BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020H06 319 bp,:mask_remained

Length=284
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_002519752.1|  60S ribosomal protein L32, putative                197   2e-62   Ricinus communis
ref|XP_010547142.1|  PREDICTED: 60S ribosomal protein L32-1-like        195   1e-61   Tarenaya hassleriana [spider flower]
ref|XP_010095157.1|  60S ribosomal protein L32-1                        195   1e-61   Morus notabilis
emb|CDP03942.1|  unnamed protein product                                195   1e-61   Coffea canephora [robusta coffee]
gb|KJB08776.1|  hypothetical protein B456_001G103100                    195   1e-61   Gossypium raimondii
gb|KHG21179.1|  60S ribosomal protein L32-1                             195   1e-61   Gossypium arboreum [tree cotton]
ref|XP_010529134.1|  PREDICTED: 60S ribosomal protein L32-1-like        195   2e-61   Tarenaya hassleriana [spider flower]
emb|CDP20502.1|  unnamed protein product                                194   3e-61   Coffea canephora [robusta coffee]
ref|XP_006437228.1|  hypothetical protein CICLE_v10032912mg             194   3e-61   
ref|XP_010524654.1|  PREDICTED: 60S ribosomal protein L32-1             194   3e-61   Tarenaya hassleriana [spider flower]
ref|XP_002533495.1|  60S ribosomal protein L32, putative                194   4e-61   Ricinus communis
ref|XP_004147400.1|  PREDICTED: 60S ribosomal protein L32-1-like        194   4e-61   
ref|XP_002272873.1|  PREDICTED: 60S ribosomal protein L32-1             194   5e-61   Vitis vinifera
ref|XP_007049630.1|  Ribosomal protein L32e                             193   7e-61   Theobroma cacao [chocolate]
ref|XP_010559271.1|  PREDICTED: 60S ribosomal protein L32-1-like        193   7e-61   Tarenaya hassleriana [spider flower]
ref|XP_008443854.1|  PREDICTED: 60S ribosomal protein L32-1             193   8e-61   Cucumis melo [Oriental melon]
ref|XP_006437227.1|  hypothetical protein CICLE_v10032912mg             194   8e-61   
ref|XP_010272649.1|  PREDICTED: 60S ribosomal protein L32-1             193   1e-60   Nelumbo nucifera [Indian lotus]
gb|KDP21195.1|  hypothetical protein JCGZ_21666                         192   1e-60   Jatropha curcas
gb|KHG21178.1|  60S ribosomal protein L32-1                             195   1e-60   Gossypium arboreum [tree cotton]
ref|XP_008439684.1|  PREDICTED: 60S ribosomal protein L32-1-like        192   1e-60   Cucumis melo [Oriental melon]
gb|KJB08773.1|  hypothetical protein B456_001G102900                    192   2e-60   Gossypium raimondii
ref|XP_010056846.1|  PREDICTED: 60S ribosomal protein L32-1             192   2e-60   Eucalyptus grandis [rose gum]
ref|XP_006467550.1|  PREDICTED: 60S ribosomal protein L32-1-like        192   3e-60   Citrus sinensis [apfelsine]
ref|XP_010069607.1|  PREDICTED: 60S ribosomal protein L32-1             192   3e-60   Eucalyptus grandis [rose gum]
ref|XP_006449608.1|  hypothetical protein CICLE_v10017148mg             192   3e-60   
ref|XP_002321286.1|  hypothetical protein POPTR_0014s18940g             191   3e-60   
gb|ADR71279.1|  60S ribosomal protein L32A                              191   4e-60   Hevea brasiliensis [jebe]
gb|KHG04454.1|  60S ribosomal L32-1 -like protein                       191   4e-60   Gossypium arboreum [tree cotton]
ref|XP_010247562.1|  PREDICTED: 60S ribosomal protein L32-1-like        191   4e-60   Nelumbo nucifera [Indian lotus]
ref|XP_007025196.1|  Ribosomal protein L32e isoform 1                   191   5e-60   Theobroma cacao [chocolate]
gb|KHG21177.1|  60S ribosomal protein L32-1                             195   7e-60   Gossypium arboreum [tree cotton]
ref|XP_010241776.1|  PREDICTED: 60S ribosomal protein L32-1-like        191   7e-60   Nelumbo nucifera [Indian lotus]
ref|XP_011089633.1|  PREDICTED: 60S ribosomal protein L32-1-like        191   8e-60   Sesamum indicum [beniseed]
ref|NP_001238414.1|  uncharacterized protein LOC100499946               191   8e-60   
ref|XP_003538445.2|  PREDICTED: 60S ribosomal protein L32-1-like        192   8e-60   
gb|AAK43709.1|AF358665_1  ribosomal protein L32                         190   9e-60   Mercurialis annua [annual mercury]
ref|XP_004134637.1|  PREDICTED: 60S ribosomal protein L32-1-like        190   1e-59   Cucumis sativus [cucumbers]
ref|XP_002303076.1|  hypothetical protein POPTR_0002s25050g             190   1e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006585160.1|  PREDICTED: 60S ribosomal protein L32-1-like        190   1e-59   Glycine max [soybeans]
gb|KJB34980.1|  hypothetical protein B456_006G094200                    190   1e-59   Gossypium raimondii
ref|XP_010100802.1|  60S ribosomal protein L32-1                        190   1e-59   Morus notabilis
ref|NP_001237268.1|  uncharacterized protein LOC100527779               190   1e-59   Glycine max [soybeans]
ref|XP_010646637.1|  PREDICTED: 60S ribosomal protein L32-1             190   1e-59   Vitis vinifera
ref|XP_004488296.1|  PREDICTED: 60S ribosomal protein L32-1-like        190   2e-59   Cicer arietinum [garbanzo]
ref|XP_011089024.1|  PREDICTED: 60S ribosomal protein L32-1-like        189   2e-59   Sesamum indicum [beniseed]
ref|XP_004504324.1|  PREDICTED: 60S ribosomal protein L32-1-like        189   2e-59   Cicer arietinum [garbanzo]
gb|EPS72800.1|  hypothetical protein M569_01958                         189   3e-59   Genlisea aurea
ref|XP_010245344.1|  PREDICTED: 60S ribosomal protein L32-1-like        189   3e-59   Nelumbo nucifera [Indian lotus]
ref|XP_007213978.1|  hypothetical protein PRUPE_ppa013240mg             189   4e-59   Prunus persica
ref|XP_004492257.1|  PREDICTED: 60S ribosomal protein L32-1-like        189   4e-59   Cicer arietinum [garbanzo]
gb|ABK94533.1|  unknown                                                 188   5e-59   Populus trichocarpa [western balsam poplar]
ref|XP_006584588.1|  PREDICTED: uncharacterized protein LOC100802...    188   5e-59   Glycine max [soybeans]
ref|NP_001242308.1|  uncharacterized protein LOC100802667               188   6e-59   Glycine max [soybeans]
gb|ABQ53642.1|  60S ribosomal protein L32A                              187   6e-59   Cucumis melo [Oriental melon]
gb|ABQ42013.1|  60S ribosomal protein L32a                              187   8e-59   Sonneratia alba
ref|XP_008792964.1|  PREDICTED: 60S ribosomal protein L32-1             187   1e-58   Phoenix dactylifera
gb|EYU28163.1|  hypothetical protein MIMGU_mgv1a016148mg                187   1e-58   Erythranthe guttata [common monkey flower]
ref|NP_001238278.1|  uncharacterized protein LOC100306401               187   1e-58   Glycine max [soybeans]
ref|NP_001236826.1|  uncharacterized protein LOC100499846               187   1e-58   Glycine max [soybeans]
gb|KCW74315.1|  hypothetical protein EUGRSUZ_E029812                    186   1e-58   Eucalyptus grandis [rose gum]
ref|NP_193544.1|  60S ribosomal protein L32-1                           187   1e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010481452.1|  PREDICTED: 60S ribosomal protein L32-1-like        187   1e-58   Camelina sativa [gold-of-pleasure]
ref|XP_009790634.1|  PREDICTED: 60S ribosomal protein L32-1-like        187   1e-58   Nicotiana sylvestris
ref|XP_010494825.1|  PREDICTED: 60S ribosomal protein L32-1-like        187   2e-58   Camelina sativa [gold-of-pleasure]
gb|KJB69746.1|  hypothetical protein B456_011G040600                    187   2e-58   Gossypium raimondii
gb|AAZ32896.1|  ribosomal protein L32                                   187   2e-58   Medicago sativa [alfalfa]
ref|XP_002868011.1|  60S ribosomal protein L32                          187   2e-58   Arabidopsis lyrata subsp. lyrata
gb|ABQ42016.1|  60S ribosomal protein L32a                              186   2e-58   Sonneratia apetala
gb|AAR83884.1|  ly200 protein                                           187   2e-58   Capsicum annuum
ref|XP_006398337.1|  hypothetical protein EUTSA_v10001069mg             187   2e-58   Eutrema salsugineum [saltwater cress]
ref|XP_006284743.1|  hypothetical protein CARUB_v10006007mg             187   2e-58   Capsella rubella
ref|XP_009620676.1|  PREDICTED: 60S ribosomal protein L32-1             187   2e-58   Nicotiana tomentosiformis
gb|ABQ42018.1|  60S ribosomal protein L32b                              186   2e-58   Sonneratia caseolaris
ref|XP_004233141.1|  PREDICTED: 60S ribosomal protein L32-1             187   2e-58   Solanum lycopersicum
ref|XP_009404229.1|  PREDICTED: 60S ribosomal protein L32-1-like        187   2e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006281294.1|  hypothetical protein CARUB_v10027344mg             187   3e-58   
ref|XP_006284745.1|  hypothetical protein CARUB_v10006009mg             187   3e-58   
ref|XP_006352982.1|  PREDICTED: 60S ribosomal protein L32-1-like        187   3e-58   Solanum tuberosum [potatoes]
ref|XP_002316741.1|  ribosomal protein L32                              186   3e-58   Populus trichocarpa [western balsam poplar]
ref|XP_010926657.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   3e-58   Elaeis guineensis
ref|XP_003578372.1|  PREDICTED: 60S ribosomal protein L32-1             186   4e-58   Brachypodium distachyon [annual false brome]
ref|XP_008371558.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   4e-58   
gb|KDP45266.1|  hypothetical protein JCGZ_15131                         187   4e-58   Jatropha curcas
gb|KJB34983.1|  hypothetical protein B456_006G094200                    185   4e-58   Gossypium raimondii
gb|AAM63787.1|  ribosomal protein L32-like protein                      186   5e-58   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009352141.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   5e-58   
gb|AFK42243.1|  unknown                                                 186   5e-58   Medicago truncatula
ref|XP_002865192.1|  60S ribosomal protein L32                          186   5e-58   Arabidopsis lyrata subsp. lyrata
