080.1|  sulfate transporter, putative                      126   2e-30   
ref|XP_010092428.1|  Sulfate transporter 3.1                            126   4e-30   Morus notabilis
ref|XP_003518908.2|  PREDICTED: sulfate transporter 3.1-like            125   8e-30   Glycine max [soybeans]
emb|CDY40238.1|  BnaA09g35200D                                          120   1e-29   Brassica napus [oilseed rape]
emb|CDX73683.1|  BnaC08g23200D                                          124   2e-29   
dbj|BAA25175.1|  sulfate transporter                                    124   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009612528.1|  PREDICTED: sulfate transporter 3.1-like            124   2e-29   Nicotiana tomentosiformis
dbj|BAA21657.1|  sulfate transporter                                    124   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|NP_190758.2|  sulfate transporter 3;1                               124   2e-29   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009804926.1|  PREDICTED: sulfate transporter 3.1-like            123   3e-29   Nicotiana sylvestris
ref|XP_010679106.1|  PREDICTED: sulfate transporter 3.1                 123   3e-29   Beta vulgaris subsp. vulgaris [field beet]
gb|KDP21414.1|  hypothetical protein JCGZ_21885                         123   3e-29   Jatropha curcas
ref|XP_011079899.1|  PREDICTED: sulfate transporter 3.1                 123   3e-29   Sesamum indicum [beniseed]
ref|XP_006349709.1|  PREDICTED: sulfate transporter 3.1-like            123   4e-29   Solanum tuberosum [potatoes]
gb|KHG29534.1|  Sulfate transporter 3                                   122   6e-29   Gossypium arboreum [tree cotton]
emb|CDY70201.1|  BnaAnng32950D                                          120   9e-29   Brassica napus [oilseed rape]
ref|XP_010515628.1|  PREDICTED: sulfate transporter 3.1-like isof...    122   1e-28   Camelina sativa [gold-of-pleasure]
gb|KEH23810.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    122   1e-28   Medicago truncatula
ref|XP_010503899.1|  PREDICTED: sulfate transporter 3.1-like            122   1e-28   Camelina sativa [gold-of-pleasure]
ref|XP_010426769.1|  PREDICTED: sulfate transporter 3.1 isoform X1      122   1e-28   Camelina sativa [gold-of-pleasure]
emb|CAN61401.1|  hypothetical protein VITISV_011489                     122   1e-28   Vitis vinifera
gb|KHG01733.1|  Sulfate transporter 3                                   122   1e-28   Gossypium arboreum [tree cotton]
gb|KJB46950.1|  hypothetical protein B456_008G002800                    120   1e-28   Gossypium raimondii
gb|KJB46951.1|  hypothetical protein B456_008G002800                    120   1e-28   Gossypium raimondii
gb|KEH23811.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    120   1e-28   Medicago truncatula
ref|XP_008366542.1|  PREDICTED: sulfate transporter 3.1-like            121   2e-28   Malus domestica [apple tree]
ref|XP_002279213.1|  PREDICTED: sulfate transporter 3.1                 121   2e-28   Vitis vinifera
ref|XP_010102377.1|  Sulfate transporter 3.1                            121   2e-28   Morus notabilis
ref|XP_007050523.1|  Sulfate transporter 3,1                            121   2e-28   
gb|KJB42154.1|  hypothetical protein B456_007G139400                    121   2e-28   Gossypium raimondii
gb|KJB46949.1|  hypothetical protein B456_008G002800                    121   2e-28   Gossypium raimondii
ref|XP_004296670.1|  PREDICTED: sulfate transporter 3.1-like            120   3e-28   Fragaria vesca subsp. vesca
ref|XP_008368821.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    120   3e-28   
gb|KGN56948.1|  hypothetical protein Csa_3G146340                       120   4e-28   Cucumis sativus [cucumbers]
ref|XP_004166382.1|  PREDICTED: sulfate transporter 3.1-like            120   4e-28   
ref|XP_004134124.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...    120   4e-28   
emb|CAE46442.1|  sulphate transporter                                   120   4e-28   Brassica napus [oilseed rape]
gb|AAC14417.1|  unknown                                                 120   6e-28   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009115890.1|  PREDICTED: sulfate transporter 3.1                 120   6e-28   Brassica rapa
ref|XP_006838985.1|  hypothetical protein AMTR_s00002p00271530          119   9e-28   Amborella trichopoda
ref|XP_011032651.1|  PREDICTED: sulfate transporter 3.1-like            119   1e-27   Populus euphratica
emb|CBI26299.3|  unnamed protein product                                119   1e-27   Vitis vinifera
emb|CDY70327.1|  BnaCnng67820D                                          117   1e-27   Brassica napus [oilseed rape]
ref|XP_006352762.1|  PREDICTED: sulfate transporter 3.1-like            119   1e-27   Solanum tuberosum [potatoes]
emb|CDY29052.1|  BnaC07g32580D                                          119   1e-27   Brassica napus [oilseed rape]
ref|XP_010652002.1|  PREDICTED: sulfate transporter 3.1-like            119   1e-27   Vitis vinifera
ref|XP_004247192.1|  PREDICTED: sulfate transporter 3.1                 119   1e-27   Solanum lycopersicum
gb|EYU40896.1|  hypothetical protein MIMGU_mgv1a002568mg                119   1e-27   Erythranthe guttata [common monkey flower]
ref|XP_009367588.1|  PREDICTED: sulfate transporter 3.1-like            118   2e-27   Pyrus x bretschneideri [bai li]
ref|XP_006444002.1|  hypothetical protein CICLE_v10019207mg             118   2e-27   Citrus clementina [clementine]
ref|XP_002307605.1|  Sulfate transporter 3.2 family protein             118   2e-27   Populus trichocarpa [western balsam poplar]
ref|XP_008438625.1|  PREDICTED: sulfate transporter 3.1                 117   3e-27   Cucumis melo [Oriental melon]
ref|XP_007162459.1|  hypothetical protein PHAVU_001G154200g             117   3e-27   Phaseolus vulgaris [French bean]
ref|XP_011082583.1|  PREDICTED: sulfate transporter 3.1-like            117   5e-27   Sesamum indicum [beniseed]
emb|CDP03663.1|  unnamed protein product                                117   5e-27   Coffea canephora [robusta coffee]
ref|XP_009136641.1|  PREDICTED: sulfate transporter 3.1-like            117   5e-27   Brassica rapa
ref|XP_009370789.1|  PREDICTED: sulfate transporter 3.1-like            117   6e-27   Pyrus x bretschneideri [bai li]
ref|XP_003554265.1|  PREDICTED: sulfate transporter 3.1-like            116   9e-27   Glycine max [soybeans]
ref|XP_003521258.1|  PREDICTED: sulfate transporter 3.1-like            116   1e-26   Glycine max [soybeans]
ref|XP_004242345.1|  PREDICTED: sulfate transporter 3.1-like            116   1e-26   Solanum lycopersicum
ref|XP_007201737.1|  hypothetical protein PRUPE_ppa002556mg             116   1e-26   Prunus persica
ref|XP_007144655.1|  hypothetical protein PHAVU_007G174100g             116   1e-26   Phaseolus vulgaris [French bean]
ref|XP_006403870.1|  hypothetical protein EUTSA_v10010178mg             115   2e-26   Eutrema salsugineum [saltwater cress]
dbj|BAJ34524.1|  unnamed protein product                                115   2e-26   Eutrema halophilum
ref|XP_006290679.1|  hypothetical protein CARUB_v10016772mg             115   2e-26   
ref|XP_002877831.1|  sulfate transporter                                115   2e-26   Arabidopsis lyrata subsp. lyrata
emb|CDX90628.1|  BnaA03g41530D                                          115   2e-26   
ref|XP_004290627.1|  PREDICTED: sulfate transporter 3.1                 115   2e-26   Fragaria vesca subsp. vesca
ref|XP_010552756.1|  PREDICTED: sulfate transporter 3.1 isoform X2      115   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_010552755.1|  PREDICTED: sulfate transporter 3.1 isoform X1      115   2e-26   Tarenaya hassleriana [spider flower]
ref|XP_003590594.1|  Sulfate/bicarbonate/oxalate exchanger and tr...    114   4e-26   Medicago truncatula
gb|EYU46548.1|  hypothetical protein MIMGU_mgv1a002543mg                114   4e-26   Erythranthe guttata [common monkey flower]
ref|XP_008235373.1|  PREDICTED: sulfate transporter 3.1-like            114   8e-26   Prunus mume [ume]
gb|KFK34430.1|  hypothetical protein AALP_AA5G143800                    113   1e-25   Arabis alpina [alpine rockcress]
ref|XP_004493701.1|  PREDICTED: sulfate transporter 3.1-like            112   3e-25   Cicer arietinum [garbanzo]
ref|XP_004495176.1|  PREDICTED: sulfate transporter 3.1-like            112   4e-25   Cicer arietinum [garbanzo]
ref|XP_009403141.1|  PREDICTED: probable sulfate transporter 3.3        109   2e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010917792.1|  PREDICTED: sulfate transporter 3.1-like            109   3e-24   Elaeis guineensis
ref|XP_004298019.1|  PREDICTED: sulfate transporter 3.1-like            108   4e-24   Fragaria vesca subsp. vesca
ref|XP_002300821.2|  Sulfate transporter 3.2 family protein             108   5e-24   Populus trichocarpa [western balsam poplar]
ref|XP_011026121.1|  PREDICTED: sulfate transporter 3.1-like            108   5e-24   Populus euphratica
ref|XP_008809388.1|  PREDICTED: sulfate transporter 3.1-like            108   8e-24   Phoenix dactylifera
ref|XP_009419196.1|  PREDICTED: sulfate transporter 3.1-like            107   2e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008807263.1|  PREDICTED: sulfate transporter 3.1-like            107   2e-23   Phoenix dactylifera
ref|XP_010932801.1|  PREDICTED: sulfate transporter 3.1-like isof...    105   5e-23   Elaeis guineensis
ref|XP_004146971.1|  PREDICTED: sulfate transporter 3.1-like            105   5e-23   Cucumis sativus [cucumbers]
gb|EPS58454.1|  hypothetical protein M569_16360                         102   5e-23   Genlisea aurea
ref|XP_010070167.1|  PREDICTED: sulfate transporter 3.1-like            105   8e-23   Eucalyptus grandis [rose gum]
ref|XP_009381462.1|  PREDICTED: probable sulfate transporter 3.3        105   8e-23   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_010556774.1|  PREDICTED: sulfate transporter 3.2 isoform X1      104   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010556775.1|  PREDICTED: sulfate transporter 3.2 isoform X2      104   2e-22   Tarenaya hassleriana [spider flower]
ref|XP_010274709.1|  PREDICTED: probable sulfate transporter 3.3        104   2e-22   Nelumbo nucifera [Indian lotus]
ref|XP_004172241.1|  PREDICTED: sulfate transporter 3.1-like          99.0    3e-22   
ref|XP_009613802.1|  PREDICTED: probable sulfate transporter 3.5 ...    102   5e-22   Nicotiana tomentosiformis
ref|XP_011463580.1|  PREDICTED: sulfate transporter 3.1-like            102   5e-22   Fragaria vesca subsp. vesca
ref|XP_009613801.1|  PREDICTED: probable sulfate transporter 3.5 ...    102   6e-22   Nicotiana tomentosiformis
ref|XP_009393046.1|  PREDICTED: sulfate transporter 3.1-like            102   1e-21   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009802339.1|  PREDICTED: probable sulfate transporter 3.3        102   1e-21   Nicotiana sylvestris
gb|KHN43015.1|  Putative sulfate transporter 3.3                        102   1e-21   Glycine soja [wild soybean]
ref|XP_003528541.2|  PREDICTED: probable sulfate transporter 3.3-...    101   2e-21   Glycine max [soybeans]
ref|XP_009604001.1|  PREDICTED: probable sulfate transporter 3.3        101   2e-21   Nicotiana tomentosiformis
gb|KHN08075.1|  Putative sulfate transporter 3.3                        101   2e-21   Glycine soja [wild soybean]
ref|XP_003556073.1|  PREDICTED: probable sulfate transporter 3.3-...    101   2e-21   Glycine max [soybeans]
emb|CAE03539.2|  OSJNBa0060D06.5                                        100   3e-21   Oryza sativa Japonica Group [Japonica rice]
gb|AGW45462.1|  sulfate/bicarbonate/oxalate exchanger and transpo...    100   3e-21   Reaumuria trigyna
ref|NP_001054098.1|  Os04g0652400                                       100   3e-21   
ref|XP_010314055.1|  PREDICTED: probable sulfate transporter 3.5        100   4e-21   Solanum lycopersicum
ref|XP_008775815.1|  PREDICTED: probable sulfate transporter 3.3        100   6e-21   
ref|XP_009757060.1|  PREDICTED: probable sulfate transporter 3.5 ...  99.8    6e-21   Nicotiana sylvestris
ref|XP_011038634.1|  PREDICTED: probable sulfate transporter 3.3      99.8    7e-21   Populus euphratica
ref|XP_009757059.1|  PREDICTED: probable sulfate transporter 3.5 ...  99.8    7e-21   Nicotiana sylvestris
ref|XP_009757058.1|  PREDICTED: probable sulfate transporter 3.5 ...  99.8    7e-21   Nicotiana sylvestris
ref|XP_004505276.1|  PREDICTED: probable sulfate transporter 3.3-...  99.8    9e-21   Cicer arietinum [garbanzo]
ref|XP_004505277.1|  PREDICTED: probable sulfate transporter 3.3-...  99.4    1e-20   
ref|XP_002314803.2|  sulfate transporter 3.3 family protein           99.4    1e-20   
ref|XP_007157748.1|  hypothetical protein PHAVU_002G095200g           99.4    1e-20   Phaseolus vulgaris [French bean]
gb|KHN43014.1|  Putative sulfate transporter 3.3                      99.4    1e-20   Glycine soja [wild soybean]
ref|XP_003529415.1|  PREDICTED: probable sulfate transporter 3.3-...  99.4    1e-20   Glycine max [soybeans]
gb|KHN02638.1|  Putative sulfate transporter 3.3                      95.1    1e-20   Glycine soja [wild soybean]
ref|XP_009405950.1|  PREDICTED: sulfate transporter 3.1-like          99.0    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_011078361.1|  PREDICTED: probable sulfate transporter 3.5      99.0    1e-20   Sesamum indicum [beniseed]
ref|XP_006583911.1|  PREDICTED: probable sulfate transporter 3.3-...  99.0    2e-20   Glycine max [soybeans]
ref|XP_006366873.1|  PREDICTED: probable sulfate transporter 3.5-...  99.0    2e-20   Solanum tuberosum [potatoes]
ref|XP_007157749.1|  hypothetical protein PHAVU_002G095300g           99.0    2e-20   Phaseolus vulgaris [French bean]
gb|KEH30849.1|  sulfate/bicarbonate/oxalate exchanger and transpo...  99.0    2e-20   Medicago truncatula
ref|XP_009622161.1|  PREDICTED: probable sulfate transporter 3.3      94.4    2e-20   Nicotiana tomentosiformis
gb|KDO64646.1|  hypothetical protein CISIN_1g006141mg                 98.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_006448250.1|  hypothetical protein CICLE_v10014538mg           98.6    2e-20   Citrus clementina [clementine]
ref|XP_006469182.1|  PREDICTED: probable sulfate transporter 3.3-...  98.6    2e-20   Citrus sinensis [apfelsine]
ref|XP_006652928.1|  PREDICTED: probable sulfate transporter 3.3-...  98.6    2e-20   
ref|XP_007045150.1|  Sulfate transporter 91                           98.6    2e-20   Theobroma cacao [chocolate]
ref|XP_006366875.1|  PREDICTED: probable sulfate transporter 3.5-...  98.2    2e-20   Solanum tuberosum [potatoes]
ref|XP_010943102.1|  PREDICTED: probable sulfate transporter 3.3 ...  98.2    2e-20   Elaeis guineensis
ref|XP_010943103.1|  PREDICTED: probable sulfate transporter 3.3 ...  97.8    3e-20   
ref|XP_004977057.1|  PREDICTED: probable sulfate transporter 3.3-...  97.8    3e-20   Setaria italica
ref|XP_011091968.1|  PREDICTED: probable sulfate transporter 3.5      97.8    4e-20   Sesamum indicum [beniseed]
ref|XP_002980841.1|  hypothetical protein SELMODRAFT_113596           97.8    4e-20   Selaginella moellendorffii
ref|XP_002989364.1|  hypothetical protein SELMODRAFT_184503           97.8    4e-20   Selaginella moellendorffii
gb|ABK26681.1|  unknown                                               94.4    4e-20   Picea sitchensis
ref|XP_009763583.1|  PREDICTED: probable sulfate transporter 3.3      95.1    4e-20   Nicotiana sylvestris
gb|KJB50368.1|  hypothetical protein B456_008G166800                  97.4    5e-20   Gossypium raimondii
emb|CAN77009.1|  hypothetical protein VITISV_036877                   97.4    5e-20   Vitis vinifera
gb|EYU23026.1|  hypothetical protein MIMGU_mgv1a002785mg              97.1    6e-20   Erythranthe guttata [common monkey flower]
ref|XP_002280766.1|  PREDICTED: probable sulfate transporter 3.3      97.1    6e-20   Vitis vinifera
gb|ABR16213.1|  unknown                                               97.1    6e-20   Picea sitchensis
ref|XP_002281248.1|  PREDICTED: probable sulfate transporter 3.5      97.1    7e-20   Vitis vinifera
ref|XP_004252053.1|  PREDICTED: probable sulfate transporter 3.5      97.1    7e-20   Solanum lycopersicum
emb|CBI26897.3|  unnamed protein product                              96.7    8e-20   Vitis vinifera
gb|KHG23018.1|  putative sulfate transporter 3.3 -like protein        96.7    1e-19   Gossypium arboreum [tree cotton]
gb|ACQ77597.1|  sulfate transporter                                   93.6    1e-19   Dimocarpus longan [longan]
ref|XP_002448662.1|  hypothetical protein SORBIDRAFT_06g030980        96.3    1e-19   Sorghum bicolor [broomcorn]
ref|XP_004238829.1|  PREDICTED: probable sulfate transporter 3.3      95.9    2e-19   Solanum lycopersicum
ref|XP_006355098.1|  PREDICTED: probable sulfate transporter 3.3-...  95.9    2e-19   Solanum tuberosum [potatoes]
ref|XP_006826848.1|  hypothetical protein AMTR_s00010p00108760        95.9    2e-19   
ref|XP_002991793.1|  hypothetical protein SELMODRAFT_134130           95.5    2e-19   
ref|XP_002989687.1|  hypothetical protein SELMODRAFT_184750           95.5    2e-19   
gb|KJB15437.1|  hypothetical protein B456_002G178600                  95.1    2e-19   Gossypium raimondii
ref|XP_009760537.1|  PREDICTED: probable sulfate transporter 3.5      95.1    3e-19   Nicotiana sylvestris
gb|KJB15438.1|  hypothetical protein B456_002G178600                  95.1    3e-19   Gossypium raimondii
gb|KJB15435.1|  hypothetical protein B456_002G178600                  95.1    3e-19   Gossypium raimondii
gb|KJB15439.1|  hypothetical protein B456_002G178600                  95.1    3e-19   Gossypium raimondii
gb|KJB15440.1|  hypothetical protein B456_002G178600                  94.7    4e-19   Gossypium raimondii
ref|XP_011023507.1|  PREDICTED: probable sulfate transporter 3.3      94.7    4e-19   Populus euphratica
gb|ABK35746.2|  sulfate transporter                                   94.4    5e-19   Populus tremula x Populus alba [gray poplar]
ref|XP_003580696.2|  PREDICTED: LOW QUALITY PROTEIN: probable sul...  94.4    6e-19   
ref|XP_002968282.1|  hypothetical protein SELMODRAFT_169988           94.4    6e-19   
ref|XP_002976095.1|  hypothetical protein SELMODRAFT_175286           94.0    7e-19   
ref|XP_008444099.1|  PREDICTED: sulfate transporter 1.3-like          94.0    8e-19   
ref|XP_004150525.1|  PREDICTED: sulfate transporter 1.3-like          94.0    8e-19   Cucumis sativus [cucumbers]
gb|KDP32302.1|  hypothetical protein JCGZ_13227                       93.6    1e-18   Jatropha curcas
ref|XP_008780888.1|  PREDICTED: sulfate transporter 1.2-like          93.6    1e-18   Phoenix dactylifera
ref|XP_008339548.1|  PREDICTED: probable sulfate transporter 3.3      93.6    1e-18   Malus domestica [apple tree]
ref|XP_002312444.2|  sulfate transporter 3.3 family protein           93.6    1e-18   
ref|XP_006379763.1|  hypothetical protein POPTR_0008s12940g           93.6    1e-18   Populus trichocarpa [western balsam poplar]
ref|XP_004297375.2|  PREDICTED: probable sulfate transporter 3.3      93.6    1e-18   Fragaria vesca subsp. vesca
ref|XP_009351474.1|  PREDICTED: probable sulfate transporter 3.3      92.8    2e-18   Pyrus x bretschneideri [bai li]
ref|XP_004505280.1|  PREDICTED: probable sulfate transporter 3.3-...  92.8    2e-18   
gb|KJB15436.1|  hypothetical protein B456_002G178600                  92.0    2e-18   Gossypium raimondii
ref|XP_009392358.1|  PREDICTED: sulfate transporter 3.1-like          92.8    2e-18   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_004505279.1|  PREDICTED: probable sulfate transporter 3.3-...  92.8    2e-18   Cicer arietinum [garbanzo]
gb|KEH30847.1|  sulfate/bicarbonate/oxalate exchanger and transpo...  92.4    2e-18   Medicago truncatula
emb|CAA65536.1|  sulphate transporter protein                         92.4    3e-18   Sporobolus stapfianus [resurrection grass]
gb|ABK35748.1|  sulfate transporter                                   92.4    3e-18   Populus tremula x Populus alba [gray poplar]
ref|XP_004165559.1|  PREDICTED: LOW QUALITY PROTEIN: probable sul...  92.4    3e-18   
ref|XP_004140467.1|  PREDICTED: probable sulfate transporter 3.3-...  92.4    3e-18   Cucumis sativus [cucumbers]
gb|ABK24712.1|  unknown                                               91.7    3e-18   Picea sitchensis
gb|KDP32700.1|  hypothetical protein JCGZ_11992                       92.0    3e-18   Jatropha curcas
ref|XP_010688172.1|  PREDICTED: probable sulfate transporter 3.5      92.0    4e-18   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009758428.1|  PREDICTED: sulfate transporter 1.3-like          92.0    4e-18   Nicotiana sylvestris
ref|XP_010088531.1|  putative sulfate transporter 3.3                 92.0    4e-18   
ref|XP_010254170.1|  PREDICTED: probable sulfate transporter 3.5 ...  91.7    4e-18   Nelumbo nucifera [Indian lotus]
ref|XP_011074140.1|  PREDICTED: sulfate transporter 1.3               91.7    5e-18   
ref|XP_010044185.1|  PREDICTED: probable sulfate transporter 3.3 ...  91.7    5e-18   Eucalyptus grandis [rose gum]
ref|XP_008454781.1|  PREDICTED: probable sulfate transporter 3.3      91.3    6e-18   Cucumis melo [Oriental melon]
ref|XP_010044186.1|  PREDICTED: probable sulfate transporter 3.3 ...  91.3    6e-18   Eucalyptus grandis [rose gum]
gb|AGT40333.1|  sulfate transporter                                   91.3    6e-18   Nicotiana attenuata
ref|XP_004237882.1|  PREDICTED: sulfate transporter 1.3               91.3    7e-18   Solanum lycopersicum
ref|XP_010254171.1|  PREDICTED: probable sulfate transporter 3.5 ...  90.9    7e-18   Nelumbo nucifera [Indian lotus]
gb|ACN39795.1|  unknown                                               91.3    7e-18   Picea sitchensis
ref|XP_010254173.1|  PREDICTED: probable sulfate transporter 3.5 ...  90.9    7e-18   
ref|XP_006354018.1|  PREDICTED: sulfate transporter 1.3-like          91.3    7e-18   Solanum tuberosum [potatoes]
ref|XP_002526028.1|  sulfate transporter, putative                    90.9    8e-18   Ricinus communis
ref|XP_009595009.1|  PREDICTED: probable sulfate transporter 3.5      90.9    9e-18   Nicotiana tomentosiformis
ref|XP_011015979.1|  PREDICTED: sulfate transporter 1.2-like          90.9    1e-17   Populus euphratica
ref|XP_011006147.1|  PREDICTED: sulfate transporter 1.2-like          90.9    1e-17   Populus euphratica
ref|XP_002307394.1|  high affinity sulfate transporter family pro...  90.5    1e-17   
ref|XP_009339687.1|  PREDICTED: probable sulfate transporter 3.3      90.5    1e-17   
ref|XP_006287241.1|  hypothetical protein CARUB_v10000428mg           90.1    1e-17   Capsella rubella
ref|XP_010261543.1|  PREDICTED: sulfate transporter 1.2-like          90.1    1e-17   Nelumbo nucifera [Indian lotus]
gb|AAM14588.1|AF493790_1  putative sulphate transporter               90.1    2e-17   Oryza sativa Indica Group [Indian rice]
ref|NP_001049259.1|  Os03g0195800                                     90.1    2e-17   
ref|XP_011075526.1|  PREDICTED: probable sulfate transporter 3.3      90.1    2e-17   Sesamum indicum [beniseed]
ref|XP_010455991.1|  PREDICTED: sulfate transporter 3.2-like          90.1    2e-17   Camelina sativa [gold-of-pleasure]
ref|NP_001169671.1|  uncharacterized protein LOC100383552             90.1    2e-17   Zea mays [maize]
ref|XP_009629531.1|  PREDICTED: sulfate transporter 1.3-like          90.1    2e-17   Nicotiana tomentosiformis
ref|XP_009103200.1|  PREDICTED: probable sulfate transporter 3.3 ...  89.7    2e-17   Brassica rapa
ref|XP_010051595.1|  PREDICTED: probable sulfate transporter 3.5      89.7    2e-17   Eucalyptus grandis [rose gum]
ref|XP_010926258.1|  PREDICTED: sulfate transporter 1.2-like          89.7    2e-17   Elaeis guineensis
ref|XP_008389211.1|  PREDICTED: probable sulfate transporter 3.3      89.7    2e-17   
ref|XP_011098138.1|  PREDICTED: sulfate transporter 1.2-like          89.7    2e-17   Sesamum indicum [beniseed]
emb|CDP03354.1|  unnamed protein product                              89.7    2e-17   Coffea canephora [robusta coffee]
gb|EPS57748.1|  hypothetical protein M569_17069                       89.4    2e-17   Genlisea aurea
sp|P53392.1|SUT2_STYHA  RecName: Full=High affinity sulfate trans...  89.7    3e-17   Stylosanthes hamata [Caribbean stylo]
ref|XP_009103199.1|  PREDICTED: probable sulfate transporter 3.3 ...  89.4    3e-17   Brassica rapa
emb|CBK55652.1|  sulphate transporter                                 89.7    3e-17   Astragalus racemosus
ref|XP_010049718.1|  PREDICTED: probable sulfate transporter 3.5      89.4    3e-17   Eucalyptus grandis [rose gum]
gb|KFK44398.1|  hypothetical protein AALP_AA1G252200                  89.4    3e-17   Arabis alpina [alpine rockcress]
ref|XP_008243372.1|  PREDICTED: probable sulfate transporter 3.3      89.4    3e-17   
ref|XP_007225166.1|  hypothetical protein PRUPE_ppa002313mg           89.4    3e-17   
dbj|BAJ85696.1|  predicted protein                                    89.4    3e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_007018858.1|  Sulfate transporter 1,3 isoform 2                89.4    3e-17   
gb|KJB32009.1|  hypothetical protein B456_005G218600                  89.4    3e-17   Gossypium raimondii
ref|XP_006306275.1|  hypothetical protein CARUB_v10012133mg           89.0    4e-17   Capsella rubella
ref|XP_010460085.1|  PREDICTED: probable sulfate transporter 3.3      89.0    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010477593.1|  PREDICTED: probable sulfate transporter 3.3      89.0    4e-17   Camelina sativa [gold-of-pleasure]
ref|XP_006343117.1|  PREDICTED: probable sulfate transporter 3.4-...  89.0    4e-17   Solanum tuberosum [potatoes]
ref|XP_007018857.1|  Sulfate transporter 1,3 isoform 1                89.4    4e-17   
ref|XP_002528191.1|  sulfate transporter, putative                    89.0    4e-17   Ricinus communis
dbj|BAA75015.1|  sulfate transporter                                  89.0    4e-17   
ref|XP_010250358.1|  PREDICTED: probable sulfate transporter 3.5      89.0    4e-17   
ref|NP_173722.1|  sulfate transporter 3.3                             89.0    4e-17   
ref|XP_002893261.1|  hypothetical protein ARALYDRAFT_472562           88.6    5e-17   
ref|XP_004969770.1|  PREDICTED: sulfate transporter 3.1-like          88.6    5e-17   
emb|CBK55651.1|  sulphate transporter                                 88.6    5e-17   
ref|XP_009615183.1|  PREDICTED: probable sulfate transporter 3.4      88.6    6e-17   
ref|XP_004235704.1|  PREDICTED: probable sulfate transporter 3.4      88.6    6e-17   
tpg|DAA35655.1|  TPA: hypothetical protein ZEAMMB73_371925            83.6    6e-17   
ref|XP_008463375.1|  PREDICTED: probable sulfate transporter 3.5      88.6    6e-17   
ref|NP_192179.1|  sulfate transporter 3.2                             88.2    7e-17   
ref|XP_010030062.1|  PREDICTED: sulfate transporter 1.3-like          88.2    7e-17   
emb|CDY04744.1|  BnaC05g18450D                                        88.2    7e-17   
emb|CDY21415.1|  BnaA09g30120D                                        88.2    7e-17   
ref|XP_010269183.1|  PREDICTED: sulfate transporter 1.2-like          88.2    9e-17   
emb|CDY21905.1|  BnaC09g00110D                                        86.3    9e-17   
gb|ABK35751.2|  sulfate transporter                                   87.8    1e-16   
emb|CBI28093.3|  unnamed protein product                              87.8    1e-16   
ref|XP_010249813.1|  PREDICTED: probable sulfate transporter 3.4      87.4    1e-16   
ref|XP_006649558.1|  PREDICTED: sulfate transporter 1.2-like          87.4    1e-16   
ref|XP_007043017.1|  Sulfate transporter 1,3 isoform 2                87.4    1e-16   
ref|XP_002281235.1|  PREDICTED: probable sulfate transporter 3.4 ...  87.4    1e-16   
ref|XP_007043016.1|  Sulfate transporter 1,3 isoform 1                87.4    1e-16   
ref|XP_010030063.1|  PREDICTED: sulfate transporter 1.3-like          87.4    2e-16   
ref|XP_003569695.1|  PREDICTED: probable sulfate transporter 3.5      87.0    2e-16   
ref|NP_001141114.1|  uncharacterized protein LOC100273198             87.0    2e-16   
ref|XP_004985613.1|  PREDICTED: sulfate transporter 3.1-like          87.0    2e-16   
gb|KJB59131.1|  hypothetical protein B456_009G240000                  87.0    2e-16   
ref|XP_007204231.1|  hypothetical protein PRUPE_ppa002608mg           87.0    2e-16   
ref|XP_010656340.1|  PREDICTED: probable sulfate transporter 3.4 ...  86.7    2e-16   
ref|XP_010688173.1|  PREDICTED: probable sulfate transporter 3.4      87.0    2e-16   
ref|XP_010430059.1|  PREDICTED: sulfate transporter 3.2 isoform X2    86.7    2e-16   
ref|XP_010430049.1|  PREDICTED: sulfate transporter 3.2 isoform X1    86.7    2e-16   
ref|XP_009592454.1|  PREDICTED: sulfate transporter 1.3-like          86.7    2e-16   
ref|XP_003561623.1|  PREDICTED: sulfate transporter 1.2-like          86.7    2e-16   
emb|CBK55660.1|  sulphate transporter                                 86.7    2e-16   
ref|XP_010033888.1|  PREDICTED: probable sulfate transporter 3.4      86.7    2e-16   
ref|XP_004141780.1|  PREDICTED: probable sulfate transporter 3.4-...  86.7    2e-16   
ref|XP_002874900.1|  SULTR3_2                                         86.7    3e-16   
gb|ABL85048.1|  sulfate transporter                                   86.7    3e-16   
ref|XP_009800111.1|  PREDICTED: sulfate transporter 1.3-like          86.7    3e-16   
ref|NP_001267950.1|  sulfate transporter                              86.7    3e-16   
ref|NP_001234569.1|  sulfate transporter 2                            86.7    3e-16   
gb|AFW89362.1|  hypothetical protein ZEAMMB73_695392                  86.7    3e-16   
ref|XP_010916916.1|  PREDICTED: sulfate transporter 1.3-like          86.7    3e-16   
ref|XP_011013918.1|  PREDICTED: probable sulfate transporter 3.5      86.3    3e-16   
emb|CAD55698.1|  sulphate transporter                                 86.3    3e-16   
emb|CAD54674.1|  sulphate transporter                                 86.3    3e-16   
emb|CAN75170.1|  hypothetical protein VITISV_041032                   86.3    3e-16   
ref|XP_006381703.1|  hypothetical protein POPTR_0006s16150g           86.3    4e-16   
ref|XP_002515590.1|  sulfate transporter, putative                    86.3    4e-16   
gb|ABA01552.1|  sulfate transporter                                   86.3    4e-16   
ref|XP_009409155.1|  PREDICTED: sulfate transporter 1.3-like          86.3    4e-16   
ref|XP_011072325.1|  PREDICTED: probable sulfate transporter 3.4      85.9    4e-16   
ref|XP_008242604.1|  PREDICTED: probable sulfate transporter 3.5      85.9    5e-16   
ref|XP_010498811.1|  PREDICTED: probable sulfate transporter 3.3      85.9    5e-16   
ref|XP_010424653.1|  PREDICTED: sulfate transporter 3.2-like          84.3    5e-16   
emb|CBK55663.1|  sulphate transporter                                 85.9    5e-16   
ref|XP_010664070.1|  PREDICTED: sulfate transporter isoform X1        85.9    5e-16   
ref|XP_006844339.1|  hypothetical protein AMTR_s00142p00018440        85.9    5e-16   
gb|ABM17059.2|  sulfate transporter                                   85.5    6e-16   
gb|EYU24685.1|  hypothetical protein MIMGU_mgv1a002778mg              85.5    6e-16   
gb|KHN20699.1|  Putative sulfate transporter 3.5                      85.5    6e-16   
emb|CDY12489.1|  BnaC07g13290D                                        83.6    6e-16   
ref|XP_003557209.1|  PREDICTED: probable sulfate transporter 3.4      85.5    6e-16   
ref|XP_009768935.1|  PREDICTED: probable sulfate transporter 3.4      85.5    7e-16   
ref|XP_011027674.1|  PREDICTED: sulfate transporter 1.2-like          85.5    7e-16   
ref|XP_004485557.1|  PREDICTED: high affinity sulfate transporter...  85.5    7e-16   
ref|XP_004485558.1|  PREDICTED: high affinity sulfate transporter...  85.1    8e-16   
emb|CBK55659.1|  sulphate transporter                                 85.1    8e-16   
ref|XP_010103934.1|  High affinity sulfate transporter 2              85.1    8e-16   
emb|CBK55650.1|  sulphate transporter                                 85.1    8e-16   
ref|XP_009115564.1|  PREDICTED: probable sulfate transporter 3.3      85.1    8e-16   
ref|XP_003593165.1|  Sulfate transporter                              85.5    8e-16   
ref|NP_001044083.1|  Os01g0719300                                     85.1    9e-16   
gb|EAY75631.1|  hypothetical protein OsI_03536                        85.1    9e-16   
ref|XP_008798427.1|  PREDICTED: sulfate transporter 1.3-like          85.1    9e-16   
ref|XP_004485559.1|  PREDICTED: high affinity sulfate transporter...  84.7    1e-15   
gb|KHG07987.1|  High affinity sulfate transporter 2                   84.7    1e-15   
emb|CDP00782.1|  unnamed protein product                              84.7    1e-15   
gb|KFK30874.1|  hypothetical protein AALP_AA6G037000                  84.7    1e-15   
ref|XP_010254168.1|  PREDICTED: probable sulfate transporter 3.4 ...  84.7    1e-15   
ref|XP_008462141.1|  PREDICTED: probable sulfate transporter 3.4      84.7    1e-15   
gb|AES63416.2|  high affinity sulfate transporter type 1              84.7    1e-15   
gb|EYU31825.1|  hypothetical protein MIMGU_mgv1a0030182mg             82.0    1e-15   
ref|XP_008337447.1|  PREDICTED: probable sulfate transporter 3.5      84.7    1e-15   
ref|XP_006844344.1|  hypothetical protein AMTR_s00142p00027860        84.7    1e-15   
gb|ABK35749.1|  sulfate transporter                                   84.7    1e-15   
ref|XP_010030061.1|  PREDICTED: sulfate transporter 1.3-like          84.7    1e-15   
gb|KEH36439.1|  high affinity sulfate transporter type 1              84.7    1e-15   
ref|NP_001105050.1|  sulfate permease1                                84.3    1e-15   
gb|EMS54292.1|  Sulfate transporter 1.3                               81.6    1e-15   
ref|XP_008648264.1|  PREDICTED: sulfate permease1 isoform X1          84.3    1e-15   
ref|XP_007152811.1|  hypothetical protein PHAVU_004G1616000g          84.3    1e-15   
ref|XP_010254174.1|  PREDICTED: probable sulfate transporter 3.5 ...  84.0    2e-15   
ref|XP_010939616.1|  PREDICTED: sulfate transporter 1.3-like          84.3    2e-15   
ref|XP_002513877.1|  sulfate transporter, putative                    84.3    2e-15   
ref|XP_010552708.1|  PREDICTED: probable sulfate transporter 3.3      84.3    2e-15   
gb|AAF17685.1|AC009243_12  F28K19.22                                  84.3    2e-15   
ref|XP_002281258.1|  PREDICTED: probable sulfate transporter 3.5 ...  84.0    2e-15   
ref|XP_010060154.1|  PREDICTED: sulfate transporter 1.3               84.0    2e-15   
ref|XP_008460483.1|  PREDICTED: sulfate transporter 1.3-like isof...  84.0    2e-15   
ref|XP_004486722.1|  PREDICTED: probable sulfate transporter 3.4-...  84.0    2e-15   
emb|CDJ26292.1|  unnamed protein product                              84.0    2e-15   
dbj|BAK05364.1|  predicted protein                                    84.0    2e-15   
ref|XP_009347158.1|  PREDICTED: probable sulfate transporter 3.5      84.0    2e-15   
ref|XP_009352476.1|  PREDICTED: probable sulfate transporter 3.5      84.0    2e-15   
ref|XP_010915047.1|  PREDICTED: probable sulfate transporter 3.4 ...  84.0    2e-15   
emb|CBI28095.3|  unnamed protein product                              84.0    2e-15   
ref|XP_009345534.1|  PREDICTED: sulfate transporter 1.2-like          84.0    2e-15   
ref|XP_010915048.1|  PREDICTED: probable sulfate transporter 3.4 ...  83.6    2e-15   
emb|CBK55654.1|  sulphate transporter                                 84.0    2e-15   
ref|XP_008775334.1|  PREDICTED: probable sulfate transporter 3.5      84.0    2e-15   
gb|KJB59130.1|  hypothetical protein B456_009G240000                  84.0    2e-15   
emb|CDO98069.1|  unnamed protein product                              84.0    2e-15   
ref|XP_002534156.1|  sulfate transporter, putative                    84.0    2e-15   
emb|CDY22071.1|  BnaA09g01000D                                        84.0    2e-15   
ref|XP_010254169.1|  PREDICTED: probable sulfate transporter 3.4 ...  83.2    3e-15   
ref|XP_002889173.1|  SULTR1_2                                         83.6    3e-15   
ref|XP_009111264.1|  PREDICTED: sulfate transporter 3.2               83.6    3e-15   
ref|NP_565166.1|  sulfate transporter 1;2                             83.6    3e-15   
ref|XP_010687477.1|  PREDICTED: sulfate transporter 1.2-like          83.6    3e-15   
ref|XP_006390034.1|  hypothetical protein EUTSA_v10018244mg           83.6    3e-15   
ref|XP_009369644.1|  PREDICTED: sulfate transporter 1.2               83.6    3e-15   
emb|CBK55662.1|  sulphate transporter                                 83.6    3e-15   
ref|XP_010656341.1|  PREDICTED: probable sulfate transporter 3.5 ...  83.2    3e-15   
ref|XP_009128268.1|  PREDICTED: sulfate transporter 1.2-like          83.2    3e-15   
gb|AFX60924.1|  high-affinity sulfate transporter 1;2b                83.2    3e-15   
ref|XP_010088848.1|  putative sulfate transporter 3.5                 83.2    3e-15   
gb|EYU21552.1|  hypothetical protein MIMGU_mgv1a002572mg              83.2    3e-15   
emb|CDX88404.1|  BnaC06g38480D                                        83.2    4e-15   
emb|CDY14642.1|  BnaC02g24710D                                        82.8    4e-15   
emb|CBK55657.1|  sulphate transporter                                 83.2    4e-15   
gb|KGN65363.1|  hypothetical protein Csa_1G378520                     79.3    4e-15   
ref|XP_009403246.1|  PREDICTED: sulfate transporter 1.3-like          83.2    4e-15   
gb|KCW57017.1|  hypothetical protein EUGRSUZ_I02684                   82.4    4e-15   
gb|KEH34875.1|  high affinity sulfate transporter type 1              82.8    4e-15   
ref|XP_004140373.1|  PREDICTED: sulfate transporter 1.3-like          83.2    4e-15   
gb|KEH34874.1|  high affinity sulfate transporter type 1              82.8    5e-15   
ref|XP_003543650.1|  PREDICTED: probable sulfate transporter 3.4-...  82.8    5e-15   
gb|KEH34873.1|  high affinity sulfate transporter type 1              82.8    5e-15   
ref|XP_004299604.1|  PREDICTED: sulfate transporter 1.3               82.8    5e-15   
gb|EMT02170.1|  Putative sulfate transporter 3.5                      82.8    5e-15   
ref|XP_010098035.1|  putative sulfate transporter 3.4                 82.8    6e-15   
gb|EYU43602.1|  hypothetical protein MIMGU_mgv1a019382mg              82.8    6e-15   
ref|XP_008233994.1|  PREDICTED: sulfate transporter 1.3-like          82.8    6e-15   
ref|XP_009106443.1|  PREDICTED: sulfate transporter 1.2               82.8    6e-15   
gb|KJB79700.1|  hypothetical protein B456_013G062700                  82.8    6e-15   
ref|XP_008790803.1|  PREDICTED: sulfate transporter 1.3-like          82.8    6e-15   
gb|KJB79699.1|  hypothetical protein B456_013G062700                  82.8    6e-15   
ref|XP_002465820.1|  hypothetical protein SORBIDRAFT_01g046410        82.8    6e-15   
ref|XP_007225673.1|  hypothetical protein PRUPE_ppa002542mg           82.8    6e-15   
emb|CAE53112.1|  sulfate transporter                                  82.8    6e-15   
gb|EYU18501.1|  hypothetical protein MIMGU_mgv1a0267591mg             81.3    6e-15   
ref|XP_003614968.1|  Sulfate transporter                              82.4    6e-15   
ref|XP_003638788.1|  Sulfate transporter                              82.8    6e-15   
ref|XP_009758742.1|  PREDICTED: sulfate transporter 1.3-like          82.4    7e-15   
gb|AGC92012.1|  SST1-like protein                                     82.4    7e-15   
ref|XP_010105878.1|  Sulfate transporter 1.3                          82.4    7e-15   
ref|NP_001168294.1|  hypothetical protein                             82.4    7e-15   
ref|XP_006360279.1|  PREDICTED: sulfate transporter 1.2-like isof...  82.4    7e-15   
emb|CDX87487.1|  BnaA07g33860D                                        82.4    8e-15   
ref|XP_008374998.1|  PREDICTED: sulfate transporter 1.3-like          82.4    8e-15   
dbj|BAJ91790.1|  predicted protein                                    82.4    8e-15   
emb|CAN83977.1|  hypothetical protein VITISV_018424                   82.4    8e-15   
ref|XP_009598569.1|  PREDICTED: probable sulfate transporter 3.4      82.4    9e-15   
ref|XP_002468339.1|  hypothetical protein SORBIDRAFT_01g044090        82.0    9e-15   
ref|XP_006826989.1|  hypothetical protein AMTR_s00010p00208980        82.0    9e-15   
ref|XP_004506859.1|  PREDICTED: probable sulfate transporter 3.4-...  82.0    1e-14   
gb|EAZ25923.1|  hypothetical protein OsJ_09766                        82.0    1e-14   
ref|NP_001049261.1|  Os03g0196000                                     82.0    1e-14   
ref|XP_009773435.1|  PREDICTED: probable sulfate transporter 3.4      82.0    1e-14   
ref|XP_006649560.1|  PREDICTED: sulfate transporter 1.2-like isof...  82.0    1e-14   
ref|XP_010428905.1|  PREDICTED: sulfate transporter 1.2-like isof...  82.0    1e-14   
gb|AFX60923.1|  high-affinity sulfate transporter 1;2a                82.0    1e-14   
ref|XP_003558765.1|  PREDICTED: sulfate transporter 3.1-like          82.0    1e-14   
sp|P53391.1|SUT1_STYHA  RecName: Full=High affinity sulfate trans...  82.0    1e-14   
ref|XP_010229044.1|  PREDICTED: LOW QUALITY PROTEIN: sulfate tran...  81.6    1e-14   
ref|XP_006451103.1|  hypothetical protein CICLE_v10007732mg           81.6    1e-14   
ref|XP_004490362.1|  PREDICTED: sulfate transporter 1.3-like isof...  81.6    1e-14   
ref|XP_006304513.1|  hypothetical protein CARUB_v10011339mg           81.6    1e-14   
emb|CBA11528.1|  sulphate transporter                                 81.6    1e-14   
dbj|BAJ89607.1|  predicted protein                                    81.6    1e-14   
gb|EYU39150.1|  hypothetical protein MIMGU_mgv1a002714mg              81.6    1e-14   
emb|CAD55696.1|  sulphate transporter                                 81.6    1e-14   
ref|XP_006649559.1|  PREDICTED: sulfate transporter 1.2-like isof...  81.6    1e-14   
ref|XP_009408945.1|  PREDICTED: probable sulfate transporter 3.4      81.6    1e-14   
ref|XP_010657602.1|  PREDICTED: sulfate transporter 1.3-like          81.6    1e-14   
ref|XP_010667626.1|  PREDICTED: sulfate transporter 1.2-like isof...  81.6    1e-14   
gb|EMT20443.1|  High affinity sulfate transporter 2                   81.6    1e-14   
ref|XP_010261215.1|  PREDICTED: sulfate transporter 1.3-like          81.6    1e-14   
ref|XP_010428902.1|  PREDICTED: sulfate transporter 1.2-like isof...  81.6    1e-14   
ref|XP_010477471.1|  PREDICTED: sulfate transporter 1.3               81.6    1e-14   
ref|XP_006475711.1|  PREDICTED: probable sulfate transporter 3.5 ...  81.3    1e-14   
emb|CAD55700.1|  sulphate transporter                                 81.3    2e-14   
emb|CAD55699.1|  sulphate transporter                                 81.3    2e-14   
gb|EMS62366.1|  High affinity sulfate transporter 1                   81.3    2e-14   
ref|XP_010667625.1|  PREDICTED: sulfate transporter 1.2-like isof...  81.3    2e-14   
ref|XP_010920101.1|  PREDICTED: probable sulfate transporter 3.5      81.3    2e-14   
gb|KHN45665.1|  Putative sulfate transporter 3.5                      81.3    2e-14   
gb|KHN33509.1|  High affinity sulfate transporter 2                   81.3    2e-14   
emb|CAL36108.1|  sst1 protein                                         80.9    2e-14   
gb|KJB13141.1|  hypothetical protein B456_002G059100                  80.9    2e-14   
gb|KJB13143.1|  hypothetical protein B456_002G059100                  80.9    2e-14   
gb|KJB13144.1|  hypothetical protein B456_002G059100                  80.9    2e-14   
ref|XP_003547605.1|  PREDICTED: high affinity sulfate transporter...  80.9    2e-14   
gb|KJB13142.1|  hypothetical protein B456_002G059100                  80.9    2e-14   
ref|XP_003532966.1|  PREDICTED: high affinity sulfate transporter...  80.9    2e-14   
ref|XP_010471998.1|  PREDICTED: sulfate transporter 1.2-like          80.9    2e-14   
ref|XP_002301036.1|  high affinity sulfate transporter family pro...  80.9    3e-14   
gb|AAA97952.1|  high affinity sulfate transporter HVST1               80.9    3e-14   
emb|CAA65291.1|  high affinity sulphate transporter                   80.9    3e-14   
ref|XP_003574460.1|  PREDICTED: sulfate transporter 1.2               80.5    3e-14   
ref|XP_009398827.1|  PREDICTED: probable sulfate transporter 3.4      80.5    3e-14   
gb|EYU39155.1|  hypothetical protein MIMGU_mgv1a002721mg              80.5    3e-14   
ref|XP_006301018.1|  hypothetical protein CARUB_v10021409mg           80.5    3e-14   
ref|XP_006465559.1|  PREDICTED: probable sulfate transporter 3.4-...  80.5    3e-14   
ref|XP_003543770.2|  PREDICTED: sulfate transporter 1.3-like isof...  80.5    3e-14   
ref|XP_003632863.1|  PREDICTED: probable sulfate transporter 3.4      80.5    3e-14   
ref|XP_009387871.1|  PREDICTED: probable sulfate transporter 3.5      80.5    3e-14   
emb|CAN70927.1|  hypothetical protein VITISV_043810                   80.5    3e-14   