gb|ABQ42017.1|  60S ribosomal protein L32b                              185   6e-58   Sonneratia alba
ref|XP_009410230.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   6e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006660802.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   6e-58   Oryza brachyantha
ref|XP_009390810.1|  PREDICTED: 60S ribosomal protein L32-1             186   7e-58   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001063584.1|  Os09g0502000                                       186   7e-58   
ref|XP_010905165.1|  PREDICTED: 60S ribosomal protein L32-1             186   7e-58   Elaeis guineensis
ref|XP_009601398.1|  PREDICTED: 60S ribosomal protein L32-1-like        186   7e-58   
ref|XP_009131393.1|  PREDICTED: 60S ribosomal protein L32-1             186   7e-58   Brassica rapa
emb|CDP20386.1|  unnamed protein product                                186   7e-58   Coffea canephora [robusta coffee]
gb|EMT03725.1|  60S ribosomal protein L32-1                             186   8e-58   
ref|XP_008372551.1|  PREDICTED: 60S ribosomal protein L32-1             185   9e-58   Malus domestica [apple tree]
ref|XP_004244534.1|  PREDICTED: 60S ribosomal protein L32-1-like        185   9e-58   Solanum lycopersicum
ref|XP_006659599.1|  PREDICTED: 60S ribosomal protein L32-1-like        185   9e-58   Oryza brachyantha
ref|NP_001148889.1|  60S ribosomal protein L32                          185   1e-57   Zea mays [maize]
ref|NP_001062288.2|  Os08g0524600                                       186   1e-57   
ref|XP_011096476.1|  PREDICTED: 60S ribosomal protein L32-1             185   1e-57   Sesamum indicum [beniseed]
ref|XP_009788393.1|  PREDICTED: 60S ribosomal protein L32-1-like        185   1e-57   Nicotiana sylvestris
ref|NP_199455.1|  60S ribosomal protein L32-2                           185   1e-57   Arabidopsis thaliana [mouse-ear cress]
ref|XP_003574802.1|  PREDICTED: 60S ribosomal protein L32-1-like        185   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_003574804.1|  PREDICTED: 60S ribosomal protein L32-1-like        185   1e-57   Brachypodium distachyon [annual false brome]
ref|XP_007140722.1|  hypothetical protein PHAVU_008G136100g             185   1e-57   Phaseolus vulgaris [French bean]
emb|CDY33476.1|  BnaA06g35970D                                          185   2e-57   Brassica napus [oilseed rape]
pdb|3J61|EE  Chain e, Localization Of The Large Subunit Ribosomal...    184   2e-57   Triticum aestivum [Canadian hard winter wheat]
gb|KHG00816.1|  60S ribosomal L32-1 -like protein                       184   2e-57   Gossypium arboreum [tree cotton]
ref|XP_002445836.1|  hypothetical protein SORBIDRAFT_07g026620          184   2e-57   Sorghum bicolor [broomcorn]
ref|XP_003629717.1|  60S ribosomal protein L32                          184   2e-57   Medicago truncatula
ref|XP_006414148.1|  hypothetical protein EUTSA_v10026550mg             184   2e-57   Eutrema salsugineum [saltwater cress]
ref|NP_001175927.1|  Os09g0501100                                       184   2e-57   
ref|XP_006362510.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   2e-57   Solanum tuberosum [potatoes]
ref|XP_009605706.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   2e-57   Nicotiana tomentosiformis
gb|EMS50093.1|  60S ribosomal protein L32-1                             184   2e-57   Triticum urartu
ref|XP_008785360.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   2e-57   Phoenix dactylifera
gb|AFK45640.1|  unknown                                                 184   2e-57   Lotus japonicus
ref|XP_009761159.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   3e-57   Nicotiana sylvestris
ref|XP_002460481.1|  hypothetical protein SORBIDRAFT_02g029030          184   3e-57   Sorghum bicolor [broomcorn]
ref|XP_010910370.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   3e-57   Elaeis guineensis
ref|XP_011085290.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   3e-57   Sesamum indicum [beniseed]
ref|XP_007201259.1|  hypothetical protein PRUPE_ppa013247mg             184   3e-57   Prunus persica
ref|XP_009772347.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   3e-57   Nicotiana sylvestris
ref|XP_007138500.1|  hypothetical protein PHAVU_009G214400g             184   3e-57   Phaseolus vulgaris [French bean]
gb|EYU39177.1|  hypothetical protein MIMGU_mgv1a016137mg                184   4e-57   Erythranthe guttata [common monkey flower]
ref|XP_009379989.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   4e-57   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009632010.1|  PREDICTED: 60S ribosomal protein L32-1-like ...    184   4e-57   Nicotiana tomentosiformis
ref|XP_002462615.1|  hypothetical protein SORBIDRAFT_02g029050          184   4e-57   Sorghum bicolor [broomcorn]
ref|XP_003578370.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   4e-57   Brachypodium distachyon [annual false brome]
ref|XP_004957262.1|  PREDICTED: 60S ribosomal protein L32-1-like        184   4e-57   Setaria italica
ref|NP_001132800.1|  uncharacterized protein LOC100194289               183   5e-57   Zea mays [maize]
gb|EMS45337.1|  60S ribosomal protein L32-1                             184   6e-57   Triticum urartu
ref|XP_006661401.1|  PREDICTED: 60S ribosomal protein L32-1-like        182   6e-57   
ref|XP_004290150.1|  PREDICTED: 60S ribosomal protein L32-1             183   6e-57   Fragaria vesca subsp. vesca
gb|ACJ85920.1|  unknown                                                 183   7e-57   Medicago truncatula
gb|EMT14243.1|  60S ribosomal protein L32-1                             184   7e-57   
ref|XP_004973928.1|  PREDICTED: 60S ribosomal protein L32-1-like        183   8e-57   Setaria italica
ref|NP_001132263.1|  uncharacterized protein LOC100193699               183   9e-57   Zea mays [maize]
ref|XP_010670205.1|  PREDICTED: 60S ribosomal protein L32-1-like        183   9e-57   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009632000.1|  PREDICTED: 60S ribosomal protein L32-1-like ...    184   1e-56   Nicotiana tomentosiformis
gb|EEE69996.1|  hypothetical protein OsJ_29906                          184   1e-56   Oryza sativa Japonica Group [Japonica rice]
gb|EEC84833.1|  hypothetical protein OsI_31924                          184   1e-56   Oryza sativa Indica Group [Indian rice]
ref|XP_009101512.1|  PREDICTED: 60S ribosomal protein L32-1-like        182   1e-56   Brassica rapa
ref|XP_009114357.1|  PREDICTED: 60S ribosomal protein L32-1-like        182   1e-56   Brassica rapa
ref|XP_010687630.1|  PREDICTED: 60S ribosomal protein L32-1             182   1e-56   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009631993.1|  PREDICTED: 60S ribosomal protein L32-1-like ...    184   1e-56   Nicotiana tomentosiformis
ref|XP_004973934.1|  PREDICTED: 60S ribosomal protein L32-1-like        182   1e-56   Setaria italica
dbj|BAK07662.1|  predicted protein                                      182   2e-56   Hordeum vulgare subsp. vulgare [two-rowed barley]
gb|ACG29450.1|  60S ribosomal protein L32                               182   2e-56   Zea mays [maize]
gb|EMS51686.1|  60S ribosomal protein L32-1                             182   2e-56   Triticum urartu
gb|ACG24091.1|  60S ribosomal protein L32                               182   2e-56   Zea mays [maize]
ref|XP_011045320.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    182   2e-56   Populus euphratica
gb|EEE69995.1|  hypothetical protein OsJ_29904                          184   2e-56   Oryza sativa Japonica Group [Japonica rice]
gb|KEH21589.1|  60S ribosomal protein L32-1                             182   2e-56   Medicago truncatula
ref|XP_010670302.1|  PREDICTED: 60S ribosomal protein L32-1-like        181   3e-56   Beta vulgaris subsp. vulgaris [field beet]
gb|ACG48652.1|  60S ribosomal protein L32                               181   3e-56   Zea mays [maize]
gb|AFK34887.1|  unknown                                                 181   3e-56   Lotus japonicus
gb|KFK23999.1|  hypothetical protein AALP_AAs41098U000100               181   4e-56   Arabis alpina [alpine rockcress]
ref|XP_010434578.1|  PREDICTED: 60S ribosomal protein L32-2             181   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_010439903.1|  PREDICTED: 60S ribosomal protein L32-2-like        181   4e-56   Camelina sativa [gold-of-pleasure]
ref|XP_007159414.1|  hypothetical protein PHAVU_002G236400g             181   6e-56   Phaseolus vulgaris [French bean]
gb|EMS61540.1|  60S ribosomal protein L32-1                             182   7e-56   Triticum urartu
gb|KFK31466.1|  hypothetical protein AALP_AA6G115900                    180   8e-56   Arabis alpina [alpine rockcress]
ref|XP_004293659.1|  PREDICTED: 60S ribosomal protein L32-1             179   3e-55   Fragaria vesca subsp. vesca
gb|ABM30195.1|  ribosomal structural protein                            179   3e-55   Brassica juncea [brown mustard]
ref|NP_001146622.1|  hypothetical protein                               178   5e-55   Zea mays [maize]
gb|ABK21991.1|  unknown                                                 176   2e-54   Picea sitchensis
gb|AFY99063.1|  ribosomal protein RPL32e                                175   3e-54   Clermontia arborescens subsp. waihiae
gb|ABK22044.1|  unknown                                                 174   2e-53   Picea sitchensis
ref|XP_002969962.1|  hypothetical protein SELMODRAFT_146656             170   8e-52   Selaginella moellendorffii
ref|XP_002981432.1|  hypothetical protein SELMODRAFT_154490             169   2e-51   Selaginella moellendorffii
gb|AFY99064.1|  ribosomal protein RPL32e                                166   8e-51   Cyanea asplenifolia
ref|XP_001779014.1|  predicted protein                                  161   3e-48   
ref|XP_001766381.1|  predicted protein                                  159   2e-47   
ref|XP_001785699.1|  predicted protein                                  159   2e-47   