>ref|XP_009620841.1| PREDICTED: sulfate transporter 3.1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=628

 Score =   143 bits (361),  Expect = 1e-36, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D++ Q    +VE PPPKPF + +KS VKETLFPDDPFR+FK QPL +K  LG+QYFV
Sbjct  2    GNADFDDQYSHQKVEIPPPKPFLKTLKSCVKETLFPDDPFRKFKKQPLTKKLTLGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>ref|XP_009620842.1| PREDICTED: sulfate transporter 3.1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=597

 Score =   143 bits (360),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D++ Q    +VE PPPKPF + +KS VKETLFPDDPFR+FK QPL +K  LG+QYFV
Sbjct  2    GNADFDDQYSHQKVEIPPPKPFLKTLKSCVKETLFPDDPFRKFKKQPLTKKLTLGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>ref|XP_009620843.1| PREDICTED: sulfate transporter 3.1-like isoform X4 [Nicotiana 
tomentosiformis]
Length=592

 Score =   143 bits (360),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D++ Q    +VE PPPKPF + +KS VKETLFPDDPFR+FK QPL +K  LG+QYFV
Sbjct  2    GNADFDDQYSHQKVEIPPPKPFLKTLKSCVKETLFPDDPFRKFKKQPLTKKLTLGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>ref|XP_009620840.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=650

 Score =   143 bits (361),  Expect = 2e-36, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 72/88 (82%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D++ Q    +VE PPPKPF + +KS VKETLFPDDPFR+FK QPL +K  LG+QYFV
Sbjct  2    GNADFDDQYSHQKVEIPPPKPFLKTLKSCVKETLFPDDPFRKFKKQPLTKKLTLGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>gb|EYU41447.1| hypothetical protein MIMGU_mgv1a002539mg [Erythranthe guttata]
Length=661

 Score =   141 bits (356),  Expect = 9e-36, Method: Composition-based stats.
 Identities = 62/81 (77%), Positives = 71/81 (88%), Gaps = 0/81 (0%)
 Frame = +1

Query  292  QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAP  471
            Q+RR EV+APP KPF E +KS++KET FPDDPFRQFKNQPL RKF+LG QYF+PIL+WAP
Sbjct  15   QRRRVEVQAPPTKPFTESLKSSLKETFFPDDPFRQFKNQPLSRKFLLGFQYFIPILEWAP  74

Query  472  RYTFQSFKADVVAGITIASLA  534
            RYTF  FKAD V+GITIASLA
Sbjct  75   RYTFDFFKADFVSGITIASLA  95



>ref|XP_006360746.1| PREDICTED: sulfate transporter 3.1-like [Solanum tuberosum]
Length=657

 Score =   139 bits (350),  Expect = 6e-35, Method: Composition-based stats.
 Identities = 64/93 (69%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +1

Query  265  MGGNGDYEWQ---QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            MG N D++ Q        VE PPPKPF + +KS VKETLFPDDPFR+FKNQPL +K  LG
Sbjct  1    MGINADFDDQYSHHHYQRVEIPPPKPFLKTLKSNVKETLFPDDPFRKFKNQPLSKKISLG  60

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             QYFVPILDWAPRYT Q FKAD++AGITIASLA
Sbjct  61   FQYFVPILDWAPRYTLQLFKADIIAGITIASLA  93



>gb|KDP40223.1| hypothetical protein JCGZ_02221 [Jatropha curcas]
Length=649

 Score =   137 bits (346),  Expect = 2e-34, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 70/88 (80%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE   R   V  PP KPF   +KS VKETLFPDDPFRQFKNQP  +KF+LG+QYFV
Sbjct  2    GNADYECPHR---VAIPPAKPFLTSLKSGVKETLFPDDPFRQFKNQPTSKKFILGLQYFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF  FKAD++AGITIASLA
Sbjct  59   PILEWAPRYTFSFFKADLIAGITIASLA  86



>ref|XP_004247591.1| PREDICTED: sulfate transporter 3.1-like [Solanum lycopersicum]
Length=657

 Score =   137 bits (345),  Expect = 3e-34, Method: Composition-based stats.
 Identities = 63/93 (68%), Positives = 72/93 (77%), Gaps = 3/93 (3%)
 Frame = +1

Query  265  MGGNGDYEWQ---QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            MG N D++ Q        VE PPPKPF + +KS VKETLFPDDPFR+FKNQPL +K  LG
Sbjct  1    MGINADFDDQYSHHHYQRVEIPPPKPFLKTLKSNVKETLFPDDPFRKFKNQPLSKKISLG  60

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             +YFVPILDWAPRYT Q FKAD++AGITIASLA
Sbjct  61   FKYFVPILDWAPRYTLQLFKADIIAGITIASLA  93



>ref|XP_008224259.1| PREDICTED: sulfate transporter 3.1-like [Prunus mume]
Length=649

 Score =   136 bits (342),  Expect = 7e-34, Method: Composition-based stats.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE   R   VE PP KPF + +KS++KET FPDDPFRQFKNQP  RK VLG+Q+FV
Sbjct  2    GNADYECPHR---VEIPPAKPFLKALKSSLKETFFPDDPFRQFKNQPTSRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF  FK+D++AGITIASLA
Sbjct  59   PILEWAPRYTFDFFKSDLIAGITIASLA  86



>ref|XP_009773834.1| PREDICTED: sulfate transporter 3.1-like isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score =   135 bits (340),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN  ++ Q    +VE P PKPF + +KS VKE LFPDDPFR+FKNQ L +K  LG+QYFV
Sbjct  2    GNAHFDDQYSHQKVEIPAPKPFLKTLKSCVKEALFPDDPFRKFKNQSLTKKLALGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>ref|XP_009773833.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Nicotiana 
sylvestris]
Length=653

 Score =   135 bits (340),  Expect = 1e-33, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 69/88 (78%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN  ++ Q    +VE P PKPF + +KS VKE LFPDDPFR+FKNQ L +K  LG+QYFV
Sbjct  2    GNAHFDDQYSHQKVEIPAPKPFLKTLKSCVKEALFPDDPFRKFKNQSLTKKLALGLQYFV  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PILDWAPRYTFQ FKAD +AGITIASLA
Sbjct  62   PILDWAPRYTFQLFKADFIAGITIASLA  89



>ref|XP_007225118.1| hypothetical protein PRUPE_ppa002648mg [Prunus persica]
 gb|EMJ26317.1| hypothetical protein PRUPE_ppa002648mg [Prunus persica]
Length=649

 Score =   135 bits (340),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 61/88 (69%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE   R   VE PP KPF + +KS++KET FPDDPFRQFKNQP  RK VLG+Q+FV
Sbjct  2    GNADYECPHR---VEIPPAKPFLKALKSSLKETFFPDDPFRQFKNQPPSRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF  FK+D++AGITIASLA
Sbjct  59   PILEWAPRYTFDFFKSDLIAGITIASLA  86



>ref|XP_009371954.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=649

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE   R   VE PP KPF++ +KS++KET FPDDPFRQFKNQP  RK VLG+Q+FV
Sbjct  2    GNADYECPHR---VEIPPSKPFFKALKSSLKETFFPDDPFRQFKNQPTSRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YTF  FK+D++AGITIASLA
Sbjct  59   PILEWAPSYTFDFFKSDLIAGITIASLA  86



>ref|XP_008390997.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Malus domestica]
Length=649

 Score =   135 bits (339),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE   R   VE PP KPF++ +KS++KET FPDDPFRQFKNQP  RK VLG+Q+FV
Sbjct  2    GNADYECPHR---VEIPPSKPFFKALKSSLKETFFPDDPFRQFKNQPTSRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YTF  FK+D++AGITIASLA
Sbjct  59   PILEWAPSYTFDFFKSDLIAGITIASLA  86



>ref|XP_010256149.1| PREDICTED: sulfate transporter 3.1-like isoform X2 [Nelumbo nucifera]
Length=627

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +1

Query  271  GNGDYEWQQR---RGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQ  441
            GN DY +  +      V  PPP+PFY+ +K ++KET FPDDP RQFKNQP  RKF+LG+Q
Sbjct  2    GNSDYAFPSKGDCAHRVAIPPPQPFYKSLKRSLKETFFPDDPLRQFKNQPPSRKFILGLQ  61

Query  442  YFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            YF+PIL+WAPRYTFQ FKAD++AGITIASLA
Sbjct  62   YFLPILEWAPRYTFQYFKADLIAGITIASLA  92



>ref|XP_010256148.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Nelumbo nucifera]
Length=649

 Score =   134 bits (338),  Expect = 2e-33, Method: Composition-based stats.
 Identities = 59/91 (65%), Positives = 72/91 (79%), Gaps = 3/91 (3%)
 Frame = +1

Query  271  GNGDYEWQQR---RGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQ  441
            GN DY +  +      V  PPP+PFY+ +K ++KET FPDDP RQFKNQP  RKF+LG+Q
Sbjct  2    GNSDYAFPSKGDCAHRVAIPPPQPFYKSLKRSLKETFFPDDPLRQFKNQPPSRKFILGLQ  61

Query  442  YFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            YF+PIL+WAPRYTFQ FKAD++AGITIASLA
Sbjct  62   YFLPILEWAPRYTFQYFKADLIAGITIASLA  92



>gb|KJB72262.1| hypothetical protein B456_011G167600 [Gossypium raimondii]
Length=650

 Score =   134 bits (338),  Expect = 3e-33, Method: Composition-based stats.
 Identities = 58/90 (64%), Positives = 73/90 (81%), Gaps = 3/90 (3%)
 Frame = +1

Query  265  MGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQY  444
            MG  G+YE Q+R   V  PP KPF + +++ +KET FPDDPFRQFKNQP+  KF+LG+QY
Sbjct  1    MGSTGEYESQRR---VPVPPSKPFLKSLQARLKETFFPDDPFRQFKNQPISNKFLLGLQY  57

Query  445  FVPILDWAPRYTFQSFKADVVAGITIASLA  534
            FVPI++WAPRYTF  FKAD++AGIT+ASLA
Sbjct  58   FVPIIEWAPRYTFDFFKADLIAGITVASLA  87



>ref|XP_009335285.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=649

 Score =   134 bits (337),  Expect = 4e-33, Method: Composition-based stats.
 Identities = 59/88 (67%), Positives = 72/88 (82%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE  +    VE PP KPF++ +KS++KET FPDDPFRQFKNQP PRK VLG+Q+FV
Sbjct  2    GNADYECPR---HVEIPPSKPFFKALKSSLKETFFPDDPFRQFKNQPTPRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YTF  FK+D+++GITIASLA
Sbjct  59   PILEWAPGYTFDFFKSDLISGITIASLA  86



>emb|CBI26298.3| unnamed protein product [Vitis vinifera]
Length=695

 Score =   134 bits (337),  Expect = 6e-33, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DY     RG V  PPPKPF   V++ +KET FPDDPFRQFKNQP  RKFVLG+QY +
Sbjct  43   GNSDY--HTPRG-VAVPPPKPFCWAVRTALKETFFPDDPFRQFKNQPPSRKFVLGLQYLM  99

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTFQSFK+D+VAGITIASLA
Sbjct  100  PILEWAPRYTFQSFKSDLVAGITIASLA  127



>ref|XP_002283184.2| PREDICTED: sulfate transporter 3.1-like [Vitis vinifera]
Length=654

 Score =   133 bits (335),  Expect = 7e-33, Method: Composition-based stats.
 Identities = 63/88 (72%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DY     RG V  PPPKPF   V++ +KET FPDDPFRQFKNQP  RKFVLG+QY +
Sbjct  2    GNSDY--HTPRG-VAVPPPKPFCWAVRTALKETFFPDDPFRQFKNQPPSRKFVLGLQYLM  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTFQSFK+D+VAGITIASLA
Sbjct  59   PILEWAPRYTFQSFKSDLVAGITIASLA  86



>ref|XP_002314667.1| hypothetical protein POPTR_0010s09280g [Populus trichocarpa]
 gb|EEF00838.1| hypothetical protein POPTR_0010s09280g [Populus trichocarpa]
Length=653

 Score =   133 bits (334),  Expect = 9e-33, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP KPF E +KS +KETLFPDDPFRQFKNQP  RKF+LG+QYFVP+L+WAPRYTF+ 
Sbjct  13   VAIPPAKPFIESIKSGIKETLFPDDPFRQFKNQPASRKFILGLQYFVPVLEWAPRYTFEF  72

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  73   FKADLIAGITIASLA  87



>ref|XP_002312546.2| hypothetical protein POPTR_0008s15640g [Populus trichocarpa]
 gb|EEE89913.2| hypothetical protein POPTR_0008s15640g [Populus trichocarpa]
Length=649

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP KPF E +K  +KETLFPDDPFRQFKNQP  RKF+LGMQYFVPIL+WAPRYTF+ 
Sbjct  12   VTIPPAKPFLESIKLGIKETLFPDDPFRQFKNQPASRKFILGMQYFVPILEWAPRYTFEF  71

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  72   FKADLIAGITIASLA  86



>ref|XP_011090680.1| PREDICTED: sulfate transporter 3.1-like [Sesamum indicum]
Length=651

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/87 (68%), Positives = 72/87 (83%), Gaps = 1/87 (1%)
 Frame = +1

Query  274  NGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVP  453
            + +YE QQR  EV+ PP KPF+  +KS++KET FPDDPF+QFKNQ + RK +LG QYFVP
Sbjct  3    SAEYEIQQRV-EVQIPPTKPFFHSLKSSLKETFFPDDPFKQFKNQTVARKLLLGCQYFVP  61

Query  454  ILDWAPRYTFQSFKADVVAGITIASLA  534
            IL+WAPRYTF+ FKAD +AGITIASLA
Sbjct  62   ILEWAPRYTFEYFKADFIAGITIASLA  88



>ref|XP_007034842.1| Sulfate transporter, putative isoform 1 [Theobroma cacao]
 gb|EOY05768.1| Sulfate transporter, putative isoform 1 [Theobroma cacao]
Length=650

 Score =   133 bits (334),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +1

Query  265  MGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQY  444
            MG   +YE   R   V  PP KPF + +++++KET FPDDPFRQFKNQP  RKF+LG+QY
Sbjct  1    MGTTAEYECPHR---VPVPPSKPFLKCLQTSLKETFFPDDPFRQFKNQPASRKFLLGLQY  57

Query  445  FVPILDWAPRYTFQSFKADVVAGITIASLA  534
            FVPIL+WAPRYTF  FKAD++AGITIASLA
Sbjct  58   FVPILEWAPRYTFDFFKADLIAGITIASLA  87



>ref|XP_007034843.1| Sulfate transporter, putative isoform 2 [Theobroma cacao]
 gb|EOY05769.1| Sulfate transporter, putative isoform 2 [Theobroma cacao]
Length=566

 Score =   132 bits (331),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 59/90 (66%), Positives = 71/90 (79%), Gaps = 3/90 (3%)
 Frame = +1

Query  265  MGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQY  444
            MG   +YE   R   V  PP KPF + +++++KET FPDDPFRQFKNQP  RKF+LG+QY
Sbjct  1    MGTTAEYECPHR---VPVPPSKPFLKCLQTSLKETFFPDDPFRQFKNQPASRKFLLGLQY  57

Query  445  FVPILDWAPRYTFQSFKADVVAGITIASLA  534
            FVPIL+WAPRYTF  FKAD++AGITIASLA
Sbjct  58   FVPILEWAPRYTFDFFKADLIAGITIASLA  87



>ref|XP_011030640.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
 ref|XP_011030641.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
Length=652

 Score =   132 bits (333),  Expect = 1e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 66/75 (88%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP KPF E +KS +KETLFPDDPFRQFKNQP  RKF+LG+QYFVP+L+WAPRYTF+ 
Sbjct  13   VAIPPAKPFIESIKSGIKETLFPDDPFRQFKNQPASRKFILGLQYFVPVLEWAPRYTFEF  72

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  73   FKADLLAGITIASLA  87



>gb|ABB59577.2| putative sulfate transporter [Populus tremula x Populus alba]
Length=637

 Score =   132 bits (331),  Expect = 2e-32, Method: Composition-based stats.
 Identities = 58/75 (77%), Positives = 64/75 (85%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP KP  E +K  +KETLFPDDPFRQFKNQP  RKF+LGMQYFVPIL+WAPRYTF+ 
Sbjct  12   VAIPPAKPLLESIKLGIKETLFPDDPFRQFKNQPASRKFILGMQYFVPILEWAPRYTFEF  71

Query  490  FKADVVAGITIASLA  534
            FKAD+VAGITIASLA
Sbjct  72   FKADLVAGITIASLA  86



>ref|XP_011026981.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
Length=649

 Score =   131 bits (330),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 57/75 (76%), Positives = 65/75 (87%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP KPF + +K  +KETLFPDDPFRQFKNQP  RKF+LGMQYFVPIL+WAPRYTF+ 
Sbjct  12   VAIPPAKPFLKSIKLGIKETLFPDDPFRQFKNQPASRKFILGMQYFVPILEWAPRYTFEF  71

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  72   FKADLIAGITIASLA  86



>gb|KDO74470.1| hypothetical protein CISIN_1g006373mg [Citrus sinensis]
Length=648

 Score =   131 bits (330),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE  +R   V  PP KPF+  +KS +KETLFPDDPFRQFKNQ   RK +LG+QYFV
Sbjct  2    GNADYECPRR---VSIPPSKPFFNSLKSGLKETLFPDDPFRQFKNQSASRKLLLGLQYFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF+ FK+D++AGITIASLA
Sbjct  59   PILEWAPRYTFEFFKSDLLAGITIASLA  86



>ref|XP_006489450.1| PREDICTED: sulfate transporter 3.1-like [Citrus sinensis]
Length=648

 Score =   131 bits (330),  Expect = 3e-32, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE  +R   V  PP KPF+  +KS +KETLFPDDPFRQFKNQ   RK +LG+QYFV
Sbjct  2    GNADYECPRR---VSIPPSKPFFNSLKSGLKETLFPDDPFRQFKNQSASRKLLLGLQYFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF+ FK+D++AGITIASLA
Sbjct  59   PILEWAPRYTFEFFKSDLLAGITIASLA  86



>ref|XP_006420023.1| hypothetical protein CICLE_v10004520mg [Citrus clementina]
 gb|ESR33263.1| hypothetical protein CICLE_v10004520mg [Citrus clementina]
Length=648

 Score =   131 bits (329),  Expect = 5e-32, Method: Composition-based stats.
 Identities = 60/88 (68%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE  +R   V  PP KPF+  +KS +KETLFPDDPFRQFKNQ   RK +LG+QYFV
Sbjct  2    GNADYECPRR---VSIPPSKPFFNSLKSGLKETLFPDDPFRQFKNQSASRKLLLGLQYFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAPRYTF+ FK+D++AGITIASLA
Sbjct  59   PILEWAPRYTFEFFKSDLLAGITIASLA  86



>ref|XP_008390930.1| PREDICTED: sulfate transporter 3.1-like [Malus domestica]
Length=649

 Score =   130 bits (327),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 71/88 (81%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN DYE  +    VE PP K F++ +KS++KET FPDDPFRQFKNQP  RK VLG+Q+FV
Sbjct  2    GNADYECPR---HVEIPPSKSFFKALKSSLKETFFPDDPFRQFKNQPTSRKLVLGLQHFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PI++WAPRYTF  FK+D+++GITIASLA
Sbjct  59   PIIEWAPRYTFDFFKSDLISGITIASLA  86



>ref|XP_010024227.1| PREDICTED: sulfate transporter 3.1-like [Eucalyptus grandis]
 gb|KCW60689.1| hypothetical protein EUGRSUZ_H03420 [Eucalyptus grandis]
Length=652

 Score =   130 bits (327),  Expect = 1e-31, Method: Composition-based stats.
 Identities = 58/87 (67%), Positives = 69/87 (79%), Gaps = 3/87 (3%)
 Frame = +1

Query  274  NGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVP  453
            N DYE   +   V  PPPKPF + + +T+KET FPDDPFRQF+ QP  RK VLG+QYFVP
Sbjct  6    NMDYECPHK---VAIPPPKPFLQSLMTTLKETFFPDDPFRQFRGQPGSRKLVLGLQYFVP  62

Query  454  ILDWAPRYTFQSFKADVVAGITIASLA  534
            IL+WAPRYTF SFK+D++AGITIASLA
Sbjct  63   ILEWAPRYTFDSFKSDLIAGITIASLA  89



>gb|KHN03817.1| Sulfate transporter 3.1 [Glycine soja]
Length=657

 Score =   129 bits (324),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQ------QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            G+ DYE+       +R  +VE PPP+PF++ +K ++KET FPDDP RQFKN+P  +KF+L
Sbjct  2    GSVDYEYPLGMNNVERVHQVEVPPPQPFFKSLKYSLKETFFPDDPLRQFKNKPASKKFML  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF PI +WAPRYTFQ FKAD++AGITIASLA
Sbjct  62   GLQYFFPIFEWAPRYTFQFFKADLIAGITIASLA  95



>ref|XP_003536673.1| PREDICTED: sulfate transporter 3.1-like [Glycine max]
Length=657

 Score =   129 bits (324),  Expect = 2e-31, Method: Composition-based stats.
 Identities = 57/94 (61%), Positives = 74/94 (79%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQ------QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            G+ DYE+       +R  +VE PPP+PF++ +K ++KET FPDDP RQFKN+P  +KF+L
Sbjct  2    GSVDYEYPLGMNNVERVHQVEVPPPQPFFKSLKYSLKETFFPDDPLRQFKNKPASKKFML  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF PI +WAPRYTFQ FKAD++AGITIASLA
Sbjct  62   GLQYFFPIFEWAPRYTFQFFKADLIAGITIASLA  95



>ref|XP_010259124.1| PREDICTED: sulfate transporter 3.1-like [Nelumbo nucifera]
Length=648

 Score =   128 bits (321),  Expect = 5e-31, Method: Composition-based stats.
 Identities = 57/91 (63%), Positives = 69/91 (76%), Gaps = 3/91 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRG---EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQ  441
            GN DY +         V  PP +PFY+ +K ++KET FPDDP RQFKNQP  RKF+LG+Q
Sbjct  2    GNADYVFPSSGDCGHRVAIPPSQPFYKSLKKSLKETFFPDDPVRQFKNQPPSRKFILGLQ  61

Query  442  YFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            YF+PIL+WAPRYTFQ FKAD++AGITI SLA
Sbjct  62   YFLPILEWAPRYTFQYFKADLIAGITITSLA  92



>ref|XP_003632327.1| PREDICTED: sulfate transporter 3.1-like [Vitis vinifera]
Length=654

 Score =   128 bits (321),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GNGDY++     E    V  PPP+PF + +K+++KET FPDDP RQFKNQP  RKF+LG+
Sbjct  4    GNGDYKYPATGVECAHRVAVPPPQPFTKSLKTSLKETFFPDDPLRQFKNQPASRKFILGL  63

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            QYF PIL+W PRY+FQ  KAD+++GITIASLA
Sbjct  64   QYFFPILEWGPRYSFQFLKADLISGITIASLA  95



>emb|CBI28733.3| unnamed protein product [Vitis vinifera]
Length=652

 Score =   128 bits (321),  Expect = 6e-31, Method: Composition-based stats.
 Identities = 56/92 (61%), Positives = 71/92 (77%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GNGDY++     E    V  PPP+PF + +K+++KET FPDDP RQFKNQP  RKF+LG+
Sbjct  2    GNGDYKYPATGVECAHRVAVPPPQPFTKSLKTSLKETFFPDDPLRQFKNQPASRKFILGL  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            QYF PIL+W PRY+FQ  KAD+++GITIASLA
Sbjct  62   QYFFPILEWGPRYSFQFLKADLISGITIASLA  93



>emb|CDO99099.1| unnamed protein product [Coffea canephora]
Length=651

 Score =   128 bits (321),  Expect = 7e-31, Method: Composition-based stats.
 Identities = 59/88 (67%), Positives = 68/88 (77%), Gaps = 1/88 (1%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+E  Q R  VE+PP KPF++ +  +VKETLFPDDPFRQFK Q   +K VLG+QYFV
Sbjct  2    GNADFE-SQHRVRVESPPSKPFFQNLGMSVKETLFPDDPFRQFKGQSFSKKCVLGLQYFV  60

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL WAP YTF  FKAD +AGITIASLA
Sbjct  61   PILKWAPGYTFDFFKADFIAGITIASLA  88



>ref|XP_009609980.1| PREDICTED: sulfate transporter 3.1-like [Nicotiana tomentosiformis]
Length=656

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 56/95 (59%), Positives = 71/95 (75%), Gaps = 7/95 (7%)
 Frame = +1

Query  271  GNGDYEW-------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFV  429
            GN DYE+        ++   VE PPP+PF++ +K+TVKETLFPDDP RQFKNQP  +KF+
Sbjct  2    GNKDYEYPSSMNGESRKTHAVEIPPPQPFFKSLKNTVKETLFPDDPLRQFKNQPPRKKFI  61