ref|XP_001767962.1|  predicted protein                                  159   2e-47   
ref|XP_006597935.1|  PREDICTED: 60S ribosomal protein L32-1-like        158   4e-47   
ref|XP_001771475.1|  predicted protein                                  157   8e-47   
ref|XP_005847255.1|  hypothetical protein CHLNCDRAFT_35552              157   9e-47   Chlorella variabilis
ref|XP_002901678.1|  60S ribosomal protein L32-1                        155   9e-46   Phytophthora infestans T30-4
gb|AHA44493.1|  60S ribosomal-like protein                              155   9e-46   Pectinaria gouldii
ref|XP_008913469.1|  hypothetical protein PPTG_17566                    155   1e-45   Phytophthora parasitica INRA-310
ref|XP_001656734.1|  AAEL003396-PA                                      154   2e-45   Aedes aegypti
ref|XP_009516675.1|  hypothetical protein PHYSODRAFT_353635             154   2e-45   Phytophthora sojae
dbj|BAM76247.1|  ribosomal protein                                      153   3e-45   Pinctada fucata
ref|XP_005997880.1|  PREDICTED: 60S ribosomal protein L32-like          153   4e-45   Latimeria chalumnae
dbj|BAD26685.1|  Ribosomal protein L32                                  152   6e-45   Plutella xylostella [cabbage moth]
ref|XP_003224928.1|  PREDICTED: 60S ribosomal protein L32               152   8e-45   Anolis carolinensis [Carolina anole]
ref|XP_320915.2|  AGAP002122-PA                                         152   1e-44   Anopheles gambiae str. PEST
sp|Q962T1.1|RL32_SPOFR  RecName: Full=60S ribosomal protein L32         152   1e-44   Spodoptera frugiperda
dbj|BAH20804.1|  ribosomal protein L32                                  152   1e-44   Triops granarius
ref|XP_011396614.1|  60S ribosomal protein L32-1                        152   1e-44   Auxenochlorella protothecoides
ref|NP_001091752.1|  ribosomal protein L32                              151   2e-44   Bombyx mori [silk moth]
emb|CBN78007.1|  conserved unknown protein                              151   2e-44   Ectocarpus siliculosus
ref|XP_007423320.1|  PREDICTED: 60S ribosomal protein L32-like          151   3e-44   Python bivittatus
ref|XP_007126271.1|  PREDICTED: 60S ribosomal protein L32 isoform X1    151   3e-44   
ref|XP_002592147.1|  hypothetical protein BRAFLDRAFT_114866             150   3e-44   Branchiostoma floridae
gb|ABS57448.1|  ribosomal protein L32                                   150   3e-44   Heliconius melpomene [common postman]
ref|XP_006631059.1|  PREDICTED: 60S ribosomal protein L32-like          150   4e-44   Lepisosteus oculatus
gb|AAO31774.1|  ribosomal protein L32                                   150   4e-44   Branchiostoma belcheri tsingtauense
ref|XP_009874431.1|  PREDICTED: 60S ribosomal protein L32               150   4e-44   Apaloderma vittatum
ref|XP_009938273.1|  PREDICTED: 60S ribosomal protein L32               150   4e-44   Opisthocomus hoazin [hoatzin]
ref|XP_001842889.1|  60S ribosomal protein L32                          150   4e-44   Culex quinquefasciatus
gb|ABV44758.1|  60S ribosomal protein L32-like protein                  150   4e-44   Phlebotomus papatasi
ref|XP_005053373.1|  PREDICTED: 60S ribosomal protein L32-like          150   4e-44   Ficedula albicollis
ref|NP_001232440.1|  putative ribosomal protein L32                     150   4e-44   Taeniopygia guttata
ref|XP_010568525.1|  PREDICTED: 60S ribosomal protein L32               150   4e-44   Haliaeetus leucocephalus
ref|NP_001232799.1|  60S ribosomal protein L32-like                     150   4e-44   Taeniopygia guttata
ref|XP_011439989.1|  PREDICTED: 60S ribosomal protein L32-like          150   5e-44   Crassostrea gigas
gb|ADO95151.1|  ribosomal protein L32                                   150   5e-44   Antheraea yamamai [Japanese oak silk moth]
ref|NP_001279165.1|  ribosomal protein L32                              150   5e-44   Callorhinchus milii [Australian ghost shark]
gb|EHJ73441.1|  60S ribosomal protein L32                               150   5e-44   
ref|XP_005145854.1|  PREDICTED: 60S ribosomal protein L32-like          150   5e-44   Melopsittacus undulatus
ref|NP_001011414.1|  ribosomal protein L32                              150   6e-44   Xenopus tropicalis [western clawed frog]
ref|XP_001637038.1|  predicted protein                                  150   6e-44   Nematostella vectensis
gb|ACY95314.1|  ribosomal protein L32                                   150   6e-44   Manduca sexta [Carolina sphinx]
dbj|BAM19062.1|  ribosomal protein L32                                  150   6e-44   Papilio polytes
ref|XP_008499584.1|  PREDICTED: 60S ribosomal protein L32               150   6e-44   Calypte anna
ref|XP_005709176.1|  60S ribosomal protein L32                          150   6e-44   Galdieria sulphuraria
gb|ABV60337.1|  60S ribosomal protein L32-like protein                  150   6e-44   Lutzomyia longipalpis
ref|XP_004333102.1|  ribosomal protein L32, putative                    150   7e-44   Acanthamoeba castellanii str. Neff
ref|NP_001087306.1|  ribosomal protein L32                              150   7e-44   Xenopus laevis [clawed frog]
ref|XP_004581376.1|  PREDICTED: 60S ribosomal protein L32               150   8e-44   Ochotona princeps [southern American pika]
ref|XP_006900940.1|  PREDICTED: 60S ribosomal protein L32-like          150   8e-44   Elephantulus edwardii [Cape long-eared elephant shrew]
gb|AAH86909.1|  Ribosomal protein L32                                   150   9e-44   Mus musculus [mouse]
ref|XP_002921300.1|  PREDICTED: 60S ribosomal protein L32               150   9e-44   
ref|XP_003698444.1|  PREDICTED: 60S ribosomal protein L32-like is...    149   9e-44   Apis florea [dwarf honeybee]
ref|XP_001417185.1|  predicted protein                                  149   9e-44   Ostreococcus lucimarinus CCE9901
gb|ETE71342.1|  60S ribosomal protein L32                               149   1e-43   Ophiophagus hannah
ref|XP_003398978.1|  PREDICTED: 60S ribosomal protein L32-like          149   1e-43   Bombus terrestris [large earth bumblebee]
ref|XP_010749666.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   
ref|XP_006740304.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   Leptonychotes weddellii
gb|ACK76689.1|  ribosomal protein L32                                   149   1e-43   Peromyscus polionotus subgriseus
ref|NP_000985.1|  60S ribosomal protein L32                             149   1e-43   Homo sapiens [man]
gb|AAR05874.1|  ribosomal protein L32                                   149   1e-43   Drosophila saltans
gb|AAX36164.1|  ribosomal protein L32                                   149   1e-43   synthetic construct
ref|XP_004692418.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   Condylura cristata
ref|XP_009902351.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   Picoides pubescens
ref|XP_005072153.1|  PREDICTED: 60S ribosomal protein L32-like          149   1e-43   Mesocricetus auratus [Syrian golden hamster]
ref|XP_005066029.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   
ref|XP_010140894.1|  PREDICTED: 60S ribosomal protein L32               149   1e-43   Buceros rhinoceros silvestris
ref|XP_007060005.1|  PREDICTED: 60S ribosomal protein L32-like          149   1e-43   Chelonia mydas [green seaturtle]
ref|XP_007251555.1|  PREDICTED: 60S ribosomal protein L32-like          149   1e-43   Astyanax mexicanus [blind cave fish]
ref|XP_009078057.1|  PREDICTED: 60S ribosomal protein L32               148   2e-43   Acanthisitta chloris
ref|XP_006998507.1|  PREDICTED: 60S ribosomal protein L32-like          149   2e-43   
ref|NP_001029955.1|  60S ribosomal protein L32                          149   2e-43   Bos taurus [bovine]
gb|EKC27633.1|  60S ribosomal protein L32                               150   2e-43   Crassostrea gigas
ref|XP_007621067.1|  PREDICTED: 60S ribosomal protein L32 isoform X2    149   2e-43   
ref|XP_006132886.1|  PREDICTED: 60S ribosomal protein L32-like is...    149   2e-43   
ref|XP_004395705.1|  PREDICTED: 60S ribosomal protein L32 isoform 1     149   2e-43   Odobenus rosmarus divergens
ref|XP_011330282.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Ooceraea biroi
gb|ETN60962.1|  60S ribosomal protein L32                               149   2e-43   Anopheles darlingi [American malaria mosquito]
ref|XP_010194404.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Colius striatus
gb|KFP71005.1|  60S ribosomal protein L32                               148   2e-43   Acanthisitta chloris
ref|XP_009699238.1|  PREDICTED: 60S ribosomal protein L32               150   2e-43   Cariama cristata
gb|ADT80707.1|  ribosomal protein L32                                   149   2e-43   Euphydryas aurinia [marsh fritillary]
ref|XP_011368839.1|  PREDICTED: 60S ribosomal protein L32 isoform X1    149   2e-43   Pteropus vampyrus
dbj|BAM17803.1|  ribosomal protein L32                                  149   2e-43   Papilio xuthus [Chinese swallowtail]
emb|CAD79337.1|  ribosomal protein L32                                  148   2e-43   Crassostrea gigas
ref|XP_011315147.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Fopius arisanus
gb|ELK07892.1|  60S ribosomal protein L32                               149   2e-43   Pteropus alecto
dbj|BAE66641.2|  ribosomal protein L32                                  149   2e-43   Polypedilum vanderplanki
ref|XP_011146167.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Harpegnathos saltator
ref|XP_008585250.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Galeopterus variegatus [Malayan flying lemur]
gb|ABW23186.1|  ribosomal protein rpl32                                 148   2e-43   Arenicola marina [rock worm]
ref|XP_009583500.1|  PREDICTED: 60S ribosomal protein L32               149   2e-43   Fulmarus glacialis
emb|CDQ92082.1|  unnamed protein product                                149   2e-43   Oncorhynchus mykiss
ref|XP_003963393.1|  PREDICTED: 60S ribosomal protein L32-like is...    149   3e-43   Takifugu rubripes [tiger puffer]