Query  430  LGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            LG+QY  PI +W PRYT   FK+D++AGITIASLA
Sbjct  62   LGLQYIFPIFEWGPRYTLDFFKSDLIAGITIASLA  96



>ref|XP_009778206.1| PREDICTED: sulfate transporter 3.1-like [Nicotiana sylvestris]
Length=656

 Score =   127 bits (319),  Expect = 1e-30, Method: Composition-based stats.
 Identities = 57/95 (60%), Positives = 73/95 (77%), Gaps = 7/95 (7%)
 Frame = +1

Query  271  GNGDYEW------QQRRGE-VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFV  429
            GN DYE+      + R+ + VE PPP+PF++ +K+TVKETLFPDDP RQFKNQP  +KF+
Sbjct  2    GNKDYEYPASMNGESRKTQPVEIPPPQPFFKSLKNTVKETLFPDDPLRQFKNQPPRKKFI  61

Query  430  LGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            LG+QY  PI +W PRYT   FK+D++AGITIASLA
Sbjct  62   LGLQYLFPIFEWGPRYTLDFFKSDLIAGITIASLA  96



>ref|XP_002517080.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF45243.1| sulfate transporter, putative [Ricinus communis]
Length=606

 Score =   126 bits (316),  Expect = 2e-30, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 69/88 (78%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D++       V  PP KPF + +KS +KETLFPDDPFRQFK QP  RKF+LG+QYFV
Sbjct  2    GNTDFQCPH---PVAIPPEKPFLKSLKSGLKETLFPDDPFRQFKKQPASRKFILGLQYFV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            P L+WAPRYTF SFK+D+++GITIASLA
Sbjct  59   PFLEWAPRYTFGSFKSDLISGITIASLA  86



>ref|XP_010092428.1| Sulfate transporter 3.1 [Morus notabilis]
 gb|EXB51146.1| Sulfate transporter 3.1 [Morus notabilis]
Length=657

 Score =   126 bits (316),  Expect = 4e-30, Method: Composition-based stats.
 Identities = 57/89 (64%), Positives = 69/89 (78%), Gaps = 1/89 (1%)
 Frame = +1

Query  271  GNGDYEWQQR-RGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYF  447
            GNGD  + +     V  PP KPF + +K+++KET FPDDPFRQFKNQ   R+ VLG+QYF
Sbjct  6    GNGDNTYNEYCPHRVAIPPTKPFSKALKASLKETFFPDDPFRQFKNQSGLRRLVLGLQYF  65

Query  448  VPILDWAPRYTFQSFKADVVAGITIASLA  534
            VPIL+WAPRYTF  FKAD++AGITIASLA
Sbjct  66   VPILEWAPRYTFSFFKADLIAGITIASLA  94



>ref|XP_003518908.2| PREDICTED: sulfate transporter 3.1-like [Glycine max]
 gb|KHN18862.1| Sulfate transporter 3.1 [Glycine soja]
Length=657

 Score =   125 bits (313),  Expect = 8e-30, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 73/94 (78%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQ------QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            G+ DYE+       +R  +VE PPP+PF++ +K ++KET FPDDP RQFKN+P  +KF+L
Sbjct  2    GSVDYEYPLGMNNFERVHQVEVPPPQPFFKSLKYSLKETFFPDDPLRQFKNKPASKKFML  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+Q+F PI +WAP+YTFQ  KAD++AGITIASLA
Sbjct  62   GLQFFFPIFEWAPKYTFQFLKADLIAGITIASLA  95



>emb|CDY40238.1| BnaA09g35200D [Brassica napus]
Length=264

 Score =   120 bits (300),  Expect = 1e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPRYNFKLFKSDLIAGITIASLA  96



>emb|CDX73683.1| BnaC08g23200D [Brassica napus]
Length=655

 Score =   124 bits (311),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPRYNFKLFKSDLIAGITIASLA  96



>dbj|BAA25175.1| sulfate transporter [Arabidopsis thaliana]
Length=646

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RKFVL
Sbjct  3    TEDYTFPQGAEELHRRHHTVEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKFVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY  + FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNLKFFKSDLIAGITIASLA  96



>ref|XP_009612528.1| PREDICTED: sulfate transporter 3.1-like [Nicotiana tomentosiformis]
Length=662

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +1

Query  271  GNGDYEWQQ-RRGE--------VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRK  423
            GN DYE+     GE        VE PPP+PF++ +K+TVKETLFPDDP RQFKNQ   RK
Sbjct  2    GNADYEYPSIMNGESAGTGIHRVEIPPPQPFFKSLKNTVKETLFPDDPLRQFKNQTPLRK  61

Query  424  FVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            F+LG+QYF PI +W  RY F  FK+D++AGITIASLA
Sbjct  62   FILGLQYFFPIFEWGSRYNFGFFKSDLIAGITIASLA  98



>dbj|BAA21657.1| sulfate transporter [Arabidopsis thaliana]
Length=658

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RKFVL
Sbjct  3    TEDYTFPQGAEELHRRHHTVEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKFVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY  + FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNLKFFKSDLIAGITIASLA  96



>ref|NP_190758.2| sulfate transporter 3;1 [Arabidopsis thaliana]
 sp|Q9SV13.1|SUT31_ARATH RecName: Full=Sulfate transporter 3.1; AltName: Full=AST12; AltName: 
Full=AtST1 [Arabidopsis thaliana]
 emb|CAB41310.1| sulfate transporter (ATST1) [Arabidopsis thaliana]
 gb|AAM20724.1| sulfate transporter ATST1 [Arabidopsis thaliana]
 gb|AEE78860.1| sulfate transporter 3.1 [Arabidopsis thaliana]
Length=658

 Score =   124 bits (310),  Expect = 2e-29, Method: Composition-based stats.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RKFVL
Sbjct  3    TEDYTFPQGAEELHRRHHTVEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKFVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY  + FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNLKFFKSDLIAGITIASLA  96



>ref|XP_009804926.1| PREDICTED: sulfate transporter 3.1-like [Nicotiana sylvestris]
Length=662

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 58/97 (60%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +1

Query  271  GNGDYEWQQ-RRGE--------VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRK  423
            GN DYE+     GE        VE PPP+PF++ +K+TVKETLFPDDP RQFKNQ   RK
Sbjct  2    GNADYEYPSIMNGESTGIGIHRVEIPPPQPFFKSLKNTVKETLFPDDPLRQFKNQTPLRK  61

Query  424  FVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            F+LG+QYF PI +W  RY F  FK+D++AGITIASLA
Sbjct  62   FILGVQYFFPIFEWGSRYNFGFFKSDLIAGITIASLA  98



>ref|XP_010679106.1| PREDICTED: sulfate transporter 3.1 [Beta vulgaris subsp. vulgaris]
Length=657

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 54/97 (56%), Positives = 69/97 (71%), Gaps = 7/97 (7%)
 Frame = +1

Query  265  MGGNGDYEW-------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRK  423
            MG   D+E+        QR+  V  PPP+PF+  +++T+KET FPDDP RQFKNQP  RK
Sbjct  2    MGTVEDHEYVYPSMNTGQRKSRVAVPPPQPFFRSLQTTLKETFFPDDPLRQFKNQPRSRK  61

Query  424  FVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            F+LG+QYF P L+WAP+Y     KAD++AGITIASLA
Sbjct  62   FILGLQYFFPFLEWAPKYCLDFLKADLIAGITIASLA  98



>gb|KDP21414.1| hypothetical protein JCGZ_21885 [Jatropha curcas]
Length=656

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 52/75 (69%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PPP+PF++ +K  +KET FPDDPFRQFKNQP  RKF LG+QYF+PIL+WAPRYT + 
Sbjct  20   VAIPPPQPFFKSLKYNLKETFFPDDPFRQFKNQPPCRKFTLGLQYFLPILEWAPRYTLEF  79

Query  490  FKADVVAGITIASLA  534
             KAD++AGITIASLA
Sbjct  80   LKADIIAGITIASLA  94



>ref|XP_011079899.1| PREDICTED: sulfate transporter 3.1 [Sesamum indicum]
Length=662

 Score =   123 bits (309),  Expect = 3e-29, Method: Composition-based stats.
 Identities = 51/78 (65%), Positives = 63/78 (81%), Gaps = 0/78 (0%)
 Frame = +1

Query  301  RGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYT  480
            R  V  PPP+PF + +K+T+KET FPDDP RQFKNQP  R+F+LG+QY  PIL+W PRYT
Sbjct  21   RHRVAVPPPQPFVKSLKNTLKETFFPDDPLRQFKNQPPRRRFILGLQYVFPILEWGPRYT  80

Query  481  FQSFKADVVAGITIASLA  534
             Q F+AD++AGITIASLA
Sbjct  81   LQFFRADLIAGITIASLA  98



>ref|XP_006349709.1| PREDICTED: sulfate transporter 3.1-like [Solanum tuberosum]
Length=659

 Score =   123 bits (308),  Expect = 4e-29, Method: Composition-based stats.
 Identities = 52/80 (65%), Positives = 67/80 (84%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            +++ +VE PPP+PF + +K+TVKETLFPDDP RQFKNQP  +K  LG+QYF PI +WAPR
Sbjct  20   RKKHQVEIPPPQPFLKSLKNTVKETLFPDDPLRQFKNQPPLKKLKLGVQYFFPIFEWAPR  79

Query  475  YTFQSFKADVVAGITIASLA  534
            YTF  FK+D+++GITIASLA
Sbjct  80   YTFDFFKSDLISGITIASLA  99



>gb|KHG29534.1| Sulfate transporter 3 [Gossypium arboreum]
Length=653

 Score =   122 bits (307),  Expect = 6e-29, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEW------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GNGD+ +      Q     V  PPP+PF+   K+T+KET FPDDP RQFKN+   R+F+L
Sbjct  2    GNGDFVYPSSSDRQCATHRVAIPPPQPFFMSFKNTLKETFFPDDPLRQFKNKTPSRRFIL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+WAPRY+FQ  K+D+VAGITIASLA
Sbjct  62   GLQYFLPILEWAPRYSFQFLKSDLVAGITIASLA  95



>emb|CDY70201.1| BnaAnng32950D, partial [Brassica napus]
Length=394

 Score =   120 bits (300),  Expect = 9e-29, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPRYNFKLFKSDLIAGITIASLA  96



>ref|XP_010515628.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Camelina 
sativa]
 ref|XP_010515629.1| PREDICTED: sulfate transporter 3.1-like isoform X2 [Camelina 
sativa]
Length=659

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ ++KETLFPDDPFRQFKNQ   RK VL
Sbjct  3    TEDYTFPEGAEELHRRHHTVEAPQPQPFLKSLQYSLKETLFPDDPFRQFKNQNASRKVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNFKFFKSDLIAGITIASLA  96



>gb|KEH23810.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=656

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQQRRG-----EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GNGDY +           V  PP +PF+E +K +VKETLFPDDP R+FKNQP  R+FVL 
Sbjct  2    GNGDYAYPSSMNVESVHRVAIPPHQPFFESLKYSVKETLFPDDPLRKFKNQPASRRFVLA  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +Q+F+PIL+WAP+YT Q  K+D++AGITIASLA
Sbjct  62   LQHFLPILEWAPQYTLQFLKSDLIAGITIASLA  94



>ref|XP_010503899.1| PREDICTED: sulfate transporter 3.1-like [Camelina sativa]
Length=658

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ ++KETLFPDDPFRQFKNQ   RK VL
Sbjct  3    TEDYTFPEGAEELHRRHHTVEAPKPQPFLKSLQYSLKETLFPDDPFRQFKNQNASRKVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNFKFFKSDLIAGITIASLA  96



>ref|XP_010426769.1| PREDICTED: sulfate transporter 3.1 isoform X1 [Camelina sativa]
 ref|XP_010426770.1| PREDICTED: sulfate transporter 3.1 isoform X2 [Camelina sativa]
Length=658

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ ++KETLFPDDPFRQFKNQ   RK VL
Sbjct  3    TEDYTFPEGAEELHRRHHTVEAPQPQPFLKSLQYSLKETLFPDDPFRQFKNQNASRKVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPIFEWAPRYNFKFFKSDLIAGITIASLA  96



>emb|CAN61401.1| hypothetical protein VITISV_011489 [Vitis vinifera]
Length=654

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 67/88 (76%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN + E  +R   V  PP K F + + ST KET+FPDDPFRQFKNQ   RKFVLG+QY V
Sbjct  2    GNSNCETPRR---VAVPPKKSFSDSLSSTFKETIFPDDPFRQFKNQSPSRKFVLGLQYLV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PI +WAPRYTF+ FKAD++AGITIASLA
Sbjct  59   PIFEWAPRYTFEFFKADLIAGITIASLA  86



>gb|KHG01733.1| Sulfate transporter 3 [Gossypium arboreum]
Length=657

 Score =   122 bits (305),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDY------EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GN DY      E++Q    V  PPP+PF++  K+++KET FPDDP RQFKN+   RKF L
Sbjct  2    GNADYLYPSTNEYRQCAHPVAVPPPQPFFKSFKNSLKETFFPDDPLRQFKNKTPSRKFFL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+W PRYTFQ  K+D+++GITIASLA
Sbjct  62   GLQYFLPILEWGPRYTFQFLKSDLISGITIASLA  95



>gb|KJB46950.1| hypothetical protein B456_008G002800 [Gossypium raimondii]
 gb|KJB46952.1| hypothetical protein B456_008G002800 [Gossypium raimondii]
Length=561

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEW------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GNGD+ +      Q     V  PPP+PF+   K+++KET FPDDP RQFKN+   R+F+L
Sbjct  2    GNGDFMYPSSSDRQCVTHRVAIPPPQPFFMSFKNSLKETFFPDDPLRQFKNKTPSRRFIL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+WAPRY+FQ  K+D+VAGITIASLA
Sbjct  62   GLQYFLPILEWAPRYSFQFLKSDLVAGITIASLA  95



>gb|KJB46951.1| hypothetical protein B456_008G002800 [Gossypium raimondii]
Length=572

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEW------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GNGD+ +      Q     V  PPP+PF+   K+++KET FPDDP RQFKN+   R+F+L
Sbjct  2    GNGDFMYPSSSDRQCVTHRVAIPPPQPFFMSFKNSLKETFFPDDPLRQFKNKTPSRRFIL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+WAPRY+FQ  K+D+VAGITIASLA
Sbjct  62   GLQYFLPILEWAPRYSFQFLKSDLVAGITIASLA  95



>gb|KEH23811.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=576

 Score =   120 bits (302),  Expect = 1e-28, Method: Composition-based stats.
 Identities = 54/93 (58%), Positives = 69/93 (74%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQQRRG-----EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GNGDY +           V  PP +PF+E +K +VKETLFPDDP R+FKNQP  R+FVL 
Sbjct  2    GNGDYAYPSSMNVESVHRVAIPPHQPFFESLKYSVKETLFPDDPLRKFKNQPASRRFVLA  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +Q+F+PIL+WAP+YT Q  K+D++AGITIASLA
Sbjct  62   LQHFLPILEWAPQYTLQFLKSDLIAGITIASLA  94



>ref|XP_008366542.1| PREDICTED: sulfate transporter 3.1-like [Malus domestica]
Length=657

 Score =   121 bits (304),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 56/93 (60%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQQRRGE-----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GN DY +     E     VE PPP+PF + +KS++KET FPDDP R FKNQP  RKFVLG
Sbjct  2    GNVDYVYPSTNVEDSPHRVEIPPPQPFIKTLKSSLKETFFPDDPLRPFKNQPASRKFVLG  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             QYF PIL+WAPRYT    K+D+++GITIASLA
Sbjct  62   FQYFFPILEWAPRYTLDFLKSDLISGITIASLA  94



>ref|XP_002279213.1| PREDICTED: sulfate transporter 3.1 [Vitis vinifera]
Length=654

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN + E  +R   V  PP K F   + ST KET+FPDDPFRQFKNQ   RKFVLG+QY V
Sbjct  2    GNSNCETPRR---VAVPPKKSFSASLSSTFKETIFPDDPFRQFKNQSPSRKFVLGLQYLV  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PI +WAPRYTF+ FKAD++AGITIASLA
Sbjct  59   PIFEWAPRYTFEFFKADLIAGITIASLA  86



>ref|XP_010102377.1| Sulfate transporter 3.1 [Morus notabilis]
 gb|EXB93349.1| Sulfate transporter 3.1 [Morus notabilis]
Length=660

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 53/80 (66%), Positives = 62/80 (78%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            +R   V  PPP+PF +  ++TVKET FPDDPFRQFKNQ   RK VLG+QYF PIL+WAPR
Sbjct  16   ERSHRVAIPPPQPFVKTFRNTVKETFFPDDPFRQFKNQTAWRKLVLGLQYFFPILEWAPR  75

Query  475  YTFQSFKADVVAGITIASLA  534
            Y    FKAD+V+GITIASLA
Sbjct  76   YPLSFFKADIVSGITIASLA  95



>ref|XP_007050523.1| Sulfate transporter 3,1 [Theobroma cacao]
 gb|EOX94680.1| Sulfate transporter 3,1 [Theobroma cacao]
Length=655

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/92 (59%), Positives = 69/92 (75%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEW----QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     Q    V  PPP+PF++  K+++KET FPDDP RQFKN+   RKF+LG+
Sbjct  2    GNADYVYPSANDQCAHRVAIPPPQPFFKSFKNSLKETFFPDDPLRQFKNKTPSRKFILGL  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            QYF+PIL+WAPRY+ Q  KAD++AGITIASLA
Sbjct  62   QYFLPILEWAPRYSLQFLKADLIAGITIASLA  93



>gb|KJB42154.1| hypothetical protein B456_007G139400 [Gossypium raimondii]
Length=657

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDY------EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GN DY      E++Q    V  PPP+PF++  K+++KET FPDDP RQFKN+   RKF L
Sbjct  2    GNADYVYPSTNEYRQCAHPVAVPPPQPFFKSFKNSLKETFFPDDPLRQFKNKTPSRKFFL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+W PRYTFQ  K+D+++GITIASLA
Sbjct  62   GLQYFLPILEWGPRYTFQFLKSDLISGITIASLA  95



>gb|KJB46949.1| hypothetical protein B456_008G002800 [Gossypium raimondii]
Length=653

 Score =   121 bits (303),  Expect = 2e-28, Method: Composition-based stats.
 Identities = 54/94 (57%), Positives = 70/94 (74%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEW------QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GNGD+ +      Q     V  PPP+PF+   K+++KET FPDDP RQFKN+   R+F+L
Sbjct  2    GNGDFMYPSSSDRQCVTHRVAIPPPQPFFMSFKNSLKETFFPDDPLRQFKNKTPSRRFIL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF+PIL+WAPRY+FQ  K+D+VAGITIASLA
Sbjct  62   GLQYFLPILEWAPRYSFQFLKSDLVAGITIASLA  95



>ref|XP_004296670.1| PREDICTED: sulfate transporter 3.1-like [Fragaria vesca subsp. 
vesca]
 ref|XP_011462544.1| PREDICTED: sulfate transporter 3.1-like [Fragaria vesca subsp. 
vesca]
Length=656

 Score =   120 bits (302),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 54/91 (59%), Positives = 67/91 (74%), Gaps = 1/91 (1%)
 Frame = +1

Query  265  MGGNGDYE-WQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQ  441
            MG + D++ +   R EVE PPPKP    VKS++KET FPDDPFR FKNQP  +K V+G+Q
Sbjct  1    MGTDYDHDRYSPERVEVEIPPPKPLLTAVKSSMKETFFPDDPFRAFKNQPASKKAVMGLQ  60

Query  442  YFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            YF  ILDWAPRY     K+D++AGITI+SLA
Sbjct  61   YFFTILDWAPRYKLSYLKSDIIAGITISSLA  91



>ref|XP_008368821.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 3.1-like 
[Malus domestica]
Length=652

 Score =   120 bits (301),  Expect = 3e-28, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF + +KS++KET FPDDP R FKNQP  RKF+LG QYF PIL+WAPRYT + 
Sbjct  19   VEIPPPQPFIKTLKSSLKETFFPDDPLRPFKNQPTSRKFILGFQYFFPILEWAPRYTLEF  78

Query  490  FKADVVAGITIASLA  534
             K+D+++GITIASLA
Sbjct  79   LKSDLISGITIASLA  93



>gb|KGN56948.1| hypothetical protein Csa_3G146340 [Cucumis sativus]
Length=646

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+E   R   V  PP KPF + + S +KET FPDDPF+QFKNQPLP +  L ++YF+
Sbjct  2    GNADFECPHR---VAIPPKKPFLDSLASNLKETFFPDDPFKQFKNQPLPTQIFLWLKYFI  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YT   FKAD+VAGITIASLA
Sbjct  59   PILNWAPHYTLDFFKADLVAGITIASLA  86



>ref|XP_004166382.1| PREDICTED: sulfate transporter 3.1-like [Cucumis sativus]
Length=646

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+E   R   V  PP KPF + + S +KET FPDDPF+QFKNQPLP +  L ++YF+
Sbjct  2    GNADFECPHR---VAIPPKKPFLDSLASNLKETFFPDDPFKQFKNQPLPTQIFLWLKYFI  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YT   FKAD+VAGITIASLA
Sbjct  59   PILNWAPHYTLDFFKADLVAGITIASLA  86



>ref|XP_004134124.1| PREDICTED: LOW QUALITY PROTEIN: sulfate transporter 3.1-like 
[Cucumis sativus]
Length=651

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 54/88 (61%), Positives = 65/88 (74%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+E   R   V  PP KPF + + S +KET FPDDPF+QFKNQPLP +  L ++YF+
Sbjct  2    GNADFECPHR---VAIPPKKPFLDSLASNLKETFFPDDPFKQFKNQPLPTQIFLWLKYFI  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+WAP YT   FKAD+VAGITIASLA
Sbjct  59   PILNWAPHYTLDFFKADLVAGITIASLA  86



>emb|CAE46442.1| sulphate transporter [Brassica napus]
Length=658

 Score =   120 bits (301),  Expect = 4e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPDPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAP Y F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPLYNFKLFKSDLIAGITIASLA  96



>gb|AAC14417.1| unknown [Arabidopsis thaliana]
Length=703

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 71/94 (76%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE+     G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RKFVL
Sbjct  48   TEDYTFPQGAEELHRRHHTVEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKFVL  107

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PI +WAPRY  + FK+D++AGITIASLA
Sbjct  108  GLKYFLPIFEWAPRYNLKFFKSDLIAGITIASLA  141



>ref|XP_009115890.1| PREDICTED: sulfate transporter 3.1 [Brassica rapa]
Length=658

 Score =   120 bits (300),  Expect = 6e-28, Method: Compositional matrix adjust.
 Identities = 56/94 (60%), Positives = 73/94 (78%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAPRY F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPRYNFKLFKSDLIAGITIASLA  96



>ref|XP_006838985.1| hypothetical protein AMTR_s00002p00271530 [Amborella trichopoda]
 gb|ERN01554.1| hypothetical protein AMTR_s00002p00271530 [Amborella trichopoda]
Length=658

 Score =   119 bits (298),  Expect = 9e-28, Method: Composition-based stats.
 Identities = 55/94 (59%), Positives = 67/94 (71%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQQRRG------EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GN D  + Q+        +V  P PKPF     S++KETLFPDDPFRQFK+QPL R+ VL
Sbjct  2    GNADLVYAQQATAKECIHKVAVPQPKPFVSKFMSSLKETLFPDDPFRQFKSQPLARRLVL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+Q+F PIL+WAP Y F  FKAD++AGITIASLA
Sbjct  62   GLQFFFPILEWAPSYNFAFFKADLIAGITIASLA  95



>ref|XP_011032651.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
Length=655

 Score =   119 bits (298),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     E    V  PPP+PF + +K  +KET FPDDP RQFKNQP  R+F+LG+
Sbjct  2    GNADYVFPSTNAESAHRVAIPPPQPFVKSLKYNLKETFFPDDPLRQFKNQPTSRRFILGI  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +YF+PI DWAP YTF   ++D +AGITIASLA
Sbjct  62   KYFLPIFDWAPSYTFDFLRSDFIAGITIASLA  93



>emb|CBI26299.3| unnamed protein product [Vitis vinifera]
Length=740

 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 57/88 (65%), Positives = 66/88 (75%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN + E  +R   V  PP K F   + ST KET+FPDDPFRQFKNQ   RKFVLG+QY V
Sbjct  88   GNSNCETPRR---VAVPPKKSFSASLSSTFKETIFPDDPFRQFKNQSPSRKFVLGLQYLV  144

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PI +WAPRYTF+ FKAD++AGITIASLA
Sbjct  145  PIFEWAPRYTFEFFKADLIAGITIASLA  172



>emb|CDY70327.1| BnaCnng67820D, partial [Brassica napus]
Length=421

 Score =   117 bits (293),  Expect = 1e-27, Method: Compositional matrix adjust.
 Identities = 55/94 (59%), Positives = 72/94 (77%), Gaps = 0/94 (0%)
 Frame = +1