gb|AEA51130.1|  ribosomal protein L32                                   149   3e-43   Oryzias melastigma [Java medaka]
ref|NP_001035132.1|  60S ribosomal protein L32                          148   3e-43   Danio rerio [leopard danio]
ref|XP_006729652.1|  PREDICTED: 60S ribosomal protein L32-like          148   3e-43   Leptonychotes weddellii
ref|XP_004639873.1|  PREDICTED: 60S ribosomal protein L32-like          148   3e-43   
gb|AAR05875.1|  ribosomal protein L32                                   147   3e-43   Drosophila sturtevanti
gb|ABW90364.1|  putative ribosomal protein L32                          148   3e-43   Sipunculus nudus
gb|ACR24953.1|  ribosomal protein L32                                   148   3e-43   
ref|XP_004707466.1|  PREDICTED: 60S ribosomal protein L32-like          149   3e-43   
ref|XP_005188348.1|  PREDICTED: 60S ribosomal protein L32               148   4e-43   
ref|XP_001508412.1|  PREDICTED: 60S ribosomal protein L32               148   4e-43   
gb|EOB06838.1|  60S ribosomal protein L32                               149   4e-43   
ref|XP_004413256.1|  PREDICTED: 60S ribosomal protein L32-like          148   4e-43   
ref|XP_008412183.1|  PREDICTED: 60S ribosomal protein L32               148   4e-43   
ref|XP_001376303.1|  PREDICTED: 60S ribosomal protein L32               148   4e-43   
ref|XP_010788707.1|  PREDICTED: 60S ribosomal protein L32               148   5e-43   
ref|XP_006861258.1|  PREDICTED: 60S ribosomal protein L32-like          148   5e-43   
ref|XP_005288525.1|  PREDICTED: 60S ribosomal protein L32               148   5e-43   
ref|XP_006082896.1|  PREDICTED: 60S ribosomal protein L32-like          148   5e-43   
emb|CAJ17414.1|  ribosomal protein L32e                                 148   5e-43   
ref|XP_004738623.1|  PREDICTED: 60S ribosomal protein L32               149   5e-43   
gb|AIY54301.1|  ribosomal protein L32e                                  148   5e-43   
ref|XP_001096119.1|  PREDICTED: 60S ribosomal protein L32-like is...    148   5e-43   
ref|XP_008276036.1|  PREDICTED: 60S ribosomal protein L32               148   5e-43   
ref|XP_006180128.1|  PREDICTED: 60S ribosomal protein L32               148   5e-43   
dbj|BAD98920.1|  ribosomal protein 49                                   148   5e-43   
ref|XP_004613202.1|  PREDICTED: 60S ribosomal protein L32-like          147   6e-43   
ref|XP_004368406.1|  PREDICTED: 60S ribosomal protein L32               147   6e-43   
ref|XP_008317593.1|  PREDICTED: 60S ribosomal protein L32               147   6e-43   
gb|AAX62446.1|  ribosomal protein L32 isoform B                         147   6e-43   
gb|AAR05870.1|  ribosomal protein L32                                   146   6e-43   
gb|ACQ57838.1|  60S ribosomal protein L32                               147   6e-43   
ref|XP_006901100.1|  PREDICTED: 60S ribosomal protein L32-like          147   6e-43   
ref|XP_001601522.1|  PREDICTED: 60S ribosomal protein L32               147   7e-43   
ref|XP_969564.1|  PREDICTED: 60S ribosomal protein L32                  147   7e-43   
ref|XP_005801735.1|  PREDICTED: 60S ribosomal protein L32-like          147   7e-43   
ref|NP_001291534.1|  60S ribosomal protein L32                          147   7e-43   
ref|XP_007562300.1|  PREDICTED: 60S ribosomal protein L32               147   8e-43   
gb|ACY71313.1|  ribosomal protein L32                                   147   8e-43   
gb|AAX62445.1|  ribosomal protein L32 isoform A                         147   8e-43   
emb|CAG11291.1|  unnamed protein product                                147   8e-43   
gb|ESA17921.1|  hypothetical protein GLOINDRAFT_58066                   147   9e-43   
ref|XP_008549839.1|  PREDICTED: 60S ribosomal protein L32               147   9e-43   
gb|ADE27977.1|  ribosomal protein L32 isoform B                         147   9e-43   
gb|AAL48255.1|AF450502_1  ribosomal protein L32                         147   9e-43   
gb|ENN81440.1|  hypothetical protein YQE_02133                          147   9e-43   
ref|XP_005955799.1|  PREDICTED: 60S ribosomal protein L32 isoform X2    147   1e-42   
ref|NP_524582.1|  ribosomal protein L32, isoform A                      147   1e-42   
ref|XP_004623809.1|  PREDICTED: 60S ribosomal protein L32-like          147   1e-42   
ref|XP_004401550.1|  PREDICTED: 60S ribosomal protein L32-like is...    147   1e-42   
ref|XP_005563310.1|  PREDICTED: 60S ribosomal protein L32-like          147   1e-42   
ref|XP_001086191.1|  PREDICTED: 60S ribosomal protein L32-like          147   1e-42   
ref|XP_002072936.1|  RpL32                                              147   1e-42   
gb|AAF04131.1|AF190579_1  ribosomal protein L32                         146   1e-42   
ref|NP_001011587.1|  60S ribosomal protein L32                          147   1e-42   
gb|EXX70958.1|  ribosomal 60S subunit protein L32                       147   1e-42   
ref|XP_011255329.1|  PREDICTED: 60S ribosomal protein L32               147   1e-42   
gb|AFG26288.1|  ribosomal protein L32e                                  147   1e-42   
ref|XP_001091424.1|  PREDICTED: 60S ribosomal protein L32-like is...    147   1e-42   
ref|XP_003507397.1|  PREDICTED: 60S ribosomal protein L32 isoform X1    147   1e-42   
gb|EHH16161.1|  hypothetical protein EGK_11405                          147   1e-42   
gb|AFS17325.1|  ribosomal protein 49                                    147   1e-42   
ref|XP_005651824.1|  ribosomal protein L32e                             147   1e-42   
ref|XP_004455815.1|  PREDICTED: 60S ribosomal protein L32-like          147   1e-42   
gb|EHH51125.1|  hypothetical protein EGM_10455                          147   1e-42   
ref|XP_001964544.1|  GF23239                                            147   1e-42   
ref|XP_011179338.1|  PREDICTED: 60S ribosomal protein L32               147   1e-42   
gb|AHI62785.1|  ribosomal protein L32                                   147   1e-42   
ref|NP_001187056.1|  60S ribosomal protein L32                          147   1e-42   
emb|CAJ17411.1|  ribosomal protein L32e                                 147   1e-42   
gb|AEE63292.1|  unknown                                                 147   1e-42   
ref|NP_733339.1|  ribosomal protein L32, isoform C                      147   1e-42   
gb|ABM55539.1|  putative ribosomal protein L32                          146   2e-42   
ref|XP_001357639.2|  RpL32, isoform A                                   146   2e-42   
ref|XP_008258430.1|  PREDICTED: 60S ribosomal protein L32 isoform X2    149   2e-42   
ref|XP_001090091.1|  PREDICTED: 60S ribosomal protein L32-like          146   2e-42   
ref|XP_011495928.1|  PREDICTED: 60S ribosomal protein L32               146   2e-42   
dbj|BAN20289.1|  ribosomal protein L32                                  146   2e-42   
dbj|BAF98683.1|  ribosomal protein L32                                  146   2e-42   
ref|XP_011067821.1|  PREDICTED: 60S ribosomal protein L32               146   2e-42   
ref|XP_005359302.1|  PREDICTED: 60S ribosomal protein L32-like          146   2e-42   
ref|XP_002020495.1|  RpL32                                              146   2e-42   
emb|CAB55349.1|  ribosomal protein 49                                   145   2e-42   
ref|XP_002508201.1|  predicted protein                                  146   2e-42   
ref|XP_004517954.1|  PREDICTED: 60S ribosomal protein L32-like          146   2e-42   
gb|ADV40094.1|  ribosomal protein L32 isoform B                         146   3e-42   
emb|CEF97489.1|  Ribosomal protein L32e                                 146   3e-42   
dbj|BAK19477.1|  ribosomal protein L32                                  146   3e-42   
ref|XP_001990138.1|  GH18400                                            146   3e-42   
gb|AAN05611.1|  ribosomal protein L32                                   145   3e-42   
ref|XP_004706492.1|  PREDICTED: 60S ribosomal protein L32-like          145   3e-42   
gb|AAP80706.1|  ribosome protein L32                                    145   4e-42   
gb|AIL52744.1|  putative ribosomal protein L32                          145   4e-42   
gb|EFX89085.1|  hypothetical protein DAPPUDRAFT_230219                  145   4e-42   
gb|ADQ58002.1|  ribosomal protein L32                                   145   4e-42   
gb|AAR05873.1|  ribosomal protein L32                                   145   4e-42   
ref|XP_004546095.1|  PREDICTED: 60S ribosomal protein L32-like          145   5e-42   
gb|ABW90405.1|  putative ribosomal protein L32                          145   5e-42   
ref|XP_004400036.1|  PREDICTED: 60S ribosomal protein L32-like          145   5e-42   
ref|XP_006883187.1|  PREDICTED: 60S ribosomal protein L32-like          145   5e-42   
sp|Q94460.1|RL32_DROAC  RecName: Full=60S ribosomal protein L32; ...    145   6e-42   
ref|XP_002946494.1|  component of cytosolic 80S ribosome and 60S ...    145   6e-42   
gb|ACO08726.1|  60S ribosomal protein L32                               145   6e-42   
ref|XP_005710156.1|  unnamed protein product                            147   7e-42   
ref|XP_005955798.1|  PREDICTED: 60S ribosomal protein L32 isoform X1    147   7e-42   
ref|XP_004630050.1|  PREDICTED: 60S ribosomal protein L32-like          145   7e-42   
gb|AEB54641.1|  ribosomal protein L32                                   145   7e-42   
gb|ABR27950.1|  60S ribosomal protein L32                               145   7e-42   
ref|XP_010862027.1|  PREDICTED: 60S ribosomal protein L32-like          145   8e-42   
gb|AAR05872.1|  ribosomal protein L32                                   144   8e-42   
ref|XP_008268698.1|  PREDICTED: 60S ribosomal protein L32-like is...    145   9e-42   
gb|EAW61102.1|  hCG18290                                                145   9e-42   
ref|XP_002718770.1|  PREDICTED: 60S ribosomal protein L32-like is...    144   9e-42   
emb|CBI40947.3|  unnamed protein product                                143   9e-42   