Query  253  TENSMGGNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            TE++    G  E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   R+ VL
Sbjct  3    TEDNTFPQGAEEPHRRHHAVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQTTSRQVVL  62

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G++YF+PIL+WAP Y F+ FK+D++AGITIASLA
Sbjct  63   GLKYFLPILEWAPLYNFKLFKSDLIAGITIASLA  96



>ref|XP_006352762.1| PREDICTED: sulfate transporter 3.1-like [Solanum tuberosum]
Length=663

 Score =   119 bits (298),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 51/75 (68%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF++ +K+TVKETLFPDDP +QFKNQ   RKF+LG+QYF PI +W  RY F  
Sbjct  26   VEIPPPQPFFKSLKNTVKETLFPDDPLKQFKNQKPLRKFILGVQYFFPIFEWGSRYNFGF  85

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  86   FKADLIAGITIASLA  100



>emb|CDY29052.1| BnaC07g32580D [Brassica napus]
Length=758

 Score =   119 bits (299),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/83 (64%), Positives = 65/83 (78%), Gaps = 0/83 (0%)
 Frame = +1

Query  286  EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDW  465
            E  +R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RK VLG+QYF PI +W
Sbjct  114  EPHRRHHTVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKVVLGLQYFFPICEW  173

Query  466  APRYTFQSFKADVVAGITIASLA  534
            APRY  + FK+D++AGITIASLA
Sbjct  174  APRYNLKLFKSDLIAGITIASLA  196



>ref|XP_010652002.1| PREDICTED: sulfate transporter 3.1-like [Vitis vinifera]
 emb|CBI28731.3| unnamed protein product [Vitis vinifera]
Length=647

 Score =   119 bits (297),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/92 (58%), Positives = 67/92 (73%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GNGDY++     E    V  PPP+PF + +K+++KET  PDDP RQFKNQP  R F LG+
Sbjct  2    GNGDYKYPAAGVECAHRVAVPPPQPFTKSLKTSLKETFVPDDPLRQFKNQPASRIFRLGL  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            QY  PIL+W PRY+FQ  KAD+++GITIASLA
Sbjct  62   QYLFPILEWGPRYSFQFLKADLISGITIASLA  93



>ref|XP_004247192.1| PREDICTED: sulfate transporter 3.1 [Solanum lycopersicum]
Length=658

 Score =   119 bits (297),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 53/97 (55%), Positives = 70/97 (72%), Gaps = 9/97 (9%)
 Frame = +1

Query  271  GNGDY---------EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRK  423
            GN +Y         E  +++ +VE P  +PF + +K+TVKETLFPDDP RQFKNQP  +K
Sbjct  2    GNAEYDEYSSSMKGEKNRKKHQVEIPAAQPFLKSLKNTVKETLFPDDPLRQFKNQPPLKK  61

Query  424  FVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             +LG+QYF PI +WAPRYT   FK+D+++GITIASLA
Sbjct  62   LILGLQYFFPIFEWAPRYTLDFFKSDLISGITIASLA  98



>gb|EYU40896.1| hypothetical protein MIMGU_mgv1a002568mg [Erythranthe guttata]
Length=657

 Score =   119 bits (297),  Expect = 1e-27, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF + +K+T+KET FPDDP RQFKNQP  +K VLG QY  PIL+W PRYT + 
Sbjct  24   VEIPPPQPFVKSIKNTLKETFFPDDPLRQFKNQPPRKKLVLGFQYIFPILEWGPRYTLEF  83

Query  490  FKADVVAGITIASLA  534
             KAD++AGITIASLA
Sbjct  84   LKADLIAGITIASLA  98



>ref|XP_009367588.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=657

 Score =   118 bits (296),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 54/93 (58%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQQRRGE-----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GN DY +     E     VE PP +PF + +KS++KET FPDDP R FKNQP  RKF+LG
Sbjct  2    GNVDYAYPSTNVENSPHRVEIPPAQPFIKTLKSSLKETFFPDDPLRPFKNQPASRKFILG  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             QYF PIL+WAPRYT    K+D+++GITIASLA
Sbjct  62   FQYFFPILEWAPRYTLDFLKSDLISGITIASLA  94



>ref|XP_006444002.1| hypothetical protein CICLE_v10019207mg [Citrus clementina]
 ref|XP_006479671.1| PREDICTED: sulfate transporter 3.1-like [Citrus sinensis]
 gb|ESR57242.1| hypothetical protein CICLE_v10019207mg [Citrus clementina]
 gb|KDO68651.1| hypothetical protein CISIN_1g006138mg [Citrus sinensis]
Length=659

 Score =   118 bits (296),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 66/94 (70%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVE------APPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GN DY +   +  VE       PPP+PF+  +K  +KET FPDDP R FKN+P  +KF+L
Sbjct  4    GNADYVYPSSKENVENAHRVAIPPPQPFFNSLKYNLKETFFPDDPLRLFKNKPASKKFIL  63

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QY  PI +WAPRY+FQ  KAD++AGITIASLA
Sbjct  64   GLQYVFPIFEWAPRYSFQFLKADLIAGITIASLA  97



>ref|XP_002307605.1| Sulfate transporter 3.2 family protein [Populus trichocarpa]
 gb|EEE94601.1| Sulfate transporter 3.2 family protein [Populus trichocarpa]
Length=655

 Score =   118 bits (295),  Expect = 2e-27, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 65/92 (71%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     E    V  PPP+PF + +K  +KET FPDDP RQFKNQP  R+FVLG+
Sbjct  2    GNADYVFPSTNAECARRVAIPPPQPFVKSLKYNLKETFFPDDPLRQFKNQPTSRRFVLGI  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +YF+PI DWAP YTF   ++D ++GITIASLA
Sbjct  62   KYFLPIFDWAPSYTFDFLRSDFISGITIASLA  93



>ref|XP_008438625.1| PREDICTED: sulfate transporter 3.1 [Cucumis melo]
Length=646

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 53/88 (60%), Positives = 63/88 (72%), Gaps = 3/88 (3%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+E   R   V  PP KPF + + S +KET FPDDPF+QFKNQPLP +  L ++YF+
Sbjct  2    GNADFECPHR---VAIPPKKPFLDSLSSNLKETFFPDDPFKQFKNQPLPTQIFLWLKYFI  58

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            P L WAP YT   FKAD+VAGITIASLA
Sbjct  59   PFLSWAPHYTLDFFKADLVAGITIASLA  86



>ref|XP_007162459.1| hypothetical protein PHAVU_001G154200g [Phaseolus vulgaris]
 gb|ESW34453.1| hypothetical protein PHAVU_001G154200g [Phaseolus vulgaris]
Length=653

 Score =   117 bits (294),  Expect = 3e-27, Method: Composition-based stats.
 Identities = 52/90 (58%), Positives = 67/90 (74%), Gaps = 2/90 (2%)
 Frame = +1

Query  271  GNGDYEWQQRR--GEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQY  444
            GN DYE+        V  PPP+PF++ +K ++KET FPDDPFR+FKNQ    KFVLG+QY
Sbjct  2    GNADYEYPNADCVHRVAIPPPQPFFKSLKYSLKETFFPDDPFRKFKNQTPSIKFVLGLQY  61

Query  445  FVPILDWAPRYTFQSFKADVVAGITIASLA  534
            F PI +WAP+YT Q  K+D+++GITIASLA
Sbjct  62   FFPIFEWAPKYTLQFLKSDLISGITIASLA  91



>ref|XP_011082583.1| PREDICTED: sulfate transporter 3.1-like [Sesamum indicum]
Length=663

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/97 (57%), Positives = 65/97 (67%), Gaps = 9/97 (9%)
 Frame = +1

Query  271  GNGDYE--WQQRRG-------EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRK  423
            GN DY   W             V  PPP+PF + +K+T+KET FPDDP RQFKNQ   +K
Sbjct  2    GNADYTYPWSNDYNSHAAASHRVAIPPPQPFVKSLKNTLKETFFPDDPLRQFKNQSPRKK  61

Query  424  FVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             VLG+QY  PIL+W PRYT Q FKAD++AGITIASLA
Sbjct  62   LVLGLQYLFPILEWGPRYTLQFFKADLIAGITIASLA  98



>emb|CDP03663.1| unnamed protein product [Coffea canephora]
Length=652

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 50/88 (57%), Positives = 64/88 (73%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            GN D+   +       PPP+PF + +++ VKETLFPDDP RQFKNQP  RK +LG+QY  
Sbjct  2    GNADFMNGESTHRAAVPPPQPFLKSLQNAVKETLFPDDPLRQFKNQPPGRKLILGLQYLF  61

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            PIL+W PRY+   FK+D+V+GITIASLA
Sbjct  62   PILEWGPRYSLDFFKSDLVSGITIASLA  89



>ref|XP_009136641.1| PREDICTED: sulfate transporter 3.1-like [Brassica rapa]
Length=658

 Score =   117 bits (293),  Expect = 5e-27, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = +1

Query  271  GNGDYEWQQ-------RRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFV  429
            G  DY + Q       R   VE P P+PF + ++ +VKETLFPDDPFRQFKNQ   RK V
Sbjct  2    GTADYTFPQGAEEPHLRHHTVETPEPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKVV  61

Query  430  LGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            LG+QYF PI +WAPRY    FK+D++AGITIASLA
Sbjct  62   LGLQYFFPICEWAPRYNLTLFKSDLIAGITIASLA  96



>ref|XP_009370789.1| PREDICTED: sulfate transporter 3.1-like [Pyrus x bretschneideri]
Length=654

 Score =   117 bits (292),  Expect = 6e-27, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 61/75 (81%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF + +KS++KET FPDDP R FKNQP  RKF+LG Q+F PIL+WAPRYT + 
Sbjct  17   VEIPPPQPFIKTLKSSLKETFFPDDPLRPFKNQPTSRKFILGFQHFFPILEWAPRYTLEF  76

Query  490  FKADVVAGITIASLA  534
             K+D+++G TIASLA
Sbjct  77   LKSDLISGFTIASLA  91



>ref|XP_003554265.1| PREDICTED: sulfate transporter 3.1-like [Glycine max]
 gb|KHN02557.1| Sulfate transporter 3.1 [Glycine soja]
Length=656

 Score =   116 bits (291),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 67/93 (72%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQQRRG-----EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GN DY +           V  PPP+PF++ +K ++KET FPDDPFR+FKNQP  ++F+LG
Sbjct  2    GNADYAYPSGMNVECVHRVAIPPPQPFFKSLKYSMKETFFPDDPFRKFKNQPASKRFLLG  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +QYF PI +WAP+YT    K+D+++GITIASLA
Sbjct  62   LQYFFPIFEWAPKYTLHFLKSDLISGITIASLA  94



>ref|XP_003521258.1| PREDICTED: sulfate transporter 3.1-like [Glycine max]
 gb|KHN10687.1| Sulfate transporter 3.1 [Glycine soja]
Length=656

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 68/93 (73%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEWQ-----QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GN DY +      +    V  PPP+PF++ +K ++KET FPDDPFR+FKNQP  ++F+LG
Sbjct  2    GNADYAYPSGMNVESVHRVAIPPPQPFFKSLKYSMKETFFPDDPFRKFKNQPASKRFMLG  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +QYF PI +WAP+YT    K+D+++GITIASLA
Sbjct  62   LQYFFPIFEWAPKYTLHFLKSDLISGITIASLA  94



>ref|XP_004242345.1| PREDICTED: sulfate transporter 3.1-like [Solanum lycopersicum]
Length=660

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/75 (65%), Positives = 62/75 (83%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF++ +K+T+KETLFPDDP +QFKNQ   RKF+LG+QY  PI +W  RY+F  
Sbjct  23   VEIPPPQPFFKSLKNTLKETLFPDDPLKQFKNQKPLRKFILGVQYLFPIFEWGSRYSFGF  82

Query  490  FKADVVAGITIASLA  534
            FKAD++AGITIASLA
Sbjct  83   FKADLIAGITIASLA  97



>ref|XP_007201737.1| hypothetical protein PRUPE_ppa002556mg [Prunus persica]
 gb|EMJ02936.1| hypothetical protein PRUPE_ppa002556mg [Prunus persica]
Length=658

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 52/94 (55%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAP------PPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            GN DY       E E+P      PP+PF + VK+++KET FPDDP RQFKNQP  RK VL
Sbjct  2    GNADYVCPSTNVEGESPHRVAIPPPQPFVKTVKNSLKETFFPDDPLRQFKNQPASRKLVL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF PI +W PRYT    K+D+++GITIASL+
Sbjct  62   GLQYFFPIFEWGPRYTLDFLKSDLISGITIASLS  95



>ref|XP_007144655.1| hypothetical protein PHAVU_007G174100g [Phaseolus vulgaris]
 gb|ESW16649.1| hypothetical protein PHAVU_007G174100g [Phaseolus vulgaris]
Length=660

 Score =   116 bits (290),  Expect = 1e-26, Method: Composition-based stats.
 Identities = 49/80 (61%), Positives = 63/80 (79%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            Q++  VE P P+PF + +K ++KET FPDDP RQFKN+P  +KF+L +QYF PI  WAP+
Sbjct  20   QQKHHVEVPTPQPFLKYLKFSLKETFFPDDPLRQFKNKPPSKKFMLAIQYFFPIFQWAPK  79

Query  475  YTFQSFKADVVAGITIASLA  534
            YTF  FKAD++AGITIASLA
Sbjct  80   YTFHFFKADLIAGITIASLA  99



>ref|XP_006403870.1| hypothetical protein EUTSA_v10010178mg [Eutrema salsugineum]
 gb|ESQ45323.1| hypothetical protein EUTSA_v10010178mg [Eutrema salsugineum]
Length=658

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  277  GDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPI  456
            G  E  +R   VEAP P+PF + ++ ++KETLFPDDPFRQFKNQ   RK VLG++YF PI
Sbjct  11   GAEESHRRHHTVEAPEPQPFLKSLQYSLKETLFPDDPFRQFKNQKASRKVVLGIKYFFPI  70

Query  457  LDWAPRYTFQSFKADVVAGITIASLA  534
             +WAPRY  + FK+D++AGITIASLA
Sbjct  71   CEWAPRYNLKFFKSDLIAGITIASLA  96



>dbj|BAJ34524.1| unnamed protein product [Thellungiella halophila]
Length=658

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  277  GDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPI  456
            G  E  +R   VEAP P+PF + ++ ++KETLFPDDPFRQFKNQ   RK VLG++YF PI
Sbjct  11   GAEESHRRHHTVEAPEPQPFLKSLQYSLKETLFPDDPFRQFKNQKASRKVVLGIKYFFPI  70

Query  457  LDWAPRYTFQSFKADVVAGITIASLA  534
             +WAPRY  + FK+D++AGITIASLA
Sbjct  71   CEWAPRYNLKFFKSDLIAGITIASLA  96



>ref|XP_006290679.1| hypothetical protein CARUB_v10016772mg, partial [Capsella rubella]
 gb|EOA23577.1| hypothetical protein CARUB_v10016772mg, partial [Capsella rubella]
Length=685

 Score =   115 bits (289),  Expect = 2e-26, Method: Compositional matrix adjust.
 Identities = 53/86 (62%), Positives = 66/86 (77%), Gaps = 0/86 (0%)
 Frame = +1

Query  277  GDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPI  456
            G  E Q+R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ    K VLG++YF PI
Sbjct  38   GAEELQRRHHTVEAPKPQPFLKSLQYSVKETLFPDDPFRQFKNQNASTKVVLGLKYFFPI  97

Query  457  LDWAPRYTFQSFKADVVAGITIASLA  534
             +WAP Y F+ FK+D++AGITIASLA
Sbjct  98   FEWAPHYNFKFFKSDLIAGITIASLA  123



>ref|XP_002877831.1| sulfate transporter [Arabidopsis lyrata subsp. lyrata]
 gb|EFH54090.1| sulfate transporter [Arabidopsis lyrata subsp. lyrata]
Length=659

 Score =   115 bits (289),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/75 (67%), Positives = 63/75 (84%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RK VLG++YF+PI +WAPRY  + 
Sbjct  23   VEAPQPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKVVLGLKYFLPIFEWAPRYNLKF  82

Query  490  FKADVVAGITIASLA  534
            FK+D++AGITIASLA
Sbjct  83   FKSDLIAGITIASLA  97



>emb|CDX90628.1| BnaA03g41530D [Brassica napus]
Length=658

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 55/95 (58%), Positives = 66/95 (69%), Gaps = 7/95 (7%)
 Frame = +1

Query  271  GNGDYEWQQ-------RRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFV  429
            G  DY + Q       R   VEAP P+PF + ++ +VKETLFPDDPFRQFKNQ   RK V
Sbjct  2    GTADYTFPQGAEEPHLRHHTVEAPEPQPFLKSLQYSVKETLFPDDPFRQFKNQNASRKVV  61

Query  430  LGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            LG+QY  PI +WAPRY    FK+D++AGITIASLA
Sbjct  62   LGLQYVFPISEWAPRYNLTLFKSDLIAGITIASLA  96



>ref|XP_004290627.1| PREDICTED: sulfate transporter 3.1 [Fragaria vesca subsp. vesca]
Length=655

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 52/92 (57%), Positives = 64/92 (70%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQQRRGE----VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     E    V  PPP+PF   +K+++KET FPDDP RQFKNQP  RK VLG+
Sbjct  2    GNVDYVYPSANVESSRRVAIPPPQPFITTLKNSLKETFFPDDPLRQFKNQPASRKLVLGI  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            QY  PI +WAPRYT    K+D+++GITIASLA
Sbjct  62   QYVFPIFEWAPRYTLDFLKSDLISGITIASLA  93



>ref|XP_010552756.1| PREDICTED: sulfate transporter 3.1 isoform X2 [Tarenaya hassleriana]
Length=642

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  286  EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDW  465
            E +QRR  VEAPPP+PF   ++ ++KETLFPDDPFRQFK+Q   RK VL ++YF PIL+W
Sbjct  4    EQEQRRHRVEAPPPQPFIRSLEYSMKETLFPDDPFRQFKDQSPTRKLVLALKYFFPILEW  63

Query  466  APRYTFQSFKADVVAGITIASLA  534
            AP Y     K+D++AG+TIASLA
Sbjct  64   APLYNLTLLKSDLIAGVTIASLA  86



>ref|XP_010552755.1| PREDICTED: sulfate transporter 3.1 isoform X1 [Tarenaya hassleriana]
Length=642

 Score =   115 bits (288),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 50/83 (60%), Positives = 64/83 (77%), Gaps = 0/83 (0%)
 Frame = +1

Query  286  EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDW  465
            E +QRR  VEAPPP+PF   ++ ++KETLFPDDPFRQFK+Q   RK VL ++YF PIL+W
Sbjct  4    EQEQRRHRVEAPPPQPFIRSLEYSMKETLFPDDPFRQFKDQSPTRKLVLALKYFFPILEW  63

Query  466  APRYTFQSFKADVVAGITIASLA  534
            AP Y     K+D++AG+TIASLA
Sbjct  64   APLYNLTLLKSDLIAGVTIASLA  86



>ref|XP_003590594.1| Sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
 gb|AES60845.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=656

 Score =   114 bits (286),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PPP+PF + +K ++KET FPDDP R+FKNQP  +K VLG+QYF PI +WAP YTFQ 
Sbjct  23   VAIPPPQPFLKSMKYSMKETFFPDDPLRRFKNQPASKKLVLGLQYFFPIFEWAPSYTFQF  82

Query  490  FKADVVAGITIASLA  534
             K+D++AGITIASLA
Sbjct  83   LKSDLIAGITIASLA  97



>gb|EYU46548.1| hypothetical protein MIMGU_mgv1a002543mg [Erythranthe guttata]
Length=660

 Score =   114 bits (286),  Expect = 4e-26, Method: Composition-based stats.
 Identities = 48/75 (64%), Positives = 60/75 (80%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PPP+PF + +K+T+KET FPDDP RQFKNQP  RK +LG+QY  PI+ W P+YT+Q 
Sbjct  21   VAIPPPQPFIKSLKNTLKETFFPDDPLRQFKNQPPRRKLLLGLQYVFPIVQWGPQYTWQF  80

Query  490  FKADVVAGITIASLA  534
             KAD++AGITIASLA
Sbjct  81   LKADLIAGITIASLA  95



>ref|XP_008235373.1| PREDICTED: sulfate transporter 3.1-like [Prunus mume]
Length=658

 Score =   114 bits (284),  Expect = 8e-26, Method: Composition-based stats.
 Identities = 50/94 (53%), Positives = 65/94 (69%), Gaps = 6/94 (6%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAP------PPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVL  432
            G  DY +     E E+P      PP+PF + +K+++KET FPDDP RQFKNQP  RK VL
Sbjct  2    GTADYVYPSTNVEGESPHRVAIPPPQPFVKTLKNSLKETFFPDDPLRQFKNQPASRKLVL  61

Query  433  GMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            G+QYF PI +W PRYT    K+D+++GITIASL+
Sbjct  62   GLQYFFPIFEWGPRYTLDFLKSDLISGITIASLS  95



>gb|KFK34430.1| hypothetical protein AALP_AA5G143800 [Arabis alpina]
Length=657

 Score =   113 bits (282),  Expect = 1e-25, Method: Composition-based stats.
 Identities = 52/86 (60%), Positives = 63/86 (73%), Gaps = 0/86 (0%)
 Frame = +1

Query  277  GDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPI  456
            G  E  +R   VEAP P+PF + ++ +V ETLFPDDPFRQFKNQ   RK VLG++YF PI
Sbjct  11   GSEEPHRRHHTVEAPQPQPFLKSLQYSVIETLFPDDPFRQFKNQKPSRKVVLGLKYFFPI  70

Query  457  LDWAPRYTFQSFKADVVAGITIASLA  534
             DWAPRY     K+D++AGITIASLA
Sbjct  71   CDWAPRYNLNLLKSDLIAGITIASLA  96



>ref|XP_004493701.1| PREDICTED: sulfate transporter 3.1-like [Cicer arietinum]
Length=657

 Score =   112 bits (280),  Expect = 3e-25, Method: Composition-based stats.
 Identities = 47/72 (65%), Positives = 58/72 (81%), Gaps = 0/72 (0%)
 Frame = +1

Query  319  PPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKA  498
            PPPKPF E  K ++KETLF DDP ++FKNQP  ++FVL +QYF PIL+WAP YT Q  K+
Sbjct  24   PPPKPFIESFKHSMKETLFQDDPLKKFKNQPTSKRFVLALQYFFPILEWAPHYTLQFLKS  83

Query  499  DVVAGITIASLA  534
            D++AGITIASLA
Sbjct  84   DLIAGITIASLA  95



>ref|XP_004495176.1| PREDICTED: sulfate transporter 3.1-like [Cicer arietinum]
Length=656

 Score =   112 bits (279),  Expect = 4e-25, Method: Composition-based stats.
 Identities = 49/93 (53%), Positives = 66/93 (71%), Gaps = 5/93 (5%)
 Frame = +1

Query  271  GNGDYEW-----QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLG  435
            GN DY +     ++    V  PP +PF + +K ++KET FPDDP R+FKNQP  +KF+L 
Sbjct  2    GNVDYAYTCSSVEESVQRVAVPPDQPFLKSMKYSLKETFFPDDPLRRFKNQPPSKKFILA  61

Query  436  MQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +QYF PI +WAP Y+FQ  K+D++AGITIASLA
Sbjct  62   LQYFFPIFEWAPNYSFQFLKSDLIAGITIASLA  94



>ref|XP_009403141.1| PREDICTED: probable sulfate transporter 3.3 [Musa acuminata subsp. 
malaccensis]
Length=646

 Score =   109 bits (273),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 49/88 (56%), Positives = 61/88 (69%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            G G  E  +    V  PPP+   + +K  +KET FPDDPFR+FK QPL RK+VL  QY  
Sbjct  9    GEGQVETSEAVHRVAEPPPQSTVDKMKVRMKETFFPDDPFRRFKGQPLKRKWVLAAQYLF  68

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            P+LDWAP Y+F  FK+D+VAG+TIASLA
Sbjct  69   PVLDWAPSYSFSLFKSDLVAGLTIASLA  96



>ref|XP_010917792.1| PREDICTED: sulfate transporter 3.1-like [Elaeis guineensis]
Length=658

 Score =   109 bits (273),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +PF E  ++ +KET FPDDP RQFK++   R+ +LG+QYF+PIL WAP Y+F  
Sbjct  21   VPIPPSRPFLETFRANLKETFFPDDPLRQFKHEKCSRRLILGLQYFLPILQWAPTYSFNF  80

Query  490  FKADVVAGITIASLA  534
            FK+D++AGITIASLA
Sbjct  81   FKSDLIAGITIASLA  95



>ref|XP_004298019.1| PREDICTED: sulfate transporter 3.1-like [Fragaria vesca subsp. 
vesca]
Length=656

 Score =   108 bits (271),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 45/76 (59%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PPPKP    VKS+++ET F DDPFR+FKNQP  RK +LG+QYF  IL+WAPRY   
Sbjct  15   QVVIPPPKPLLTAVKSSMRETFFSDDPFRRFKNQPGSRKVILGLQYFFTILEWAPRYKLS  74