ref|XP_007627031.1|  PREDICTED: 60S ribosomal protein L32-like is...    144   1e-41   
ref|NP_001266584.1|  ribosomal protein L32                              144   1e-41   
ref|XP_001695517.1|  ribosomal protein L32, component of cytosoli...    144   1e-41   
gb|AET09725.1|  hypothetical protein C016-C8                            144   1e-41   
gb|ABD98762.1|  putative ribosomal protein 49                           144   1e-41   
ref|XP_004398838.1|  PREDICTED: 60S ribosomal protein L32-like          144   1e-41   
ref|XP_002107815.1|  expressed hypothetical protein                     144   1e-41   
gb|EWM22035.1|  ribosomal protein l32                                   144   1e-41   
ref|XP_001093728.1|  PREDICTED: 60S ribosomal protein L32-like is...    144   1e-41   
ref|XP_006895039.1|  PREDICTED: 60S ribosomal protein L32-like          144   2e-41   
ref|XP_006081909.1|  PREDICTED: 60S ribosomal protein L32-like          144   2e-41   
ref|NP_001154108.1|  60S ribosomal protein L32                          144   2e-41   
ref|XP_004443141.1|  PREDICTED: 60S ribosomal protein L32-like          144   2e-41   
emb|CAJ17413.1|  ribosomal protein L32e                                 144   2e-41   
ref|NP_001291087.1|  60S ribosomal protein L32                          144   2e-41   
gb|KDR21989.1|  60S ribosomal protein L32                               144   2e-41   
ref|XP_003057688.1|  predicted protein                                  144   2e-41   
emb|CCA25446.1|  palmitoyltransferase putative                          150   2e-41   
gb|ELV09974.1|  60S ribosomal protein L32                               144   2e-41   
gb|ACH70771.1|  ribosomal protein L32                                   144   2e-41   
ref|XP_006863981.1|  PREDICTED: 60S ribosomal protein L32-like          144   2e-41   
gb|AIU94835.1|  60S ribosomal protein                                   143   3e-41   
gb|AAR05871.1|  ribosomal protein L32                                   142   3e-41   
dbj|BAJ41260.1|  ribosomal protein L32                                  143   3e-41   
gb|ELU10952.1|  hypothetical protein CAPTEDRAFT_154331                  143   3e-41   
ref|XP_005561211.1|  PREDICTED: 60S ribosomal protein L32-like          143   3e-41   
ref|XP_004471493.1|  PREDICTED: 60S ribosomal protein L32-like          143   3e-41   
gb|EPZ34814.1|  60S ribosomal protein L32                               143   4e-41   
emb|CDQ68326.1|  unnamed protein product                                143   5e-41   
ref|XP_009198452.1|  PREDICTED: 60S ribosomal protein L32               145   5e-41   
ref|XP_003880836.1|  60s ribosomal protein L32, related                 142   6e-41   
ref|XP_009029569.1|  hypothetical protein HELRODRAFT_115955             142   6e-41   
tpe|CAL69079.1|  TPA: putative 60S ribosomal protein L32                142   6e-41   
gb|ELK38660.1|  60S ribosomal protein L32                               142   6e-41   
emb|CAJ17415.1|  ribosomal protein L32e                                 142   8e-41   
gb|AGH70176.1|  60S ribosomal protein L32                               142   8e-41   
gb|AEK48266.1|  ribosomal protein S13-like protein                      142   9e-41   
gb|ACO08453.1|  60S ribosomal protein L32                               142   9e-41   
ref|XP_782126.1|  PREDICTED: 60S ribosomal protein L32-like             142   9e-41   
gb|AFK37851.1|  unknown                                                 140   1e-40   
gb|AGM32221.1|  60S ribosomal protein L32-like protein                  142   1e-40   
gb|ELW66736.1|  60S ribosomal protein L32                               142   1e-40   
ref|XP_004701586.1|  PREDICTED: 60S ribosomal protein L32-like          142   1e-40   
ref|XP_006819595.1|  PREDICTED: 60S ribosomal protein L32-like is...    142   1e-40   
emb|CEG65617.1|  Putative 50S ribosomal protein L32                     142   1e-40   
ref|XP_009033175.1|  hypothetical protein AURANDRAFT_36203              142   1e-40   
ref|XP_007447709.1|  PREDICTED: 60S ribosomal protein L32-like          142   1e-40   
ref|XP_006899113.1|  PREDICTED: 60S ribosomal protein L32-like          141   1e-40   
emb|CEJ04757.1|  Putative 50S ribosomal protein L32                     141   1e-40   
gb|ABX44835.1|  putative 60S ribosomal protein RPL32                    142   1e-40   
ref|XP_006978507.1|  PREDICTED: 60S ribosomal protein L32-like          141   2e-40   
ref|XP_008880792.1|  hypothetical protein H310_14671                    145   2e-40   
ref|XP_009828892.1|  hypothetical protein H257_05656                    146   2e-40   
ref|XP_003121309.1|  PREDICTED: 60S ribosomal protein L32-like          141   2e-40   
ref|XP_007852820.1|  60s ribosomal protein l32                          141   2e-40   
gb|KIM48160.1|  hypothetical protein M413DRAFT_62431                    141   2e-40   
ref|XP_006192816.1|  PREDICTED: 60S ribosomal protein L32-like          141   2e-40   
gb|ACI69805.1|  60S ribosomal protein L32                               141   2e-40   
gb|AGJ76543.1|  ribosomal protein L32                                   140   2e-40   
ref|XP_005787789.1|  hypothetical protein EMIHUDRAFT_351999             141   3e-40   
ref|XP_007508249.1|  predicted protein                                  143   3e-40   
gb|KFH65945.1|  60S ribosomal protein L32                               140   3e-40   
gb|KIK71052.1|  hypothetical protein GYMLUDRAFT_975613                  140   3e-40   
ref|XP_005364571.1|  PREDICTED: 60S ribosomal protein L32-like          140   3e-40   
gb|ACO12749.1|  60S ribosomal protein L32                               140   3e-40   
gb|ACO15420.1|  60S ribosomal protein L32                               140   3e-40   
gb|KDO22237.1|  hypothetical protein SPRG_12323                         141   4e-40   
gb|ADD24158.1|  60S ribosomal protein L32                               140   4e-40   
ref|XP_006997900.1|  PREDICTED: 60S ribosomal protein L32-like          140   4e-40   
ref|XP_004456963.1|  PREDICTED: 60S ribosomal protein L32-like          140   4e-40   
ref|XP_006104511.1|  PREDICTED: 60S ribosomal protein L32-like          140   4e-40   
ref|XP_005096705.1|  PREDICTED: 60S ribosomal protein L32-like          141   4e-40   
ref|XP_005870096.1|  PREDICTED: 60S ribosomal protein L32 isoform X1    140   4e-40   
ref|XP_005571513.1|  PREDICTED: 60S ribosomal protein L32-like          140   4e-40   
ref|XP_006147755.1|  PREDICTED: 60S ribosomal protein L32-like          142   4e-40   
ref|XP_001117016.1|  PREDICTED: 60S ribosomal protein L32-like is...    140   4e-40   
ref|XP_002368808.1|  ribosomal protein L32, putative                    140   4e-40   
ref|XP_008616125.1|  50S ribosomal protein L32e                         141   4e-40   
gb|ACO10631.1|  60S ribosomal protein L32                               140   5e-40   
ref|XP_006102418.1|  PREDICTED: 60S ribosomal protein L32-like          140   5e-40   
ref|XP_002166915.1|  PREDICTED: 60S ribosomal protein L32-like is...    140   5e-40   
gb|AAX48866.1|  L32                                                     140   5e-40   
gb|ACD65179.1|  putative 60S ribosomal protein RPL32                    140   5e-40   
ref|XP_010382506.1|  PREDICTED: tetratricopeptide repeat protein ...    146   6e-40   
ref|XP_003038591.1|  60S ribosomal protein L32                          140   6e-40   
ref|XP_005358774.1|  PREDICTED: 60S ribosomal protein L32-like          140   6e-40   
gb|KIK43552.1|  hypothetical protein CY34DRAFT_803720                   139   7e-40   
gb|ACI69854.1|  60S ribosomal protein L32                               140   7e-40   
ref|XP_006101488.1|  PREDICTED: 60S ribosomal protein L32-like          140   7e-40   
ref|XP_006883669.1|  PREDICTED: 60S ribosomal protein L32-like          140   7e-40   
ref|XP_005509074.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    140   7e-40   
emb|CDS08833.1|  Putative 60S ribosomal protein L32                     139   8e-40   
emb|CCQ18667.1|  60S ribosomal protein L32                              139   8e-40   
emb|CDH57942.1|  60s ribosomal protein l32                              139   8e-40   
ref|NP_001164976.1|  60S ribosomal protein L32                          139   8e-40   
ref|XP_008944045.1|  PREDICTED: LOW QUALITY PROTEIN: 60S ribosoma...    139   8e-40   
tpg|DAA62215.1|  TPA: hypothetical protein ZEAMMB73_638619              138   8e-40   
gb|ACO12784.1|  60S ribosomal protein L32                               139   9e-40   
ref|XP_002398221.1|  hypothetical protein MPER_01224                    140   9e-40   
ref|NP_001119682.1|  ribosomal protein L32                              139   9e-40   
gb|EPY80996.1|  ribosomal protein L32-like protein                      139   9e-40   
ref|XP_003739379.1|  PREDICTED: 60S ribosomal protein L32-like          139   1e-39   
emb|CCI42782.1|  unnamed protein product                                146   1e-39   
ref|XP_003762505.1|  PREDICTED: EF-hand domain-containing protein...    147   1e-39   
emb|CCI42783.1|  unnamed protein product                                146   1e-39   
ref|XP_002430794.1|  60S ribosomal protein L32, putative                139   1e-39   
emb|CDO75254.1|  hypothetical protein BN946_scf184967.g7                139   1e-39   
gb|KIM66161.1|  hypothetical protein SCLCIDRAFT_1211384                 139   1e-39   
emb|CDS07874.1|  Putative 60S ribosomal protein L32                     139   1e-39   
ref|XP_007390444.1|  hypothetical protein PHACADRAFT_247298             139   1e-39   
gb|EUC65344.1|  60S ribosomal protein L32                               139   1e-39   
ref|XP_006870833.1|  PREDICTED: 60S ribosomal protein L32-like          140   1e-39   
ref|XP_008468712.1|  PREDICTED: 60S ribosomal protein L32-like          139   1e-39   
gb|ADV52235.1|  ribosomal protein L32                                   138   2e-39   



>ref|XP_002519752.1| 60S ribosomal protein L32, putative [Ricinus communis]
 gb|EEF42725.1| 60S ribosomal protein L32, putative [Ricinus communis]
Length=133

 Score =   197 bits (501),  Expect = 2e-62, Method: Compositional matrix adjust.
 Identities = 92/94 (98%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010547142.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
 ref|XP_010547143.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
 ref|XP_010552018.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
Length=133

 Score =   195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010095157.1| 60S ribosomal protein L32-1 [Morus notabilis]
 gb|EXB58323.1| 60S ribosomal protein L32-1 [Morus notabilis]
Length=133

 Score =   195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 94/94 (100%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>emb|CDP03942.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   195 bits (496),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKDIVERAAQLDVVVT  121



>gb|KJB08776.1| hypothetical protein B456_001G103100 [Gossypium raimondii]
 gb|KJB08777.1| hypothetical protein B456_001G103100 [Gossypium raimondii]
Length=133

 Score =   195 bits (495),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>gb|KHG21179.1| 60S ribosomal protein L32-1 [Gossypium arboreum]
 gb|KHG23788.1| 60S ribosomal L32-1 -like protein [Gossypium arboreum]
 gb|KHG29719.1| 60S ribosomal L32-1 -like protein [Gossypium arboreum]
 gb|KJB08774.1| hypothetical protein B456_001G103000 [Gossypium raimondii]
 gb|KJB08775.1| hypothetical protein B456_001G103000 [Gossypium raimondii]
 gb|KJB42488.1| hypothetical protein B456_007G158300 [Gossypium raimondii]
 gb|KJB42489.1| hypothetical protein B456_007G158300 [Gossypium raimondii]
 gb|KJB42490.1| hypothetical protein B456_007G158300 [Gossypium raimondii]
Length=133

 Score =   195 bits (495),  Expect = 1e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010529134.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
 ref|XP_010529135.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
Length=133

 Score =   195 bits (495),  Expect = 2e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>emb|CDP20502.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   194 bits (493),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_006437228.1| hypothetical protein CICLE_v10032912mg [Citrus clementina]
 ref|XP_006484818.1| PREDICTED: 60S ribosomal protein L32-1-like [Citrus sinensis]
 gb|ESR50468.1| hypothetical protein CICLE_v10032912mg [Citrus clementina]
Length=133

 Score =   194 bits (493),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010524654.1| PREDICTED: 60S ribosomal protein L32-1 [Tarenaya hassleriana]
Length=133

 Score =   194 bits (493),  Expect = 3e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNAGELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_002533495.1| 60S ribosomal protein L32, putative [Ricinus communis]
 gb|EEF28882.1| 60S ribosomal protein L32, putative [Ricinus communis]
Length=133

 Score =   194 bits (493),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_004147400.1| PREDICTED: 60S ribosomal protein L32-1-like [Cucumis sativus]
 ref|XP_004161138.1| PREDICTED: 60S ribosomal protein L32-1-like isoform 1 [Cucumis 
sativus]
 ref|XP_004161139.1| PREDICTED: 60S ribosomal protein L32-1-like isoform 2 [Cucumis 
sativus]
 ref|XP_004161140.1| PREDICTED: 60S ribosomal protein L32-1-like isoform 3 [Cucumis 
sativus]
 ref|XP_004161141.1| PREDICTED: 60S ribosomal protein L32-1-like isoform 4 [Cucumis 
sativus]
 gb|KGN65577.1| hypothetical protein Csa_1G462020 [Cucumis sativus]
Length=133

 Score =   194 bits (492),  Expect = 4e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYG+DKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGTDKKTRHYLPNGFKKFVVHNVNELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_002272873.1| PREDICTED: 60S ribosomal protein L32-1 [Vitis vinifera]
 emb|CAN74433.1| hypothetical protein VITISV_040276 [Vitis vinifera]
 emb|CBI30810.3| unnamed protein product [Vitis vinifera]
Length=133

 Score =   194 bits (492),  Expect = 5e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN QELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNAQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_007049630.1| Ribosomal protein L32e [Theobroma cacao]
 gb|EOX93787.1| Ribosomal protein L32e [Theobroma cacao]
Length=133

 Score =   193 bits (491),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKQIVERAAQLDVVVT  121



>ref|XP_010559271.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
 ref|XP_010559272.1| PREDICTED: 60S ribosomal protein L32-1-like [Tarenaya hassleriana]
Length=133

 Score =   193 bits (491),  Expect = 7e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIV+RA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVDRAAQLDVVVT  121



>ref|XP_008443854.1| PREDICTED: 60S ribosomal protein L32-1 [Cucumis melo]
Length=133

 Score =   193 bits (491),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYG+DKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGTDKKTRHYLPNGFKKFVVHNVNELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_006437227.1| hypothetical protein CICLE_v10032912mg [Citrus clementina]
 gb|ESR50467.1| hypothetical protein CICLE_v10032912mg [Citrus clementina]
Length=172

 Score =   194 bits (494),  Expect = 8e-61, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  67   SVKENWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLM  126

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  127  MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  160



>ref|XP_010272649.1| PREDICTED: 60S ribosomal protein L32-1 [Nelumbo nucifera]
 ref|XP_010272650.1| PREDICTED: 60S ribosomal protein L32-1 [Nelumbo nucifera]
Length=133

 Score =   193 bits (490),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELELLM
Sbjct  28   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>gb|KDP21195.1| hypothetical protein JCGZ_21666 [Jatropha curcas]
Length=133

 Score =   192 bits (489),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>gb|KHG21178.1| 60S ribosomal protein L32-1 [Gossypium arboreum]
Length=199

 Score =   195 bits (495),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  94   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  153

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  154  MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  187



>ref|XP_008439684.1| PREDICTED: 60S ribosomal protein L32-1-like [Cucumis melo]
 ref|XP_008439685.1| PREDICTED: 60S ribosomal protein L32-1-like [Cucumis melo]
Length=133

 Score =   192 bits (489),  Expect = 1e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYG+DKKTRHYLPNGFKKFVVHNV+ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGTDKKTRHYLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|KJB08773.1| hypothetical protein B456_001G102900 [Gossypium raimondii]
Length=133

 Score =   192 bits (488),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MH+RTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHHRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010056846.1| PREDICTED: 60S ribosomal protein L32-1 [Eucalyptus grandis]
 ref|XP_010056847.1| PREDICTED: 60S ribosomal protein L32-1 [Eucalyptus grandis]
 ref|XP_010057267.1| PREDICTED: 60S ribosomal protein L32-1-like [Eucalyptus grandis]
 ref|XP_010057268.1| PREDICTED: 60S ribosomal protein L32-1-like [Eucalyptus grandis]
 gb|KCW73737.1| hypothetical protein EUGRSUZ_E02353 [Eucalyptus grandis]
 gb|KCW73738.1| hypothetical protein EUGRSUZ_E02353 [Eucalyptus grandis]
 gb|KCW73739.1| hypothetical protein EUGRSUZ_E02353 [Eucalyptus grandis]
Length=133

 Score =   192 bits (488),  Expect = 2e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN +ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNAKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_006467550.1| PREDICTED: 60S ribosomal protein L32-1-like [Citrus sinensis]
 gb|KDO78021.1| hypothetical protein CISIN_1g032796mg [Citrus sinensis]
Length=133

 Score =   192 bits (487),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN +ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNTKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_010069607.1| PREDICTED: 60S ribosomal protein L32-1 [Eucalyptus grandis]
 gb|KCW58012.1| hypothetical protein EUGRSUZ_H00743 [Eucalyptus grandis]
Length=133

 Score =   192 bits (487),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIV+RA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVDRAAQLDVVVT  121



>ref|XP_006449608.1| hypothetical protein CICLE_v10017148mg [Citrus clementina]
 ref|XP_006449609.1| hypothetical protein CICLE_v10017148mg [Citrus clementina]
 gb|ESR62848.1| hypothetical protein CICLE_v10017148mg [Citrus clementina]
 gb|ESR62849.1| hypothetical protein CICLE_v10017148mg [Citrus clementina]
Length=133

 Score =   192 bits (487),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN +ELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNTKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_002321286.1| hypothetical protein POPTR_0014s18940g [Populus trichocarpa]
 ref|XP_006369872.1| ribosomal protein L32 [Populus trichocarpa]
 ref|XP_011005833.1| PREDICTED: 60S ribosomal protein L32-1 [Populus euphratica]
 ref|XP_011013499.1| PREDICTED: 60S ribosomal protein L32-1 [Populus euphratica]
 gb|ABK93702.1| unknown [Populus trichocarpa]
 gb|ABK94122.1| unknown [Populus trichocarpa]
 gb|EEE99601.1| hypothetical protein POPTR_0014s18940g [Populus trichocarpa]
 gb|ERP66441.1| ribosomal protein L32 [Populus trichocarpa]
Length=133

 Score =   191 bits (486),  Expect = 3e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|ADR71279.1| 60S ribosomal protein L32A [Hevea brasiliensis]
 gb|ADR71280.1| 60S ribosomal protein L32B [Hevea brasiliensis]
Length=133

 Score =   191 bits (486),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>gb|KHG04454.1| 60S ribosomal L32-1 -like protein [Gossypium arboreum]
 gb|KJB57329.1| hypothetical protein B456_009G158000 [Gossypium raimondii]
 gb|KJB57330.1| hypothetical protein B456_009G158000 [Gossypium raimondii]
Length=133

 Score =   191 bits (486),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 90/94 (96%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_010247562.1| PREDICTED: 60S ribosomal protein L32-1-like [Nelumbo nucifera]
 ref|XP_010247563.1| PREDICTED: 60S ribosomal protein L32-1-like [Nelumbo nucifera]
Length=133

 Score =   191 bits (486),  Expect = 4e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELELLM
Sbjct  28   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_007025196.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 ref|XP_007025197.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 ref|XP_007025198.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 ref|XP_007025199.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 gb|EOY27818.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 gb|EOY27819.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 gb|EOY27820.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
 gb|EOY27821.1| Ribosomal protein L32e isoform 1 [Theobroma cacao]
Length=133

 Score =   191 bits (485),  Expect = 5e-60, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN++ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNIKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>gb|KHG21177.1| 60S ribosomal protein L32-1 [Gossypium arboreum]
Length=252

 Score =   195 bits (495),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 91/94 (97%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  147  SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  206

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  207  MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  240


 Score =   188 bits (477),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 87/90 (97%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLD  272
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLD
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLD  117



>ref|XP_010241776.1| PREDICTED: 60S ribosomal protein L32-1-like [Nelumbo nucifera]
Length=133

 Score =   191 bits (484),  Expect = 7e-60, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELELLM
Sbjct  28   SVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_011089633.1| PREDICTED: 60S ribosomal protein L32-1-like [Sesamum indicum]
Length=133

 Score =   191 bits (484),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  121



>ref|NP_001238414.1| uncharacterized protein LOC100499946 [Glycine max]
 gb|ACU14299.1| unknown [Glycine max]
Length=133

 Score =   191 bits (484),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVEDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>ref|XP_003538445.2| PREDICTED: 60S ribosomal protein L32-1-like [Glycine max]
Length=181

 Score =   192 bits (488),  Expect = 8e-60, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  76   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  135

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  136  MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  169