Query  487  SFKADVVAGITIASLA  534
              K+D++AG+TI+SLA
Sbjct  75   YLKSDIIAGVTISSLA  90



>ref|XP_002300821.2| Sulfate transporter 3.2 family protein [Populus trichocarpa]
 gb|EEE80094.2| Sulfate transporter 3.2 family protein [Populus trichocarpa]
Length=655

 Score =   108 bits (271),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQ----QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     +R   V  PPP+   + +K  +KET FPDDP RQFKNQ   R+FVLG+
Sbjct  2    GNADYVYPSTNVERTPRVVIPPPQSSMKSLKYNLKETFFPDDPLRQFKNQTTSRRFVLGL  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +YF PI DWAP YT    K+D +AGITIASLA
Sbjct  62   KYFFPIFDWAPSYTLDFLKSDFIAGITIASLA  93



>ref|XP_011026121.1| PREDICTED: sulfate transporter 3.1-like [Populus euphratica]
Length=655

 Score =   108 bits (271),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 50/92 (54%), Positives = 61/92 (66%), Gaps = 4/92 (4%)
 Frame = +1

Query  271  GNGDYEWQ----QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGM  438
            GN DY +     +R   V  PPP+   + +K  +KET FPDDP RQFKNQ   R+FVLG+
Sbjct  2    GNADYVYPSTNVERAPRVAIPPPQSSVKSLKYNLKETFFPDDPLRQFKNQTTSRRFVLGL  61

Query  439  QYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +YF PI DWAP YT    K+D +AGITIASLA
Sbjct  62   KYFFPIFDWAPSYTLGFLKSDFIAGITIASLA  93



>ref|XP_008809388.1| PREDICTED: sulfate transporter 3.1-like [Phoenix dactylifera]
Length=659

 Score =   108 bits (269),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 44/75 (59%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +PF +  ++ +KET FPDDP RQFK++   R+ +LG+QYF+PIL WAP Y+F  
Sbjct  22   VPVPPSRPFLQTFRANLKETFFPDDPLRQFKHEKGSRRLILGLQYFLPILQWAPNYSFSF  81

Query  490  FKADVVAGITIASLA  534
            FK+D+VAGITIASLA
Sbjct  82   FKSDLVAGITIASLA  96



>ref|XP_009419196.1| PREDICTED: sulfate transporter 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=652

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 58/75 (77%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +PF +  ++ +KET FPDDP RQF+N+  PR+ +LG++YF+PILDWAP Y+   
Sbjct  17   VPVPPSRPFLDTFRANLKETFFPDDPLRQFRNESGPRRVILGLKYFLPILDWAPSYSLSL  76

Query  490  FKADVVAGITIASLA  534
            FK+D++AG TIASLA
Sbjct  77   FKSDLIAGATIASLA  91



>ref|XP_008807263.1| PREDICTED: sulfate transporter 3.1-like [Phoenix dactylifera]
Length=660

 Score =   107 bits (267),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 46/75 (61%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +PF E   + +KET FPDDPFRQFK++   RK +LG+QYF+PIL W P Y+F  
Sbjct  23   VPVPPSQPFLETFHANLKETFFPDDPFRQFKHERGFRKLILGLQYFIPILQWVPSYSFSL  82

Query  490  FKADVVAGITIASLA  534
            FK+D VAGITIASLA
Sbjct  83   FKSDFVAGITIASLA  97



>ref|XP_010932801.1| PREDICTED: sulfate transporter 3.1-like isoform X1 [Elaeis guineensis]
Length=660

 Score =   105 bits (263),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +PF E   + +KET FPDDPFRQFK++   R+  LG+QYF+P+L+W P Y+F  
Sbjct  23   VPVPPSRPFLETFHANLKETFFPDDPFRQFKHERGIRRLFLGLQYFIPVLEWVPSYSFNF  82

Query  490  FKADVVAGITIASLA  534
            FK+D++AGITIASLA
Sbjct  83   FKSDLIAGITIASLA  97



>ref|XP_004146971.1| PREDICTED: sulfate transporter 3.1-like [Cucumis sativus]
 gb|KGN44785.1| hypothetical protein Csa_7G387690 [Cucumis sativus]
Length=662

 Score =   105 bits (263),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/72 (57%), Positives = 56/72 (78%), Gaps = 0/72 (0%)
 Frame = +1

Query  319  PPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKA  498
            PPP+PF + +K+ +KET FPDDP RQFKN+P  +K +LG QYF P+++W PRY    FK+
Sbjct  28   PPPQPFLKSLKNAMKETFFPDDPLRQFKNKPPAKKMILGFQYFFPVVEWGPRYNLGLFKS  87

Query  499  DVVAGITIASLA  534
            D+++G TIASLA
Sbjct  88   DLISGFTIASLA  99



>gb|EPS58454.1| hypothetical protein M569_16360, partial [Genlisea aurea]
Length=238

 Score =   102 bits (253),  Expect = 5e-23, Method: Compositional matrix adjust.
 Identities = 48/84 (57%), Positives = 67/84 (80%), Gaps = 2/84 (2%)
 Frame = +1

Query  286  EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQP-LPRKFVLGMQYFVPILD  462
            + + RRG VE PP  PF + +++T+K+TL PDDPFRQF+NQ  + ++FVLG+QY  PIL+
Sbjct  10   QAENRRG-VEIPPAVPFSKHLRNTLKDTLLPDDPFRQFRNQNGIGKRFVLGLQYVFPILE  68

Query  463  WAPRYTFQSFKADVVAGITIASLA  534
            W P Y F+SF++D+V+GITIASLA
Sbjct  69   WFPSYGFRSFRSDLVSGITIASLA  92



>ref|XP_010070167.1| PREDICTED: sulfate transporter 3.1-like [Eucalyptus grandis]
 gb|KCW58780.1| hypothetical protein EUGRSUZ_H01414 [Eucalyptus grandis]
Length=660

 Score =   105 bits (262),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 50/96 (52%), Positives = 65/96 (68%), Gaps = 8/96 (8%)
 Frame = +1

Query  271  GNGDY-EWQQRRGE-------VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKF  426
            GN DY E+    G        V  P P+PF + +K+++ ET FPDDP RQFK QP  R+ 
Sbjct  2    GNADYDEFPPVEGAADRCGNGVAIPLPRPFLKSLKNSLMETFFPDDPLRQFKGQPQSRRI  61

Query  427  VLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +LG+QY +PIL+W PRYT +  +AD+VAGITIASLA
Sbjct  62   MLGLQYVLPILEWGPRYTLEFLRADLVAGITIASLA  97



>ref|XP_009381462.1| PREDICTED: probable sulfate transporter 3.3 [Musa acuminata subsp. 
malaccensis]
Length=655

 Score =   105 bits (262),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 47/76 (62%), Positives = 58/76 (76%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +VEA PP+   + +K  +KET FPDDPFR+FK QP  RK+VLG QY  PILDWAP Y+  
Sbjct  24   KVEAAPPQSTVDKMKLRLKETFFPDDPFRRFKGQPPRRKWVLGAQYLFPILDWAPNYSLS  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  84   FFKSDLVAGLTIASLA  99



>ref|XP_010556774.1| PREDICTED: sulfate transporter 3.2 isoform X1 [Tarenaya hassleriana]
Length=649

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF   +K T+ E LFPDDPFRQFKN+   RK VLG++Y  PIL+WA  Y+++ 
Sbjct  10   VEIPPPQPFLRSLKKTLMEILFPDDPFRQFKNEKPSRKLVLGLRYVFPILEWASSYSWEF  69

Query  490  FKADVVAGITIASLA  534
             K+D +AGITIASLA
Sbjct  70   LKSDAIAGITIASLA  84



>ref|XP_010556775.1| PREDICTED: sulfate transporter 3.2 isoform X2 [Tarenaya hassleriana]
Length=638

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 45/75 (60%), Positives = 57/75 (76%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            VE PPP+PF   +K T+ E LFPDDPFRQFKN+   RK VLG++Y  PIL+WA  Y+++ 
Sbjct  10   VEIPPPQPFLRSLKKTLMEILFPDDPFRQFKNEKPSRKLVLGLRYVFPILEWASSYSWEF  69

Query  490  FKADVVAGITIASLA  534
             K+D +AGITIASLA
Sbjct  70   LKSDAIAGITIASLA  84



>ref|XP_010274709.1| PREDICTED: probable sulfate transporter 3.3 [Nelumbo nucifera]
Length=653

 Score =   104 bits (259),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 47/96 (49%), Positives = 63/96 (66%), Gaps = 2/96 (2%)
 Frame = +1

Query  253  TENSMGGNGD--YEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKF  426
            T+ SM   G    E      +V  PPPK  ++ +K+ +KETLFPDDP RQFK QPL +K+
Sbjct  4    TQTSMSNTGPQCVEIDMEVHKVVPPPPKSTFQKLKNRLKETLFPDDPLRQFKGQPLKKKW  63

Query  427  VLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            +LG QY  PIL W P Y  +  K+D+++G+TIASLA
Sbjct  64   ILGAQYIFPILQWGPNYNLKLLKSDIISGLTIASLA  99



>ref|XP_004172241.1| PREDICTED: sulfate transporter 3.1-like, partial [Cucumis sativus]
Length=187

 Score = 99.0 bits (245),  Expect = 3e-22, Method: Compositional matrix adjust.
 Identities = 47/98 (48%), Positives = 63/98 (64%), Gaps = 10/98 (10%)
 Frame = +1

Query  271  GNGDYEWQQRR---GE-------VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPR  420
            GN DY +       GE          PPP+PF + +K+ +KET FPDDP RQFKN+P  +
Sbjct  2    GNADYVYPSSAPTAGEGGDCLHRAAIPPPQPFLKSLKNAMKETFFPDDPLRQFKNKPPAK  61

Query  421  KFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
            K +LG QYF P+++W PRY    FK+D+++G TIASLA
Sbjct  62   KMILGFQYFFPVVEWGPRYNLGLFKSDLISGFTIASLA  99



>ref|XP_009613802.1| PREDICTED: probable sulfate transporter 3.5 isoform X2 [Nicotiana 
tomentosiformis]
Length=582

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  292  QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAP  471
             Q    V    P+ F  ++K+ +KETLFPDDPF + KN+P+ R+F+ G QYFVPI +W P
Sbjct  5    HQSLHRVNYAAPRSFGTLLKANLKETLFPDDPFHEIKNEPISRRFLKGAQYFVPIFEWLP  64

Query  472  RYTFQSFKADVVAGITIASLA  534
            +Y+F+ FK D++AGITIASLA
Sbjct  65   KYSFKLFKYDLLAGITIASLA  85



>ref|XP_011463580.1| PREDICTED: sulfate transporter 3.1-like [Fragaria vesca subsp. 
vesca]
Length=578

 Score =   102 bits (255),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 46/84 (55%), Positives = 57/84 (68%), Gaps = 0/84 (0%)
 Frame = +1

Query  283  YEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILD  462
            Y  Q     VE PP KP    VK ++KET F DDP R+FKNQP  +K +LG+QYF  IL+
Sbjct  7    YHDQSSPQRVEIPPLKPLLTAVKLSLKETFFSDDPLRRFKNQPASKKAILGLQYFFTILE  66

Query  463  WAPRYTFQSFKADVVAGITIASLA  534
            WAPRY     K+D++AG+TIASLA
Sbjct  67   WAPRYNLGYLKSDLIAGVTIASLA  90



>ref|XP_009613801.1| PREDICTED: probable sulfate transporter 3.5 isoform X1 [Nicotiana 
tomentosiformis]
Length=642

 Score =   102 bits (255),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 43/81 (53%), Positives = 59/81 (73%), Gaps = 0/81 (0%)
 Frame = +1

Query  292  QQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAP  471
             Q    V    P+ F  ++K+ +KETLFPDDPF + KN+P+ R+F+ G QYFVPI +W P
Sbjct  5    HQSLHRVNYAAPRSFGTLLKANLKETLFPDDPFHEIKNEPISRRFLKGAQYFVPIFEWLP  64

Query  472  RYTFQSFKADVVAGITIASLA  534
            +Y+F+ FK D++AGITIASLA
Sbjct  65   KYSFKLFKYDLLAGITIASLA  85



>ref|XP_009393046.1| PREDICTED: sulfate transporter 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=662

 Score =   102 bits (254),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/77 (55%), Positives = 56/77 (73%), Gaps = 0/77 (0%)
 Frame = +1

Query  304  GEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTF  483
            G V  PP + F    ++ +KET FPDDP RQFKN P  R+F++G++YF P+L+W P Y  
Sbjct  23   GHVPIPPSRSFLATFRANLKETFFPDDPLRQFKNVPGSRRFLMGLKYFFPVLEWLPSYGH  82

Query  484  QSFKADVVAGITIASLA  534
             +FK+D+VAGITIASLA
Sbjct  83   STFKSDLVAGITIASLA  99



>ref|XP_009802339.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana sylvestris]
Length=648

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V +PP +  ++ +K+ +KET FPDDP RQFK QPL +K VLG QY  PIL+W P Y+F+
Sbjct  19   KVVSPPHRSTFQKLKNRLKETFFPDDPLRQFKGQPLKQKLVLGAQYVFPILEWGPNYSFK  78

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  79   LFKSDIVSGLTIASLA  94



>gb|KHN43015.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=601

 Score =   102 bits (253),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP K   +   + VKET FPDDP RQFK QPL RK +LG QY  P+L WAP Y+F+
Sbjct  10   QVVAPPYKSSLQKFITKVKETFFPDDPLRQFKGQPLKRKLILGAQYVFPVLQWAPSYSFK  69

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  70   LFKSDLISGLTIASLA  85



>ref|XP_003528541.2| PREDICTED: probable sulfate transporter 3.3-like [Glycine max]
Length=656

 Score =   101 bits (252),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP K   +   + VKET FPDDP RQFK QPL RK +LG QY  P+L WAP Y+F+
Sbjct  19   QVVAPPYKSSLQKFITKVKETFFPDDPLRQFKGQPLKRKLILGAQYVFPVLQWAPSYSFK  78

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  79   LFKSDLISGLTIASLA  94



>ref|XP_009604001.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tomentosiformis]
Length=648

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 59/76 (78%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V +PP +  ++ +K+ +KET FPDDP RQFK QPL +K +LG QY  PIL+W P Y+F+
Sbjct  19   KVVSPPHRSTFQKLKNRLKETFFPDDPLRQFKGQPLKQKLILGAQYVFPILEWGPNYSFK  78

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  79   LFKSDIISGLTIASLA  94



>gb|KHN08075.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=656

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K  +KET FPDDP RQFK QPL RK +LG QY  PIL W P+Y  +
Sbjct  22   QVVPPPHKSTLQKLKGRLKETFFPDDPLRQFKGQPLKRKLILGAQYVFPILQWGPKYNLK  81

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  82   LFKSDLVSGLTIASLA  97



>ref|XP_003556073.1| PREDICTED: probable sulfate transporter 3.3-like [Glycine max]
Length=658

 Score =   101 bits (251),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K  +KET FPDDP RQFK QPL RK +LG QY  PIL W P+Y  +
Sbjct  22   QVVPPPHKSTLQKLKGRLKETFFPDDPLRQFKGQPLKRKLILGAQYVFPILQWGPKYNLK  81

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  82   LFKSDLVSGLTIASLA  97



>emb|CAE03539.2| OSJNBa0060D06.5 [Oryza sativa Japonica Group]
 emb|CAE04513.2| OSJNBb0059K02.23 [Oryza sativa Japonica Group]
 gb|EEC78149.1| hypothetical protein OsI_17708 [Oryza sativa Indica Group]
Length=629

 Score =   100 bits (250),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP +     +K+ VKET FPDDPFR FK +PL  K+V+ +QY  PILDW P Y+F 
Sbjct  6    KVAAPPAQSTASKLKARVKETFFPDDPFRGFKGKPLTTKWVMAVQYLFPILDWVPSYSFS  65

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  66   LFKSDLVAGLTIASLA  81



>gb|AGW45462.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1, 
partial [Reaumuria trigyna]
Length=595

 Score =   100 bits (250),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 46/88 (52%), Positives = 58/88 (66%), Gaps = 0/88 (0%)
 Frame = +1

Query  271  GNGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFV  450
            G G  E       V  PPP+   + + S++KETLFPDDP RQFK +   RK++LG QY  
Sbjct  17   GGGCIEISMEVHRVAPPPPRSTIQKLGSSLKETLFPDDPLRQFKGKSTKRKWILGAQYIF  76

Query  451  PILDWAPRYTFQSFKADVVAGITIASLA  534
            P+L WAP YT   FK+D+VAG+TIASLA
Sbjct  77   PVLCWAPNYTLSCFKSDIVAGLTIASLA  104



>ref|NP_001054098.1| Os04g0652400 [Oryza sativa Japonica Group]
 dbj|BAF16012.1| Os04g0652400 [Oryza sativa Japonica Group]
 dbj|BAG96981.1| unnamed protein product [Oryza sativa Japonica Group]
Length=661

 Score =   100 bits (250),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP +     +K+ VKET FPDDPFR FK +PL  K+V+ +QY  PILDW P Y+F 
Sbjct  38   KVAAPPAQSTASKLKARVKETFFPDDPFRGFKGKPLTTKWVMAVQYLFPILDWVPSYSFS  97

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  98   LFKSDLVAGLTIASLA  113



>ref|XP_010314055.1| PREDICTED: probable sulfate transporter 3.5 [Solanum lycopersicum]
Length=640

 Score =   100 bits (249),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  ++K+ +KETLFPDDPF +FKN  L ++ ++G+QYFVPI  W P+Y F  
Sbjct  10   VNFAPPRSFGTILKANLKETLFPDDPFYEFKNDKLSKRILMGIQYFVPIFQWLPKYNFGL  69

Query  490  FKADVVAGITIASLA  534
            FK D++AGITIASLA
Sbjct  70   FKFDLLAGITIASLA  84



>ref|XP_008775815.1| PREDICTED: probable sulfate transporter 3.3 [Phoenix dactylifera]
Length=642

 Score =   100 bits (248),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V +PPP+   + +K  +KET FPDDPFR FK QP  +K++LG QY  PIL WAP Y   
Sbjct  20   KVVSPPPRSSLDKIKVRLKETFFPDDPFRHFKGQPPKKKWILGAQYLFPILGWAPTYNLS  79

Query  487  SFKADVVAGITIASLA  534
             FK+DVV+G+TIA+LA
Sbjct  80   LFKSDVVSGLTIATLA  95



>ref|XP_009757060.1| PREDICTED: probable sulfate transporter 3.5 isoform X3 [Nicotiana 
sylvestris]
Length=582

 Score = 99.8 bits (247),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            Q    V    P+ F  ++K+ +KETLFPDDPF + KN+P+ R+F+ G QYFVPI +W P+
Sbjct  6    QSLHRVNYAAPRSFGTLLKANLKETLFPDDPFHEIKNEPISRRFLKGAQYFVPIFEWLPK  65

Query  475  YTFQSFKADVVAGITIASLA  534
            Y F+  K D++AGITIASLA
Sbjct  66   YNFKLLKYDLLAGITIASLA  85



>ref|XP_011038634.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
Length=652

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS  KET FPDDP RQFK QPL +K++L  QYF PIL W P Y+F+
Sbjct  24   KVVPPPHRSTIQKLKSRFKETFFPDDPLRQFKGQPLGKKWILAAQYFFPILQWGPNYSFR  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_009757059.1| PREDICTED: probable sulfate transporter 3.5 isoform X2 [Nicotiana 
sylvestris]
Length=631

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            Q    V    P+ F  ++K+ +KETLFPDDPF + KN+P+ R+F+ G QYFVPI +W P+
Sbjct  6    QSLHRVNYAAPRSFGTLLKANLKETLFPDDPFHEIKNEPISRRFLKGAQYFVPIFEWLPK  65

Query  475  YTFQSFKADVVAGITIASLA  534
            Y F+  K D++AGITIASLA
Sbjct  66   YNFKLLKYDLLAGITIASLA  85



>ref|XP_009757058.1| PREDICTED: probable sulfate transporter 3.5 isoform X1 [Nicotiana 
sylvestris]
Length=642

 Score = 99.8 bits (247),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 42/80 (53%), Positives = 57/80 (71%), Gaps = 0/80 (0%)
 Frame = +1

Query  295  QRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPR  474
            Q    V    P+ F  ++K+ +KETLFPDDPF + KN+P+ R+F+ G QYFVPI +W P+
Sbjct  6    QSLHRVNYAAPRSFGTLLKANLKETLFPDDPFHEIKNEPISRRFLKGAQYFVPIFEWLPK  65

Query  475  YTFQSFKADVVAGITIASLA  534
            Y F+  K D++AGITIASLA
Sbjct  66   YNFKLLKYDLLAGITIASLA  85



>ref|XP_004505276.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Cicer 
arietinum]
Length=656

 Score = 99.8 bits (247),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP     + VK+ +KET FPDDP RQFK QPL RK +LG QY  PIL W P Y+F+
Sbjct  20   QVVPPPHTSTVKRVKTKLKETFFPDDPLRQFKGQPLNRKLILGAQYIFPILQWFPNYSFK  79

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  80   LFKSDLISGLTIASLA  95



>ref|XP_004505277.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Cicer 
arietinum]
Length=654

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP     + VK+ +KET FPDDP RQFK QPL RK +LG QY  PIL W P Y+F+
Sbjct  20   QVVPPPHTSTVKRVKTKLKETFFPDDPLRQFKGQPLNRKLILGAQYIFPILQWFPNYSFK  79

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  80   LFKSDLISGLTIASLA  95



>ref|XP_002314803.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
 gb|EEF00974.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
Length=652

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 57/76 (75%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS +KET FPDDP RQFK QPL +K++L  +YF PIL W P Y+F+
Sbjct  24   KVVPPPHRSTIQKLKSRLKETFFPDDPLRQFKGQPLGKKWILAAKYFFPILQWGPNYSFK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_007157748.1| hypothetical protein PHAVU_002G095200g [Phaseolus vulgaris]
 gb|ESW29742.1| hypothetical protein PHAVU_002G095200g [Phaseolus vulgaris]
Length=628

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   E   + +KE LFPDDP RQFK QPL RK +LG QY  P+L WAP Y+F+
Sbjct  14   QVVPPPYKSSLEKFITKIKEILFPDDPLRQFKGQPLHRKLILGAQYVFPLLQWAPTYSFK  73

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  74   LFKSDLISGLTIASLA  89



>gb|KHN43014.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=657

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + ++  +KET FPDDP RQFK QPL RK +LG QY  PIL W P+Y  +
Sbjct  22   QVVPPPHKSTLQKLQGRLKETFFPDDPLRQFKGQPLKRKLILGAQYVFPILQWGPKYNLK  81

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  82   LFKSDLVSGLTIASLA  97



>ref|XP_003529415.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Glycine 
max]
Length=659

 Score = 99.4 bits (246),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + ++  +KET FPDDP RQFK QPL RK +LG QY  PIL W P+Y  +
Sbjct  22   QVVPPPHKSTLQKLQGRLKETFFPDDPLRQFKGQPLKRKLILGAQYVFPILQWGPKYNLK  81

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  82   LFKSDLVSGLTIASLA  97



>gb|KHN02638.1| Putative sulfate transporter 3.3 [Glycine soja]
Length=217

 Score = 95.1 bits (235),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/76 (58%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP K   +   + VKET FPDDP RQFK QPL RK +LG QY  P+L WAP Y+F+
Sbjct  71   QVVAPPYKSSLQKFITKVKETFFPDDPLRQFKGQPLKRKLILGAQYVFPVLQWAPSYSFK  130

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  131  LFKSDLISGLTIASLA  146



>ref|XP_009405950.1| PREDICTED: sulfate transporter 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=649

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 39/67 (58%), Positives = 55/67 (82%), Gaps = 0/67 (0%)
 Frame = +1

Query  334  FYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADVVAG  513
            F +  ++ +KET FPDDP RQF+N+  PR+ +LG++YF+PIL+WAP Y+F  FK+D++AG
Sbjct  25   FLDTFRTNLKETFFPDDPLRQFRNEHGPRRVILGLKYFLPILEWAPSYSFGLFKSDLIAG  84

Query  514  ITIASLA  534
            ITIASLA
Sbjct  85   ITIASLA  91



>ref|XP_011078361.1| PREDICTED: probable sulfate transporter 3.5 [Sesamum indicum]
 ref|XP_011078362.1| PREDICTED: probable sulfate transporter 3.5 [Sesamum indicum]
Length=642

 Score = 99.0 bits (245),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  322  PPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKAD  501
            PP+ F  V+KS VKETLFPDDPF   KN+PL  +F+  +QYF+PI +W P+Y+   FK D
Sbjct  15   PPRSFRTVLKSKVKETLFPDDPFHLLKNEPLGHRFLKTLQYFIPICEWLPKYSLSFFKYD  74