>gb|AAK43709.1|AF358665_1 ribosomal protein L32 [Mercurialis annua]
 gb|AAK48948.1|AF370436_1 ribosomal protein L32 [Mercurialis annua]
 gb|AAK48949.1|AF370437_1 ribosomal protein L32 [Mercurialis annua]
 gb|AAK48950.1|AF370438_1 ribosomal protein L32 [Mercurialis annua]
Length=133

 Score =   190 bits (483),  Expect = 9e-60, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKDIVERAAQLDVVVT  121



>ref|XP_004134637.1| PREDICTED: 60S ribosomal protein L32-1-like [Cucumis sativus]
 ref|XP_004170613.1| PREDICTED: 60S ribosomal protein L32-1-like [Cucumis sativus]
 gb|KGN49362.1| hypothetical protein Csa_6G521090 [Cucumis sativus]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYG+DKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGTDKKTRHYLPNGFKKFVVHNVTELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_002303076.1| hypothetical protein POPTR_0002s25050g [Populus trichocarpa]
 ref|XP_011024581.1| PREDICTED: 60S ribosomal protein L32-1-like [Populus euphratica]
 ref|XP_011015536.1| PREDICTED: 60S ribosomal protein L32-1-like [Populus euphratica]
 gb|EEE82349.1| hypothetical protein POPTR_0002s25050g [Populus trichocarpa]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELE+LM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_006585160.1| PREDICTED: 60S ribosomal protein L32-1-like [Glycine max]
 gb|KHN17855.1| 60S ribosomal protein L32-1 [Glycine soja]
 gb|KHN47973.1| 60S ribosomal protein L32-1 [Glycine soja]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>gb|KJB34980.1| hypothetical protein B456_006G094200 [Gossypium raimondii]
 gb|KJB34981.1| hypothetical protein B456_006G094200 [Gossypium raimondii]
 gb|KJB34982.1| hypothetical protein B456_006G094200 [Gossypium raimondii]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 89/94 (95%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRKEIVERA+QLDV+VT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKEIVERAAQLDVLVT  121



>ref|XP_010100802.1| 60S ribosomal protein L32-1 [Morus notabilis]
 gb|EXB84500.1| 60S ribosomal protein L32-1 [Morus notabilis]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|NP_001237268.1| uncharacterized protein LOC100527779 [Glycine max]
 gb|ACU16952.1| unknown [Glycine max]
 gb|KHN18788.1| 60S ribosomal protein L32-1 [Glycine soja]
Length=133

 Score =   190 bits (483),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>ref|XP_010646637.1| PREDICTED: 60S ribosomal protein L32-1 [Vitis vinifera]
Length=133

 Score =   190 bits (482),  Expect = 1e-59, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SV+ NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM
Sbjct  28   SVESNWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>ref|XP_004488296.1| PREDICTED: 60S ribosomal protein L32-1-like [Cicer arietinum]
Length=133

 Score =   190 bits (482),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKF+VHNV++LELLMM
Sbjct  29   VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFLVHNVKDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+ST KRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNISTSKRKEIVERAAQLDVVVT  121



>ref|XP_011089024.1| PREDICTED: 60S ribosomal protein L32-1-like [Sesamum indicum]
 ref|XP_011089025.1| PREDICTED: 60S ribosomal protein L32-1-like [Sesamum indicum]
Length=133

 Score =   189 bits (481),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDK+TRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKRTRHYLPNGFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  121



>ref|XP_004504324.1| PREDICTED: 60S ribosomal protein L32-1-like [Cicer arietinum]
Length=133

 Score =   189 bits (481),  Expect = 2e-59, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKF+VHNV +LELLMM
Sbjct  29   VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFLVHNVSDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+ST KRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNISTSKRKEIVERAAQLDVVVT  121



>gb|EPS72800.1| hypothetical protein M569_01958 [Genlisea aurea]
Length=133

 Score =   189 bits (480),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV+ELE+LM
Sbjct  28   SVKRNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VSTKKRK IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTKKRKAIVERAAQLDVVVT  121



>ref|XP_010245344.1| PREDICTED: 60S ribosomal protein L32-1-like [Nelumbo nucifera]
Length=133

 Score =   189 bits (480),  Expect = 3e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRH+LPNGFKKFVVHNV+ELELLM
Sbjct  28   SVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHHLPNGFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_007213978.1| hypothetical protein PRUPE_ppa013240mg [Prunus persica]
 ref|XP_008225378.1| PREDICTED: 60S ribosomal protein L32-1 [Prunus mume]
 gb|EMJ15177.1| hypothetical protein PRUPE_ppa013240mg [Prunus persica]
Length=133

 Score =   189 bits (479),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHN +ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNHFKKFVVHNAKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_004492257.1| PREDICTED: 60S ribosomal protein L32-1-like [Cicer arietinum]
Length=133

 Score =   189 bits (479),  Expect = 4e-59, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNLSTRKRKEIVERAAQLDVVVT  121



>gb|ABK94533.1| unknown [Populus trichocarpa]
Length=133

 Score =   188 bits (478),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELE+LM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVER +QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERTAQLDVVVT  121



>ref|XP_006584588.1| PREDICTED: uncharacterized protein LOC100802667 isoform X1 [Glycine 
max]
 gb|KHN47974.1| 60S ribosomal protein L32-1 [Glycine soja]
Length=133

 Score =   188 bits (478),  Expect = 5e-59, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGY SDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYASDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>ref|NP_001242308.1| uncharacterized protein LOC100802667 [Glycine max]
 gb|ACU19438.1| unknown [Glycine max]
Length=133

 Score =   188 bits (478),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGY SDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGCTLMPNIGYASDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>gb|ABQ53642.1| 60S ribosomal protein L32A [Cucumis melo]
Length=103

 Score =   187 bits (475),  Expect = 6e-59, Method: Compositional matrix adjust.
 Identities = 87/91 (96%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  12   ENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHN  191
            ENWRRPKGIDSRVRRKFKGCTLMPNIGYG+DKKTRHYLPNGFKKFVVHNV ELELLMMHN
Sbjct  1    ENWRRPKGIDSRVRRKFKGCTLMPNIGYGTDKKTRHYLPNGFKKFVVHNVNELELLMMHN  60

Query  192  RTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            RTYCAEIAH+VSTKKRKEIVERA+QLDVVVT
Sbjct  61   RTYCAEIAHDVSTKKRKEIVERAAQLDVVVT  91



>gb|ABQ42013.1| 60S ribosomal protein L32a [Sonneratia alba]
 gb|ABQ42014.1| 60S ribosomal protein L32a [Sonneratia caseolaris]
 gb|ABQ42015.1| 60S ribosomal protein L32a [Sonneratia ovata]
Length=109

 Score =   187 bits (475),  Expect = 8e-59, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRH+LPNGFKKFVVHNV ELELLM
Sbjct  16   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHHLPNGFKKFVVHNVSELELLM  75

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERA+QLDVVVT
Sbjct  76   MHNRTYCAEIAHNVSTKKRKAIVERAAQLDVVVT  109



>ref|XP_008792964.1| PREDICTED: 60S ribosomal protein L32-1 [Phoenix dactylifera]
Length=133

 Score =   187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLM
Sbjct  28   SVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNRFKKFVVHNVSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>gb|EYU28163.1| hypothetical protein MIMGU_mgv1a016148mg [Erythranthe guttata]
 gb|EYU28164.1| hypothetical protein MIMGU_mgv1a016148mg [Erythranthe guttata]
 gb|EYU28165.1| hypothetical protein MIMGU_mgv1a016148mg [Erythranthe guttata]
Length=133

 Score =   187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKG  LMPNIGYGSDKKTRHYLPNGFKKF+VHNV+ELE+LM
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGSVLMPNIGYGSDKKTRHYLPNGFKKFLVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+ST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNISTRKRKEIVERAAQLDVVVT  121



>ref|NP_001238278.1| uncharacterized protein LOC100306401 [Glycine max]
 gb|ACU14554.1| unknown [Glycine max]
 gb|KHN02650.1| 60S ribosomal protein L32-1 [Glycine soja]
Length=133

 Score =   187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRK+IVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKDIVERAAQLDVVLT  121



>ref|NP_001236826.1| uncharacterized protein LOC100499846 [Glycine max]
 gb|ACU13887.1| unknown [Glycine max]
 gb|KHN35591.1| 60S ribosomal protein L32-1 [Glycine soja]
Length=133

 Score =   187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 93/94 (99%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRK+IVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKDIVERAAQLDVVLT  121



>gb|KCW74315.1| hypothetical protein EUGRSUZ_E029812, partial [Eucalyptus grandis]
 gb|KCW74316.1| hypothetical protein EUGRSUZ_E029812, partial [Eucalyptus grandis]
 gb|KCW74317.1| hypothetical protein EUGRSUZ_E029812, partial [Eucalyptus grandis]
Length=103

 Score =   186 bits (473),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHN +ELELLMMHNR
Sbjct  2    NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNAKELELLMMHNR  61

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            TYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  62   TYCAEIAHNVSTRKRKEIVERAAQLDVVVT  91



>ref|NP_193544.1| 60S ribosomal protein L32-1 [Arabidopsis thaliana]
 ref|XP_010441580.1| PREDICTED: 60S ribosomal protein L32-1 [Camelina sativa]
 ref|XP_010441581.1| PREDICTED: 60S ribosomal protein L32-1 [Camelina sativa]
 sp|P49211.2|RL321_ARATH RecName: Full=60S ribosomal protein L32-1 [Arabidopsis thaliana]
 emb|CAB53651.1| ribosomal protein L32-like protein [Arabidopsis thaliana]
 emb|CAB78812.1| ribosomal protein L32-like protein [Arabidopsis thaliana]
 gb|AAL09805.1| AT4g18100/F15J5_70 [Arabidopsis thaliana]
 gb|AAL62391.1| ribosomal protein L32 -like protein [Arabidopsis thaliana]
 gb|AAN15554.1| ribosomal protein L32 -like protein [Arabidopsis thaliana]
 gb|AEE83996.1| 60S ribosomal protein L32-1 [Arabidopsis thaliana]
Length=133

 Score =   187 bits (476),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVT  121



>ref|XP_010481452.1| PREDICTED: 60S ribosomal protein L32-1-like [Camelina sativa]
 ref|XP_010481453.1| PREDICTED: 60S ribosomal protein L32-1-like [Camelina sativa]
Length=133

 Score =   187 bits (475),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVT  121



>ref|XP_009790634.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana sylvestris]
Length=133

 Score =   187 bits (475),  Expect = 1e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_010494825.1| PREDICTED: 60S ribosomal protein L32-1-like [Camelina sativa]
Length=133