Query  502  VVAGITIASLA  534
            ++AGITIASLA
Sbjct  75   LLAGITIASLA  85



>ref|XP_006583911.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Glycine 
max]
Length=637

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + ++  +KET FPDDP RQFK QPL RK +LG QY  PIL W P+Y  +
Sbjct  22   QVVPPPHKSTLQKLQGRLKETFFPDDPLRQFKGQPLKRKLILGAQYVFPILQWGPKYNLK  81

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  82   LFKSDLVSGLTIASLA  97



>ref|XP_006366873.1| PREDICTED: probable sulfate transporter 3.5-like [Solanum tuberosum]
Length=640

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 56/75 (75%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  V+K+ +KETLFPDDPF +FKN+ L ++ + G+QYFVPI  W P+Y F  
Sbjct  10   VNFAPPRSFGTVLKANLKETLFPDDPFYEFKNEKLSKRILKGIQYFVPICQWLPKYNFGL  69

Query  490  FKADVVAGITIASLA  534
            FK D++AGITIASLA
Sbjct  70   FKFDLLAGITIASLA  84



>ref|XP_007157749.1| hypothetical protein PHAVU_002G095300g [Phaseolus vulgaris]
 gb|ESW29743.1| hypothetical protein PHAVU_002G095300g [Phaseolus vulgaris]
Length=647

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K     +K+ +KET FPDDP RQFK QPL  K  LG QYF PIL W P+Y+ +
Sbjct  20   QVVPPPHKTTLHKLKARLKETFFPDDPLRQFKGQPLKTKLTLGAQYFFPILQWGPKYSLK  79

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  80   LFKSDLVSGLTIASLA  95



>gb|KEH30849.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=663

 Score = 99.0 bits (245),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            EV  PP     + V++  KET FPDDP RQFK QP  RK +LG QYF PIL W P Y F+
Sbjct  23   EVVPPPHMSTVQKVRTKFKETFFPDDPMRQFKGQPCNRKLILGAQYFFPILQWLPNYNFK  82

Query  487  SFKADVVAGITIASLA  534
              KAD+++G+TIASLA
Sbjct  83   LLKADLISGLTIASLA  98



>ref|XP_009622161.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana tomentosiformis]
Length=182

 Score = 94.4 bits (233),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K+ +KET FPDDP RQFK QPL +K +LG QY  PIL+W P Y+F+
Sbjct  18   KVAPPPHKTTLQKLKTRLKETFFPDDPLRQFKGQPLKKKLILGAQYVFPILEWGPNYSFK  77

Query  487  SFKADVVAGITIASLA  534
              K+D+V+G+TIASLA
Sbjct  78   LLKSDIVSGLTIASLA  93



>gb|KDO64646.1| hypothetical protein CISIN_1g006141mg [Citrus sinensis]
Length=659

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K   E +K  +KET FPDDP RQFK QPL +K++L  QY  PIL+W P Y+F+ 
Sbjct  32   VVPPPHKSTIEKLKRRLKETFFPDDPLRQFKGQPLGKKWILAAQYIFPILEWGPNYSFKL  91

Query  490  FKADVVAGITIASLA  534
            FK+D+++G+TIASLA
Sbjct  92   FKSDIISGLTIASLA  106



>ref|XP_006448250.1| hypothetical protein CICLE_v10014538mg [Citrus clementina]
 gb|ESR61490.1| hypothetical protein CICLE_v10014538mg [Citrus clementina]
Length=659

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K   E +K  +KET FPDDP RQFK QPL +K++L  QY  PIL+W P Y+F+ 
Sbjct  32   VVPPPHKSTIEKLKRRLKETFFPDDPLRQFKGQPLGKKWILAAQYIFPILEWGPNYSFKL  91

Query  490  FKADVVAGITIASLA  534
            FK+D+++G+TIASLA
Sbjct  92   FKSDIISGLTIASLA  106



>ref|XP_006469182.1| PREDICTED: probable sulfate transporter 3.3-like [Citrus sinensis]
Length=659

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K   E +K  +KET FPDDP RQFK QPL +K++L  QY  PIL+W P Y+F+ 
Sbjct  32   VVPPPHKSTIEKLKRRLKETFFPDDPLRQFKGQPLGKKWILAAQYIFPILEWGPNYSFKL  91

Query  490  FKADVVAGITIASLA  534
            FK+D+++G+TIASLA
Sbjct  92   FKSDIISGLTIASLA  106



>ref|XP_006652928.1| PREDICTED: probable sulfate transporter 3.3-like [Oryza brachyantha]
Length=657

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +     +K+ VKET FPDDPFR FK QPL  K+++ +QY  PILDW P Y+F 
Sbjct  34   KVSPPPAQSTASKMKARVKETFFPDDPFRGFKGQPLRVKWLMAVQYLFPILDWVPSYSFS  93

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  94   LFKSDLVAGLTIASLA  109



>ref|XP_007045150.1| Sulfate transporter 91 [Theobroma cacao]
 gb|EOY00982.1| Sulfate transporter 91 [Theobroma cacao]
Length=652

 Score = 98.6 bits (244),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 43/76 (57%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K     +KS +KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+F+
Sbjct  23   QVVPPPHKSTIHKLKSRLKETFFPDDPLRQFKGQPTRKKWILAAQYIFPILQWGPNYSFK  82

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  83   LFKSDIVAGLTIASLA  98



>ref|XP_006366875.1| PREDICTED: probable sulfate transporter 3.5-like [Solanum tuberosum]
Length=640

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  V+K+ +KETLFPDDPF +FKN+ L ++ + G+QYFVPI  W P+Y F  
Sbjct  10   VNYAPPRSFKTVLKANLKETLFPDDPFHEFKNEKLSKRILKGIQYFVPICQWLPKYKFGL  69

Query  490  FKADVVAGITIASLA  534
            F  D++AGITIASLA
Sbjct  70   FMYDLLAGITIASLA  84



>ref|XP_010943102.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Elaeis 
guineensis]
Length=648

 Score = 98.2 bits (243),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 7/100 (7%)
 Frame = +1

Query  256  ENSMGGNGDYEWQQRR-------GEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPL  414
            E + G +G+ E  Q          +V  PPP+   + +K  +KET FPDDPFR+FK QP 
Sbjct  2    EEAHGADGNVEGTQVEIAVMEAMHKVVPPPPRSSLDKIKVRLKETFFPDDPFRRFKGQPP  61

Query  415  PRKFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             +K++LG QY  PIL W P Y+   FK+D+V+G+TI SLA
Sbjct  62   KKKWILGAQYLFPILGWVPTYSLSLFKSDLVSGLTITSLA  101



>ref|XP_010943103.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Elaeis 
guineensis]
Length=600

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 45/100 (45%), Positives = 62/100 (62%), Gaps = 7/100 (7%)
 Frame = +1

Query  256  ENSMGGNGDYEWQQRR-------GEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPL  414
            E + G +G+ E  Q          +V  PPP+   + +K  +KET FPDDPFR+FK QP 
Sbjct  2    EEAHGADGNVEGTQVEIAVMEAMHKVVPPPPRSSLDKIKVRLKETFFPDDPFRRFKGQPP  61

Query  415  PRKFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASLA  534
             +K++LG QY  PIL W P Y+   FK+D+V+G+TI SLA
Sbjct  62   KKKWILGAQYLFPILGWVPTYSLSLFKSDLVSGLTITSLA  101



>ref|XP_004977057.1| PREDICTED: probable sulfate transporter 3.3-like [Setaria italica]
Length=670

 Score = 97.8 bits (242),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PPP+     +K+ VKET FPDDPFR FK QPL  ++++ ++Y  PILDW P Y+F 
Sbjct  47   KVATPPPQSTASKMKARVKETFFPDDPFRAFKGQPLGTQWLMAVKYLFPILDWVPGYSFS  106

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  107  LFKSDLVSGLTIASLA  122



>ref|XP_011091968.1| PREDICTED: probable sulfate transporter 3.5 [Sesamum indicum]
Length=642

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/71 (59%), Positives = 54/71 (76%), Gaps = 0/71 (0%)
 Frame = +1

Query  322  PPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKAD  501
            PP+ F  V+KS VKETLFPDDPF   KN+PL R+ +  +QYF+PI +W P+Y+   FK D
Sbjct  15   PPRSFGTVLKSKVKETLFPDDPFHLLKNEPLGRRLLKTIQYFIPICEWLPKYSLSFFKYD  74

Query  502  VVAGITIASLA  534
            ++AGITIASLA
Sbjct  75   LLAGITIASLA  85



>ref|XP_002980841.1| hypothetical protein SELMODRAFT_113596 [Selaginella moellendorffii]
 gb|EFJ18026.1| hypothetical protein SELMODRAFT_113596 [Selaginella moellendorffii]
Length=657

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP  P +  +K T+KET FPDDPF QFKNQ   RKFVL + Y  PIL+W P+Y   
Sbjct  33   KVSVPPSTPLHSGIKDTIKETFFPDDPFLQFKNQTKGRKFVLAILYVFPILEWGPKYRLN  92

Query  487  SFKADVVAGITIASL  531
             FK D V+G+TIASL
Sbjct  93   LFKRDFVSGLTIASL  107



>ref|XP_002989364.1| hypothetical protein SELMODRAFT_184503 [Selaginella moellendorffii]
 gb|EFJ09638.1| hypothetical protein SELMODRAFT_184503 [Selaginella moellendorffii]
Length=657

 Score = 97.8 bits (242),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP  P +  +K T+KET FPDDPF QFKNQ   RKFVL + Y  PIL+W P+Y   
Sbjct  33   KVSVPPSTPLHSGIKDTIKETFFPDDPFLQFKNQTKGRKFVLAILYVFPILEWGPKYRLN  92

Query  487  SFKADVVAGITIASL  531
             FK D V+G+TIASL
Sbjct  93   LFKRDFVSGLTIASL  107



>gb|ABK26681.1| unknown [Picea sitchensis]
Length=251

 Score = 94.4 bits (233),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 54/63 (86%), Gaps = 0/63 (0%)
 Frame = +1

Query  346  VKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIA  525
            +++ VKE LFPDDPFR+FKNQP  RK+++G+QY  PIL+W P Y+F+ FK+D+V+GITIA
Sbjct  38   LRNAVKEMLFPDDPFRRFKNQPTTRKWIIGLQYVFPILEWLPTYSFRLFKSDIVSGITIA  97

Query  526  SLA  534
            SLA
Sbjct  98   SLA  100



>ref|XP_009763583.1| PREDICTED: probable sulfate transporter 3.3 [Nicotiana sylvestris]
Length=368

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 42/76 (55%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K+ +KET FPDDP RQFK QPL +K +LG QY  PIL+W P Y+F+
Sbjct  18   KVAPPPHKTTLQKLKTRLKETFFPDDPLRQFKGQPLKKKLILGAQYVFPILEWGPNYSFK  77

Query  487  SFKADVVAGITIASLA  534
              K+D+V+G+TIASLA
Sbjct  78   LLKSDIVSGLTIASLA  93



>gb|KJB50368.1| hypothetical protein B456_008G166800 [Gossypium raimondii]
Length=653

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K   + +K+ +KETLFPDDPFRQFK QP  +K+VL  QY  PIL W P Y  + 
Sbjct  25   VVPPPHKSTIQKLKTRLKETLFPDDPFRQFKGQPTKKKWVLAAQYIFPILHWGPNYNLKL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+V+G+TIASLA
Sbjct  85   FKSDIVSGVTIASLA  99



>emb|CAN77009.1| hypothetical protein VITISV_036877 [Vitis vinifera]
Length=653

 Score = 97.4 bits (241),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+ +KET FPDDP RQFK QP  RK++LG QY  PIL W P Y+ +
Sbjct  5    KVVPPPHRSTFQKFKTRLKETFFPDDPLRQFKGQPPKRKWILGAQYVFPILQWGPNYSLK  64

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  65   LFKSDIVSGLTIASLA  80



>gb|EYU23026.1| hypothetical protein MIMGU_mgv1a002785mg [Erythranthe guttata]
Length=637

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 55/75 (73%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  V+K  +KETLFPDDPFRQ + +PL R+ +  +QYFVP+L+W P Y+F  
Sbjct  12   VNMGPPRSFGTVLKLKLKETLFPDDPFRQIRKEPLGRRSIQTLQYFVPMLEWLPNYSFNL  71

Query  490  FKADVVAGITIASLA  534
            F  D++AGITIASLA
Sbjct  72   FMYDLLAGITIASLA  86



>ref|XP_002280766.1| PREDICTED: probable sulfate transporter 3.3 [Vitis vinifera]
Length=652

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+ +KET FPDDP RQFK QP  RK++LG QY  PIL W P Y+ +
Sbjct  21   KVVPPPHRSTFQKFKTRLKETFFPDDPLRQFKGQPPKRKWILGAQYVFPILQWGPNYSLK  80

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  81   LFKSDIVSGLTIASLA  96



>gb|ABR16213.1| unknown [Picea sitchensis]
Length=680

 Score = 97.1 bits (240),  Expect = 6e-20, Method: Composition-based stats.
 Identities = 44/76 (58%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  P  K       S VKETLFPDDPFR+FK +P  RK  LG +YF PIL+WAP Y+  
Sbjct  56   KVGIPESKGLVHQFNSQVKETLFPDDPFREFKGKPFGRKLWLGFRYFFPILEWAPNYSLN  115

Query  487  SFKADVVAGITIASLA  534
             FK+DV++GITIASLA
Sbjct  116  LFKSDVISGITIASLA  131



>ref|XP_002281248.1| PREDICTED: probable sulfate transporter 3.5 [Vitis vinifera]
 emb|CBI28094.3| unnamed protein product [Vitis vinifera]
Length=648

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/70 (60%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  325  PKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADV  504
            P+ F    +S +KET FPDDPFRQF+N+P  R+    +QYFVPI +W P+YTF  FK DV
Sbjct  16   PRSFANKFRSHLKETFFPDDPFRQFRNEPPLRRTKKALQYFVPIFEWLPKYTFSMFKYDV  75

Query  505  VAGITIASLA  534
            +AGITIASLA
Sbjct  76   LAGITIASLA  85



>ref|XP_004252053.1| PREDICTED: probable sulfate transporter 3.5 [Solanum lycopersicum]
Length=640

 Score = 97.1 bits (240),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  V+K+ VKETLFPDDPF  FKN+ L ++ + G+QYF+PI  W P+Y F  
Sbjct  10   VNYAPPRSFKTVLKANVKETLFPDDPFYDFKNEKLSKRILKGIQYFIPICQWLPKYKFGL  69

Query  490  FKADVVAGITIASLA  534
            F  D++AGITIASLA
Sbjct  70   FMYDLLAGITIASLA  84



>emb|CBI26897.3| unnamed protein product [Vitis vinifera]
Length=636

 Score = 96.7 bits (239),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+ +KET FPDDP RQFK QP  RK++LG QY  PIL W P Y+ +
Sbjct  5    KVVPPPHRSTFQKFKTRLKETFFPDDPLRQFKGQPPKRKWILGAQYVFPILQWGPNYSLK  64

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  65   LFKSDIVSGLTIASLA  80



>gb|KHG23018.1| putative sulfate transporter 3.3 -like protein [Gossypium arboreum]
Length=629

 Score = 96.7 bits (239),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 43/75 (57%), Positives = 54/75 (72%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K   + +K+ +KETLFPDDPFRQFK QP  +K+VL  QY  PIL W P Y  + 
Sbjct  25   VVPPPHKSTIQKLKTRLKETLFPDDPFRQFKGQPTKKKWVLASQYIFPILHWGPNYNLKL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+V+G+TIASLA
Sbjct  85   FKSDIVSGVTIASLA  99



>gb|ACQ77597.1| sulfate transporter [Dimocarpus longan]
Length=256

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++ +K+ +KET FPDDP RQFK QPL  K +LG QY  PIL+W P Y+ +
Sbjct  33   KVVPPPRRSTFQKLKTRLKETFFPDDPLRQFKGQPLKNKLILGAQYIFPILEWGPNYSLK  92

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  93   LFKSDIVSGLTIASLA  108



>ref|XP_002448662.1| hypothetical protein SORBIDRAFT_06g030980 [Sorghum bicolor]
 gb|EES12990.1| hypothetical protein SORBIDRAFT_06g030980 [Sorghum bicolor]
Length=671

 Score = 96.3 bits (238),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +     +K+ VKET FPDDPFR FK QPL  ++++ ++Y  PILDW P Y+F 
Sbjct  48   KVAPPPARSTASKMKARVKETFFPDDPFRAFKGQPLGLQWLMAVRYLFPILDWMPSYSFS  107

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  108  LFKSDLVAGLTIASLA  123



>ref|XP_004238829.1| PREDICTED: probable sulfate transporter 3.3 [Solanum lycopersicum]
Length=645

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V +PP +     +K+ +KET FPDDP RQFK Q + +K +LG QYF PIL+W P Y F 
Sbjct  18   KVVSPPHRSTLLKLKNRLKETFFPDDPLRQFKGQTIKKKLILGAQYFFPILEWCPNYRFH  77

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  78   MFKSDIISGLTIASLA  93



>ref|XP_006355098.1| PREDICTED: probable sulfate transporter 3.3-like [Solanum tuberosum]
Length=645

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V +PP +     +K+ +KET FPDDP RQFK Q + +K +LG QYF PIL+W P Y F 
Sbjct  18   KVVSPPHRSTLLKLKNRLKETFFPDDPLRQFKGQTMKQKLILGAQYFFPILEWCPNYGFN  77

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  78   MFKSDIVSGLTIASLA  93



>ref|XP_006826848.1| hypothetical protein AMTR_s00010p00108760 [Amborella trichopoda]
 gb|ERM94085.1| hypothetical protein AMTR_s00010p00108760 [Amborella trichopoda]
Length=628

 Score = 95.9 bits (237),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V AP PK F    +  VKE  FPDDPFRQFK QP   K++L  QY  PIL W P Y+F+
Sbjct  5    KVMAPQPKTFLLEFRDRVKEIFFPDDPFRQFKGQPTRMKWLLTTQYVFPILQWGPTYSFK  64

Query  487  SFKADVVAGITIASLA  534
             FK+D+++G+TIASLA
Sbjct  65   LFKSDIISGLTIASLA  80



>ref|XP_002991793.1| hypothetical protein SELMODRAFT_134130 [Selaginella moellendorffii]
 gb|EFJ07197.1| hypothetical protein SELMODRAFT_134130 [Selaginella moellendorffii]
Length=677

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V+ PP K   +   +T KETLFPDDPFR F+N+P  R+ ++ MQYF PILDW P+Y    
Sbjct  32   VQRPPAKSLLQTFSTTSKETLFPDDPFRHFRNKPSHRQAIMLMQYFFPILDWLPKYKLGF  91

Query  490  FKADVVAGITIASLA  534
             K D +AGIT ASL+
Sbjct  92   LKNDFIAGITTASLS  106



>ref|XP_002989687.1| hypothetical protein SELMODRAFT_184750 [Selaginella moellendorffii]
 gb|EFJ09164.1| hypothetical protein SELMODRAFT_184750 [Selaginella moellendorffii]
Length=677

 Score = 95.5 bits (236),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V+ PP K   +   +T KETLFPDDPFR F+N+P  R+ ++ MQYF PILDW P+Y    
Sbjct  32   VQRPPAKSLLQTFSTTSKETLFPDDPFRHFRNKPSHRQAIMLMQYFFPILDWLPKYKLGF  91

Query  490  FKADVVAGITIASLA  534
             K D +AGIT ASL+
Sbjct  92   LKNDFIAGITTASLS  106



>gb|KJB15437.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=554

 Score = 95.1 bits (235),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+   
Sbjct  25   VVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQWGPHYSLGL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+VAG+TIASLA
Sbjct  85   FKSDIVAGLTIASLA  99



>ref|XP_009760537.1| PREDICTED: probable sulfate transporter 3.5 [Nicotiana sylvestris]
Length=641

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V   PP+ F  V+K+ +KETLFPDDPF +FKN+ L  +   G+QYFVPI  W P+Y    
Sbjct  11   VNYAPPRSFGTVLKANLKETLFPDDPFHEFKNEKLSIRIQKGIQYFVPIFQWLPKYNLGL  70

Query  490  FKADVVAGITIASLA  534
            FK D++AGITIASLA
Sbjct  71   FKFDLLAGITIASLA  85



>gb|KJB15438.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=645

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+   
Sbjct  25   VVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQWGPHYSLGL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+VAG+TIASLA
Sbjct  85   FKSDIVAGLTIASLA  99



>gb|KJB15435.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=652

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+   
Sbjct  25   VVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQWGPHYSLGL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+VAG+TIASLA
Sbjct  85   FKSDIVAGLTIASLA  99



>gb|KJB15439.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=649

 Score = 95.1 bits (235),  Expect = 3e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+   
Sbjct  25   VVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQWGPHYSLGL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+VAG+TIASLA
Sbjct  85   FKSDIVAGLTIASLA  99



>gb|KJB15440.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=590

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W P Y+   
Sbjct  25   VVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQWGPHYSLGL  84

Query  490  FKADVVAGITIASLA  534
            FK+D+VAG+TIASLA
Sbjct  85   FKSDIVAGLTIASLA  99



>ref|XP_011023507.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
 ref|XP_011008182.1| PREDICTED: probable sulfate transporter 3.3 [Populus euphratica]
Length=652

 Score = 94.7 bits (234),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS +KET FPDDP  QFK QPL +K++L  QY  PIL W P Y+F+
Sbjct  24   KVVRPPHRSTIQKLKSRLKETFFPDDPLLQFKRQPLGKKWILAAQYVFPILQWGPNYSFK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>gb|ABK35746.2| sulfate transporter [Populus tremula x Populus alba]
Length=652

 Score = 94.4 bits (233),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS +KET FPDDP  QFK QPL +K++L  QY  PIL W P Y+F+
Sbjct  24   KVVPPPHRSTIQKLKSKLKETFFPDDPLLQFKRQPLGKKWILAAQYVFPILQWGPNYSFK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_003580696.2| PREDICTED: LOW QUALITY PROTEIN: probable sulfate transporter 
3.3 [Brachypodium distachyon]
Length=654

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V A P +     +K  VKET FPDDPFR FK QPL  K+++ ++Y  PIL+W P Y+F 
Sbjct  31   KVAAQPAQSTASKMKEKVKETFFPDDPFRSFKGQPLSAKWLMAVKYLFPILEWVPGYSFS  90

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  91   LFKSDLVAGLTIASLA  106



>ref|XP_002968282.1| hypothetical protein SELMODRAFT_169988 [Selaginella moellendorffii]
 gb|EFJ30536.1| hypothetical protein SELMODRAFT_169988 [Selaginella moellendorffii]
Length=646

 Score = 94.4 bits (233),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 43/87 (49%), Positives = 55/87 (63%), Gaps = 0/87 (0%)
 Frame = +1

Query  274  NGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVP  453
            NG+     +  EV  PP K        TVKET FPDDPFRQF++Q    KFVL M+Y  P
Sbjct  7    NGEAYNGHKVMEVLRPPYKSSASAFGDTVKETFFPDDPFRQFRHQTAATKFVLAMRYMFP  66

Query  454  ILDWAPRYTFQSFKADVVAGITIASLA  534
            +LDW  +Y F   +AD+V+G+TIASL+
Sbjct  67   VLDWGAKYKFADLRADLVSGLTIASLS  93



>ref|XP_002976095.1| hypothetical protein SELMODRAFT_175286 [Selaginella moellendorffii]
 gb|EFJ23000.1| hypothetical protein SELMODRAFT_175286 [Selaginella moellendorffii]
Length=630

 Score = 94.0 bits (232),  Expect = 7e-19, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 51/76 (67%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            EV  PP K        TVKET FPDDPFRQF++Q    KFVL M+Y  P+LDW  +Y F 
Sbjct  2    EVLRPPYKSSASAFGDTVKETFFPDDPFRQFRHQTAATKFVLAMRYMFPVLDWGAKYKFA  61

Query  487  SFKADVVAGITIASLA  534
              +AD+V+G+TIASL+
Sbjct  62   DLRADLVSGLTIASLS  77



>ref|XP_008444099.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
 ref|XP_008444100.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
 ref|XP_008444102.1| PREDICTED: sulfate transporter 1.3-like [Cucumis melo]
Length=661

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  Y+ +KS VKET FPDDP R FK+Q   RKF+LG+Q   PILDW   Y   
Sbjct  37   KVGVPPKQKLYKEIKSAVKETFFPDDPLRSFKDQTKKRKFILGIQAVFPILDWGRTYNLT  96

Query  487  SFKADVVAGITIASL  531
             F+ DV++G+TIASL
Sbjct  97   KFRGDVISGLTIASL  111



>ref|XP_004150525.1| PREDICTED: sulfate transporter 1.3-like [Cucumis sativus]
 ref|XP_004166671.1| PREDICTED: sulfate transporter 1.3-like [Cucumis sativus]
 gb|KGN54619.1| hypothetical protein Csa_4G379280 [Cucumis sativus]
Length=661

 Score = 94.0 bits (232),  Expect = 8e-19, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  Y+ +KS VKET FPDDP R FK+Q   RKF+LG+Q   PILDW   Y   
Sbjct  37   KVGVPPKQKLYKEIKSAVKETFFPDDPLRSFKDQTKKRKFILGIQAVFPILDWGRNYNLT  96

Query  487  SFKADVVAGITIASL  531
             F+ DV++G+TIASL
Sbjct  97   KFRGDVISGLTIASL  111



>gb|KDP32302.1| hypothetical protein JCGZ_13227 [Jatropha curcas]
Length=645

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 42/76 (55%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  P P+ F    KS  KET FPDDPFRQF+N+    KF   +QYFVPI +W P Y  +
Sbjct  12   QVNFPTPRSFGATFKSHCKETFFPDDPFRQFRNEKSFDKFKKAVQYFVPIYEWLPNYNLR  71

Query  487  SFKADVVAGITIASLA  534
            +FK D++AGITIASLA
Sbjct  72   TFKFDLLAGITIASLA  87



>ref|XP_008780888.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
 ref|XP_008780889.1| PREDICTED: sulfate transporter 1.2-like [Phoenix dactylifera]
Length=658

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/86 (48%), Positives = 56/86 (65%), Gaps = 0/86 (0%)
 Frame = +1

Query  274  NGDYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVP  453
            +G  E  Q   +V  PP + F+   K T+KETLF DDP R++K+QP  RK +LG+Q+  P
Sbjct  23   HGQMENLQSVHKVGFPPQRNFFREFKDTLKETLFADDPLRRYKDQPRSRKLILGLQFLFP  82

Query  454  ILDWAPRYTFQSFKADVVAGITIASL  531
            IL+W   Y F   K D++AG+TIASL
Sbjct  83   ILEWGRDYNFSKLKGDLIAGLTIASL  108



>ref|XP_008339548.1| PREDICTED: probable sulfate transporter 3.3 [Malus domestica]
Length=679

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP +  +  + + +KET FPDDP  QFK QP  +K++LG QY  PIL+W P Y+F+
Sbjct  48   KVVAPPYRSTFHKLLAKLKETFFPDDPLYQFKGQPPKKKWILGAQYVFPILEWGPNYSFK  107

Query  487  SFKADVVAGITIASLA  534
              K+D+V+G+TIASLA
Sbjct  108  LLKSDIVSGVTIASLA  123



>ref|XP_002312444.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
 gb|EEE89811.2| sulfate transporter 3.3 family protein [Populus trichocarpa]
Length=650

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS +KET FPDDP  QFK QPL  K++L  QY  PIL W P Y+F+
Sbjct  24   KVVPPPHRSTIQKLKSRLKETFFPDDPLLQFKRQPLGTKWILAAQYVFPILQWGPNYSFK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_006379763.1| hypothetical protein POPTR_0008s12940g [Populus trichocarpa]
 gb|ERP57560.1| hypothetical protein POPTR_0008s12940g [Populus trichocarpa]
Length=652

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 41/76 (54%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   + +KS +KET FPDDP  QFK QPL  K++L  QY  PIL W P Y+F+
Sbjct  24   KVVPPPHRSTIQKLKSRLKETFFPDDPLLQFKRQPLGTKWILAAQYVFPILQWGPNYSFK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_004297375.2| PREDICTED: probable sulfate transporter 3.3 [Fragaria vesca subsp. 
vesca]
Length=681

 Score = 93.6 bits (231),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 56/76 (74%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++ +K+ +KE LFPDDP  QFK Q   +K++LG QY  PIL+W P Y+F+
Sbjct  33   KVVLPPYRSTFQKLKAKLKEILFPDDPLHQFKGQTSKQKWILGAQYVFPILEWGPSYSFK  92

Query  487  SFKADVVAGITIASLA  534
             FK+D+VAG+TIASLA
Sbjct  93   LFKSDIVAGLTIASLA  108



>ref|XP_009351474.1| PREDICTED: probable sulfate transporter 3.3 [Pyrus x bretschneideri]
Length=679

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 38/76 (50%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V APP +  +  + + +KET FPDDP  QFK QP  +K++LG QY  PIL+W P Y+F+
Sbjct  48   KVVAPPYRSTFRKLLAKLKETFFPDDPLYQFKGQPPKKKWILGAQYVFPILEWGPNYSFK  107

Query  487  SFKADVVAGITIASLA  534
              K+D+++G+TIASLA
Sbjct  108  LLKSDIISGVTIASLA  123



>ref|XP_004505280.1| PREDICTED: probable sulfate transporter 3.3-like isoform X2 [Cicer 
arietinum]
Length=628

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K  +KET FPDDP RQFK Q    K +LG +Y  PIL W P Y+F+
Sbjct  21   QVVPPPHKSTLQKLKVRLKETFFPDDPLRQFKGQTFKIKLILGAKYMFPILQWGPNYSFK  80

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  81   LFKSDLVSGLTIASLA  96



>gb|KJB15436.1| hypothetical protein B456_002G178600 [Gossypium raimondii]
Length=500

 Score = 92.0 bits (227),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 43/83 (52%), Positives = 53/83 (64%), Gaps = 0/83 (0%)
 Frame = +1

Query  286  EWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDW  465
            E       V  PP K     +K+T+KET FPDDP RQFK QP  +K++L  QY  PIL W
Sbjct  17   EITMEVHRVVPPPHKSTIHKLKTTLKETFFPDDPLRQFKGQPTGKKWILAAQYIFPILQW  76

Query  466  APRYTFQSFKADVVAGITIASLA  534
             P Y+   FK+D+VAG+TIASLA
Sbjct  77   GPHYSLGLFKSDIVAGLTIASLA  99



>ref|XP_009392358.1| PREDICTED: sulfate transporter 3.1-like [Musa acuminata subsp. 
malaccensis]
Length=660

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 36/67 (54%), Positives = 52/67 (78%), Gaps = 0/67 (0%)
 Frame = +1

Query  334  FYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADVVAG  513
            F + +++ +KETLFPDDPF+QFKN+   R+F++G++YF P+  WAPRY     ++D+VAG
Sbjct  33   FLDTLRANLKETLFPDDPFQQFKNETGSRRFLVGLKYFFPVFQWAPRYNLSLLRSDLVAG  92

Query  514  ITIASLA  534
             TIASLA
Sbjct  93   FTIASLA  99



>ref|XP_004505279.1| PREDICTED: probable sulfate transporter 3.3-like isoform X1 [Cicer 
arietinum]
Length=657

 Score = 92.8 bits (229),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   + +K  +KET FPDDP RQFK Q    K +LG +Y  PIL W P Y+F+
Sbjct  21   QVVPPPHKSTLQKLKVRLKETFFPDDPLRQFKGQTFKIKLILGAKYMFPILQWGPNYSFK  80

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  81   LFKSDLVSGLTIASLA  96



>gb|KEH30847.1| sulfate/bicarbonate/oxalate exchanger and transporter sat-1 [Medicago 
truncatula]
Length=654

 Score = 92.4 bits (228),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP K   +  K  +KET FPDDP RQFK Q L ++ +LG +YF PIL W   Y+F+
Sbjct  19   QVVPPPHKSTLQKFKVRLKETFFPDDPLRQFKGQTLQKRLILGAKYFFPILQWGSIYSFK  78

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  79   LFKSDLVSGLTIASLA  94



>emb|CAA65536.1| sulphate transporter protein [Sporobolus stapfianus]
Length=660

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 40/76 (53%), Positives = 55/76 (72%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PPP+     +K+ +KETLFPDDPFR F+ QP   ++VL ++Y  PILDW P Y+  
Sbjct  37   KVVPPPPQSTASKLKTRLKETLFPDDPFRGFQGQPARVQWVLAVKYLFPILDWLPAYSLS  96

Query  487  SFKADVVAGITIASLA  534
             FK+D++AG+TIASLA
Sbjct  97   LFKSDLIAGLTIASLA  112



>gb|ABK35748.1| sulfate transporter, partial [Populus tremula x Populus alba]
Length=620

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = +1

Query  346  VKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIA  525
            +KS +KET FPDDP RQFK QPL +K++L  QY  PIL W P Y+F  FK+D+V+G+TIA
Sbjct  5    LKSRLKETFFPDDPLRQFKGQPLGKKWILAAQYSFPILQWGPNYSFNLFKSDIVSGLTIA  64

Query  526  SLA  534
            SLA
Sbjct  65   SLA  67



>ref|XP_004165559.1| PREDICTED: LOW QUALITY PROTEIN: probable sulfate transporter 
3.3-like [Cucumis sativus]
Length=664

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP + + E +++ +KE  FPDDP RQFK Q   RK VLG QY  PIL+W   Y F  
Sbjct  36   VVPPPRRSWLEKIRNRLKEIFFPDDPLRQFKGQSPVRKLVLGAQYIFPILEWGSHYNFPX  95

Query  490  FKADVVAGITIASLA  534
            FK+DVVAG+TIASLA
Sbjct  96   FKSDVVAGLTIASLA  110



>ref|XP_004140467.1| PREDICTED: probable sulfate transporter 3.3-like [Cucumis sativus]
 gb|KGN50848.1| Sulfate transporter [Cucumis sativus]
Length=664

 Score = 92.4 bits (228),  Expect = 3e-18, Method: Composition-based stats.
 Identities = 42/75 (56%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP + + E +++ +KE  FPDDP RQFK Q   RK VLG QY  PIL+W   Y F  
Sbjct  36   VVPPPRRSWLEKIRNRLKEIFFPDDPLRQFKGQSPVRKLVLGAQYIFPILEWGSHYNFSL  95

Query  490  FKADVVAGITIASLA  534
            FK+DVVAG+TIASLA
Sbjct  96   FKSDVVAGLTIASLA  110



>gb|ABK24712.1| unknown [Picea sitchensis]
Length=491

 Score = 91.7 bits (226),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 53/76 (70%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  P PK       S +KET FPDDPFRQF+ QP  R+++LG  Y  PIL+WAP Y+  
Sbjct  61   KVGIPEPKSVAREFSSKMKETFFPDDPFRQFRGQPCGRQWMLGFMYLFPILEWAPNYSLA  120

Query  487  SFKADVVAGITIASLA  534
             FK+DV++G+TIASLA
Sbjct  121  VFKSDVISGLTIASLA  136



>gb|KDP32700.1| hypothetical protein JCGZ_11992 [Jatropha curcas]
Length=636

 Score = 92.0 bits (227),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 41/85 (48%), Positives = 58/85 (68%), Gaps = 0/85 (0%)
 Frame = +1

Query  280  DYEWQQRRGEVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPIL  459
            D   +Q   +V  PP +  ++ +K+TVKETLF DDP R FK+QP  +KF+LG+Q   PIL
Sbjct  2    DVRNEQYTHKVGVPPKQNLFKELKATVKETLFADDPLRPFKDQPRSKKFILGIQTIFPIL  61

Query  460  DWAPRYTFQSFKADVVAGITIASLA  534
            +W   Y+ + F+ DV+AG+TIASL 
Sbjct  62   EWGRSYSLRKFRGDVIAGLTIASLC  86



>ref|XP_010688172.1| PREDICTED: probable sulfate transporter 3.5 [Beta vulgaris subsp. 
vulgaris]
Length=641

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/70 (54%), Positives = 52/70 (74%), Gaps = 0/70 (0%)
 Frame = +1

Query  325  PKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADV  504
            P+ F E  KS++KET FPDDPF  F ++P  ++ + G+QYFVPI +W P+Y+F  F+ D 
Sbjct  17   PRSFCEKFKSSLKETFFPDDPFSGFSSEPPKKRLIKGVQYFVPIFEWLPKYSFSLFRYDF  76

Query  505  VAGITIASLA  534
            +AGITIASLA
Sbjct  77   LAGITIASLA  86



>ref|XP_009758428.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana sylvestris]
 ref|XP_009758436.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana sylvestris]
 ref|XP_009758441.1| PREDICTED: sulfate transporter 1.3-like [Nicotiana sylvestris]
Length=656

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++ +K+TVKET F DDP R FK+QP  RKFVLG+Q   PIL+W   Y F 
Sbjct  32   KVGVPPKQDIFKELKTTVKETFFADDPLRCFKDQPRSRKFVLGLQAIFPILEWGRSYNFA  91

Query  487  SFKADVVAGITIASL  531
             F+ D++AG+TIASL
Sbjct  92   KFRGDLIAGLTIASL  106



>ref|XP_010088531.1| putative sulfate transporter 3.3 [Morus notabilis]
 gb|EXB36448.1| putative sulfate transporter 3.3 [Morus notabilis]
Length=681

 Score = 92.0 bits (227),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 38/61 (62%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = +1

Query  352  STVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADVVAGITIASL  531
            + +KET FPDDP RQFK QP+ +K++LG QY  PIL WAP+Y+ + FK+DVV+G+TIASL
Sbjct  41   AKLKETFFPDDPLRQFKGQPIKKKWILGAQYVFPILQWAPQYSLKLFKSDVVSGLTIASL  100

Query  532  A  534
            A
Sbjct  101  A  101



>ref|XP_010254170.1| PREDICTED: probable sulfate transporter 3.5 isoform X1 [Nelumbo 
nucifera]
Length=635

 Score = 91.7 bits (226),  Expect = 4e-18, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  325  PKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADV  504
            P+ F    KS +KET FPDDPFRQFKN+P  RK     QYF P+ +W P+Y F+ F+ D+
Sbjct  16   PRNFTTSFKSDLKETFFPDDPFRQFKNEPPLRKAKKAAQYFFPVFEWLPKYNFRLFRYDL  75

Query  505  VAGITIASLA  534
            ++GITIASLA
Sbjct  76   LSGITIASLA  85



>ref|XP_011074140.1| PREDICTED: sulfate transporter 1.3 [Sesamum indicum]
 ref|XP_011074141.1| PREDICTED: sulfate transporter 1.3 [Sesamum indicum]
Length=654

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP + F+    + VKET FPDDP R FK+Q   R+FVLGMQ   PI +W  RY F 
Sbjct  30   KVGVPPKQKFWTEFAAAVKETFFPDDPLRSFKDQSRSRQFVLGMQAAFPIFEWGRRYNFD  89

Query  487  SFKADVVAGITIASL  531
             FK D++AG+TIASL
Sbjct  90   KFKGDLIAGLTIASL  104



>ref|XP_010044185.1| PREDICTED: probable sulfate transporter 3.3 isoform X1 [Eucalyptus 
grandis]
 gb|KCW86221.1| hypothetical protein EUGRSUZ_B02908 [Eucalyptus grandis]
Length=659

 Score = 91.7 bits (226),  Expect = 5e-18, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +   + + S +KET FPDDP RQFK QP  R+ +L  QY  PIL W P Y+ + 
Sbjct  32   VVVPPARTMAQKLGSRLKETFFPDDPLRQFKGQPARRRRILAAQYVFPILQWGPNYSLKL  91

Query  490  FKADVVAGITIASLA  534
            FK+DV++G+TIASLA
Sbjct  92   FKSDVISGLTIASLA  106



>ref|XP_008454781.1| PREDICTED: probable sulfate transporter 3.3 [Cucumis melo]
Length=661

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 41/75 (55%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP + + E +++ +KE  FPDDP RQFK Q   RK+V+G QY  PIL+W   Y F  
Sbjct  33   VVPPPRRSWLEKMRNRLKEIFFPDDPLRQFKGQSPARKWVIGAQYIFPILEWGSHYNFAL  92

Query  490  FKADVVAGITIASLA  534
            FK+DVVAG+TIASLA
Sbjct  93   FKSDVVAGLTIASLA  107



>ref|XP_010044186.1| PREDICTED: probable sulfate transporter 3.3 isoform X2 [Eucalyptus 
grandis]
Length=637

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 51/75 (68%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V  PP +   + + S +KET FPDDP RQFK QP  R+ +L  QY  PIL W P Y+ + 
Sbjct  32   VVVPPARTMAQKLGSRLKETFFPDDPLRQFKGQPARRRRILAAQYVFPILQWGPNYSLKL  91

Query  490  FKADVVAGITIASLA  534
            FK+DV++G+TIASLA
Sbjct  92   FKSDVISGLTIASLA  106



>gb|AGT40333.1| sulfate transporter [Nicotiana attenuata]
Length=656

 Score = 91.3 bits (225),  Expect = 6e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKET F DDP R FK+QP  RKFVLG+Q   PIL+W   Y F 
Sbjct  32   KVGVPPKQDIFKEFKTTVKETFFADDPLRCFKDQPRSRKFVLGLQAIFPILEWGRSYNFA  91

Query  487  SFKADVVAGITIASL  531
             F+ D++AG+TIASL
Sbjct  92   KFRGDLIAGLTIASL  106



>ref|XP_004237882.1| PREDICTED: sulfate transporter 1.3 [Solanum lycopersicum]
Length=654

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKETLF DDP R FK+QP  RKF+LG+Q   PIL+W   Y   
Sbjct  29   KVGLPPKQNLFDEFKTTVKETLFSDDPLRPFKDQPRSRKFILGLQAVFPILEWGKSYNVS  88

Query  487  SFKADVVAGITIASL  531
             F+ DV+AG+TIASL
Sbjct  89   KFRGDVIAGLTIASL  103



>ref|XP_010254171.1| PREDICTED: probable sulfate transporter 3.5 isoform X2 [Nelumbo 
nucifera]
Length=595

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  325  PKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADV  504
            P+ F    KS +KET FPDDPFRQFKN+P  RK     QYF P+ +W P+Y F+ F+ D+
Sbjct  16   PRNFTTSFKSDLKETFFPDDPFRQFKNEPPLRKAKKAAQYFFPVFEWLPKYNFRLFRYDL  75

Query  505  VAGITIASLA  534
            ++GITIASLA
Sbjct  76   LSGITIASLA  85



>gb|ACN39795.1| unknown [Picea sitchensis]
Length=666

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 41/74 (55%), Positives = 50/74 (68%), Gaps = 0/74 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V APP        K  +KETLFPDDPFRQFK+QP P+K  LG++   PIL+W   YT   
Sbjct  44   VGAPPRLKLINEFKIAIKETLFPDDPFRQFKDQPRPQKIRLGVEGMFPILEWGRTYTLSK  103

Query  490  FKADVVAGITIASL  531
            FK D++AG+TIASL
Sbjct  104  FKGDLIAGLTIASL  117



>ref|XP_010254173.1| PREDICTED: probable sulfate transporter 3.5 isoform X3 [Nelumbo 
nucifera]
Length=569

 Score = 90.9 bits (224),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 39/70 (56%), Positives = 50/70 (71%), Gaps = 0/70 (0%)
 Frame = +1

Query  325  PKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQSFKADV  504
            P+ F    KS +KET FPDDPFRQFKN+P  RK     QYF P+ +W P+Y F+ F+ D+
Sbjct  16   PRNFTTSFKSDLKETFFPDDPFRQFKNEPPLRKAKKAAQYFFPVFEWLPKYNFRLFRYDL  75

Query  505  VAGITIASLA  534
            ++GITIASLA
Sbjct  76   LSGITIASLA  85



>ref|XP_006354018.1| PREDICTED: sulfate transporter 1.3-like [Solanum tuberosum]
Length=657

 Score = 91.3 bits (225),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 41/76 (54%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKETLF DDP R FK+QP  RKF+LG+Q   PILDW   Y   
Sbjct  32   KVGVPPKQNLFDEFKTTVKETLFSDDPLRPFKDQPRSRKFILGLQAVFPILDWGKSYNVS  91

Query  487  SFKADVVAGITIASLA  534
             F+ DV+AG+TIASL 
Sbjct  92   KFRGDVIAGLTIASLC  107



>ref|XP_002526028.1| sulfate transporter, putative [Ricinus communis]
 gb|EEF36368.1| sulfate transporter, putative [Ricinus communis]
Length=652

 Score = 90.9 bits (224),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 39/76 (51%), Positives = 52/76 (68%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +   +   + +KET FPDDP RQFK QPL +K++L  QY  PIL W P Y  +
Sbjct  24   KVVLPPHRSTIQKFTTRLKETFFPDDPLRQFKGQPLGKKWILAAQYVFPILQWGPSYNLK  83

Query  487  SFKADVVAGITIASLA  534
             FK+D+V+G+TIASLA
Sbjct  84   LFKSDIVSGLTIASLA  99



>ref|XP_009595009.1| PREDICTED: probable sulfate transporter 3.5 [Nicotiana tomentosiformis]
Length=641

 Score = 90.9 bits (224),  Expect = 9e-18, Method: Composition-based stats.
 Identities = 40/75 (53%), Positives = 52/75 (69%), Gaps = 0/75 (0%)
 Frame = +1

Query  310  VEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQS  489
            V    P+ F  V+K+ +KETLFPDDPF +FKN+ L  +   G+QYFVP+  W P+Y    
Sbjct  11   VNYASPRSFGTVLKANLKETLFPDDPFHEFKNEKLSIRIQKGIQYFVPMFQWLPKYNLGL  70

Query  490  FKADVVAGITIASLA  534
            FK D++AGITIASLA
Sbjct  71   FKFDLLAGITIASLA  85



>ref|XP_011015979.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015980.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015981.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015982.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011015983.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
Length=659

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKET F DDP R FK+QP  +KF+LG+Q   PIL+W   Y+F 
Sbjct  33   KVGLPPKQNLFKEFKATVKETFFADDPLRSFKDQPRSKKFILGLQAIFPILEWGRSYSFA  92

Query  487  SFKADVVAGITIASL  531
             F+ D++AG+TIASL
Sbjct  93   KFRGDLIAGLTIASL  107



>ref|XP_011006147.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011006149.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
 ref|XP_011006150.1| PREDICTED: sulfate transporter 1.2-like [Populus euphratica]
Length=659

 Score = 90.9 bits (224),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKET F DDP R FK+QP  +KF+LG+Q   PIL+W   Y+F 
Sbjct  33   KVGLPPKQNLFKEFKATVKETFFADDPLRSFKDQPRSKKFILGLQAIFPILEWGRSYSFA  92

Query  487  SFKADVVAGITIASL  531
             F+ D++AG+TIASL
Sbjct  93   KFRGDLIAGLTIASL  107



>ref|XP_002307394.1| high affinity sulfate transporter family protein [Populus trichocarpa]
 gb|EEE94390.1| high affinity sulfate transporter family protein [Populus trichocarpa]
Length=647

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 38/75 (51%), Positives = 53/75 (71%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  ++  K+TVKET F DDP R FK+QP  +KF+LG+Q   PIL+W   Y+F 
Sbjct  21   KVGLPPKQNLFKEFKATVKETFFADDPLRSFKDQPRSKKFILGLQAIFPILEWGRSYSFA  80

Query  487  SFKADVVAGITIASL  531
             F+ D++AG+TIASL
Sbjct  81   KFRGDLIAGLTIASL  95



>ref|XP_009339687.1| PREDICTED: probable sulfate transporter 3.3 [Pyrus x bretschneideri]
Length=668

 Score = 90.5 bits (223),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 37/76 (49%), Positives = 54/76 (71%), Gaps = 0/76 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  PP +  +  + + +KET FPDDP  QFK QP  +K++LG QY  PIL+W P Y+F+
Sbjct  29   KVVPPPYRSTFRKLLARLKETFFPDDPLYQFKGQPPKKKWILGAQYVFPILEWGPNYSFK  88

Query  487  SFKADVVAGITIASLA  534
              K+D+++G+TIASLA
Sbjct  89   LLKSDIISGVTIASLA  104



>ref|XP_006287241.1| hypothetical protein CARUB_v10000428mg [Capsella rubella]
 gb|EOA20139.1| hypothetical protein CARUB_v10000428mg [Capsella rubella]
Length=647

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/77 (51%), Positives = 56/77 (73%), Gaps = 1/77 (1%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQP-LPRKFVLGMQYFVPILDWAPRYTF  483
            +VE PPP+PF + +K+T+ E LF DDPFR+ +N+P   +K  LG+++  PIL+WA  Y  
Sbjct  12   KVETPPPQPFLKSLKNTLNEILFADDPFREIRNEPKTSKKIELGLRHVFPILEWARGYNL  71

Query  484  QSFKADVVAGITIASLA  534
               K+DV++GITIASLA
Sbjct  72   GYLKSDVISGITIASLA  88



>ref|XP_010261543.1| PREDICTED: sulfate transporter 1.2-like [Nelumbo nucifera]
Length=649

 Score = 90.1 bits (222),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 39/75 (52%), Positives = 50/75 (67%), Gaps = 0/75 (0%)
 Frame = +1

Query  307  EVEAPPPKPFYEVVKSTVKETLFPDDPFRQFKNQPLPRKFVLGMQYFVPILDWAPRYTFQ  486
            +V  P P+   +  K TVKETLFPDDP R FK+QP  RK +LG+Q   PI +W   Y+  
Sbjct  22   KVGVPSPQNLLKDFKETVKETLFPDDPLRPFKDQPRSRKLILGLQAIFPIFEWGRDYSLA  81

Query  487  SFKADVVAGITIASL  531
             FK D++AG+TIASL
Sbjct  82   KFKGDLIAGLTIASL  96



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553975666000