 Score =   187 bits (475),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN+ ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNISELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLDVVV+
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVS  121



>gb|KJB69746.1| hypothetical protein B456_011G040600 [Gossypium raimondii]
 gb|KJB69747.1| hypothetical protein B456_011G040600 [Gossypium raimondii]
 gb|KJB69748.1| hypothetical protein B456_011G040600 [Gossypium raimondii]
 gb|KJB69749.1| hypothetical protein B456_011G040600 [Gossypium raimondii]
Length=133

 Score =   187 bits (475),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 88/94 (94%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVKANWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTY AEIAH+VSTKKRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYSAEIAHDVSTKKRKEIVERAAQLDIVVT  121



>gb|AAZ32896.1| ribosomal protein L32 [Medicago sativa]
Length=133

 Score =   187 bits (475),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK++WRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQ+LELLMM
Sbjct  29   VKQSWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_002868011.1| 60S ribosomal protein L32 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH44270.1| 60S ribosomal protein L32 [Arabidopsis lyrata subsp. lyrata]
Length=133

 Score =   187 bits (475),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKSIVERASQLDIVVT  121



>gb|ABQ42016.1| 60S ribosomal protein L32a [Sonneratia apetala]
Length=109

 Score =   186 bits (472),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSD+KTRH+LPNGFKKFVVHNV ELELLM
Sbjct  16   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDRKTRHHLPNGFKKFVVHNVSELELLM  75

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERA+QLDVVVT
Sbjct  76   MHNRTYCAEIAHNVSTKKRKAIVERAAQLDVVVT  109



>gb|AAR83884.1| ly200 protein [Capsicum annuum]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_006398337.1| hypothetical protein EUTSA_v10001069mg [Eutrema salsugineum]
 gb|ESQ39790.1| hypothetical protein EUTSA_v10001069mg [Eutrema salsugineum]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNVTELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+STKKRK IVERASQLDV VT
Sbjct  88   MHNRTYCAEIAHNISTKKRKAIVERASQLDVAVT  121



>ref|XP_006284743.1| hypothetical protein CARUB_v10006007mg [Capsella rubella]
 gb|EOA17641.1| hypothetical protein CARUB_v10006007mg [Capsella rubella]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>ref|XP_009620676.1| PREDICTED: 60S ribosomal protein L32-1 [Nicotiana tomentosiformis]
 ref|XP_009620677.1| PREDICTED: 60S ribosomal protein L32-1 [Nicotiana tomentosiformis]
 ref|XP_009800142.1| PREDICTED: 60S ribosomal protein L32-1 [Nicotiana sylvestris]
 ref|XP_009800143.1| PREDICTED: 60S ribosomal protein L32-1 [Nicotiana sylvestris]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVIT  121



>gb|ABQ42018.1| 60S ribosomal protein L32b [Sonneratia caseolaris]
Length=107

 Score =   186 bits (472),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  16   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVSELELLM  75

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVV  278
            MHNRTYCAEIAHNVSTKKRK IVERA+QLDVV
Sbjct  76   MHNRTYCAEIAHNVSTKKRKAIVERAAQLDVV  107



>ref|XP_004233141.1| PREDICTED: 60S ribosomal protein L32-1 [Solanum lycopersicum]
 gb|ABA40471.1| ly200-like protein [Solanum tuberosum]
 gb|ABB02639.1| ly200-like protein [Solanum tuberosum]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVIT  121



>ref|XP_009404229.1| PREDICTED: 60S ribosomal protein L32-1-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   187 bits (474),  Expect = 2e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV +LELLMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVADLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+STKKRK IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNISTKKRKLIVERAAQLDIVVT  121



>ref|XP_006281294.1| hypothetical protein CARUB_v10027344mg, partial [Capsella rubella]
 gb|EOA14192.1| hypothetical protein CARUB_v10027344mg, partial [Capsella rubella]
Length=137

 Score =   187 bits (474),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  32   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  91

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  92   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  125



>ref|XP_006284745.1| hypothetical protein CARUB_v10006009mg [Capsella rubella]
 gb|EOA17643.1| hypothetical protein CARUB_v10006009mg [Capsella rubella]
Length=133

 Score =   187 bits (474),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>ref|XP_006352982.1| PREDICTED: 60S ribosomal protein L32-1-like [Solanum tuberosum]
 ref|XP_006354243.1| PREDICTED: 60S ribosomal protein L32-1-like [Solanum tuberosum]
 ref|XP_006358333.1| PREDICTED: 60S ribosomal protein L32-1-like [Solanum tuberosum]
Length=133

 Score =   187 bits (474),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVIT  121



>ref|XP_002316741.1| ribosomal protein L32 [Populus trichocarpa]
 gb|EEE97353.1| ribosomal protein L32 [Populus trichocarpa]
Length=133

 Score =   186 bits (473),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV+ELE+LM
Sbjct  28   SVKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNCFKKFVVHNVKELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_010926657.1| PREDICTED: 60S ribosomal protein L32-1-like [Elaeis guineensis]
 ref|XP_010926658.1| PREDICTED: 60S ribosomal protein L32-1-like [Elaeis guineensis]
Length=133

 Score =   186 bits (473),  Expect = 3e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELE+LM
Sbjct  28   SVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNRFKKFVVHNVSELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_003578372.1| PREDICTED: 60S ribosomal protein L32-1 [Brachypodium distachyon]
Length=133

 Score =   186 bits (473),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/93 (94%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDVVVT  121



>ref|XP_008371558.1| PREDICTED: 60S ribosomal protein L32-1-like [Malus domestica]
 ref|XP_008383524.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_008383525.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_008345928.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_008356021.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_008358620.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_008358621.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_009360820.1| PREDICTED: 60S ribosomal protein L32-1-like [Pyrus x bretschneideri]
 ref|XP_009360822.1| PREDICTED: 60S ribosomal protein L32-1-like [Pyrus x bretschneideri]
Length=133

 Score =   186 bits (473),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPN FKKFVVHNV+ELELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNHFKKFVVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|KDP45266.1| hypothetical protein JCGZ_15131 [Jatropha curcas]
Length=170

 Score =   187 bits (476),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 87/91 (96%), Positives = 90/91 (99%), Gaps = 0/91 (0%)
 Frame = +3

Query  12   ENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHN  191
            ENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLMMHN
Sbjct  68   ENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVNELELLMMHN  127

Query  192  RTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            RTYCAEIAH+VST+KRKEIVERA+QLDVVVT
Sbjct  128  RTYCAEIAHDVSTRKRKEIVERAAQLDVVVT  158



>gb|KJB34983.1| hypothetical protein B456_006G094200 [Gossypium raimondii]
Length=106

 Score =   185 bits (470),  Expect = 4e-58, Method: Compositional matrix adjust.
 Identities = 86/90 (96%), Positives = 89/90 (99%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLMMHNR
Sbjct  5    NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLMMHNR  64

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            TYCAEIAH+VSTKKRKEIVERA+QLDV+VT
Sbjct  65   TYCAEIAHDVSTKKRKEIVERAAQLDVLVT  94



>gb|AAM63787.1| ribosomal protein L32-like protein [Arabidopsis thaliana]
Length=133

 Score =   186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSR+RRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRMRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDVVVT  121



>ref|XP_009352141.1| PREDICTED: 60S ribosomal protein L32-1-like [Pyrus x bretschneideri]
Length=133

 Score =   186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPN FKKFVVHNV+ELELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNHFKKFVVHNVRELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|AFK42243.1| unknown [Medicago truncatula]
 gb|KEH22532.1| 60S ribosomal protein L32-1 [Medicago truncatula]
Length=133

 Score =   186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK++WRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQ+LELLMM
Sbjct  29   VKQSWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>ref|XP_002865192.1| 60S ribosomal protein L32 [Arabidopsis lyrata subsp. lyrata]
 gb|EFH41451.1| 60S ribosomal protein L32 [Arabidopsis lyrata subsp. lyrata]
Length=133

 Score =   186 bits (472),  Expect = 5e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VV+
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVS  121



>gb|ABQ42017.1| 60S ribosomal protein L32b [Sonneratia alba]
 gb|ABQ42019.1| 60S ribosomal protein L32b [Sonneratia ovata]
 gb|ABQ42020.1| 60S ribosomal protein L32b [Sonneratia apetala]
 gb|ACS68674.1| ribosomal protein L32 [Sonneratia alba]
 gb|ACS68744.1| ribosomal protein L32 [Sonneratia alba]
Length=107

 Score =   185 bits (469),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  16   AVKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLM  75

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVV  278
            MHNRTYCAEIAHNVSTKKRK IVERA+QLDVV
Sbjct  76   MHNRTYCAEIAHNVSTKKRKAIVERAAQLDVV  107



>ref|XP_009410230.1| PREDICTED: 60S ribosomal protein L32-1-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   186 bits (471),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGCILMPNIGYGSDKKTRHYLPNGFKKFVVHNVAELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+STKKRK IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNISTKKRKHIVERAAQLDIVVT  121



>ref|XP_006660802.1| PREDICTED: 60S ribosomal protein L32-1-like [Oryza brachyantha]
Length=133

 Score =   186 bits (471),  Expect = 6e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|XP_009390810.1| PREDICTED: 60S ribosomal protein L32-1 [Musa acuminata subsp. 
malaccensis]
 ref|XP_009390811.1| PREDICTED: 60S ribosomal protein L32-1 [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV EL+LLMM
Sbjct  29   VKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVSELDLLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST++RK IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRRRKSIVERATQLDIVVT  121



>ref|NP_001063584.1| Os09g0502000 [Oryza sativa Japonica Group]
 ref|XP_006660801.1| PREDICTED: 60S ribosomal protein L32-1-like [Oryza brachyantha]
 dbj|BAF25498.1| Os09g0502000 [Oryza sativa Japonica Group]
 gb|EAZ09642.1| hypothetical protein OsI_31926 [Oryza sativa Indica Group]
 gb|EAZ45266.1| hypothetical protein OsJ_29908 [Oryza sativa Japonica Group]
 dbj|BAH00049.1| unnamed protein product [Oryza sativa Japonica Group]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|XP_010905165.1| PREDICTED: 60S ribosomal protein L32-1 [Elaeis guineensis]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   VKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNRFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_009601398.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana tomentosiformis]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKKIVERAAQLDVVVT  121



>ref|XP_009131393.1| PREDICTED: 60S ribosomal protein L32-1 [Brassica rapa]
 ref|XP_009136905.1| PREDICTED: 60S ribosomal protein L32-1 [Brassica rapa]
 ref|XP_009108351.1| PREDICTED: 60S ribosomal protein L32-1 [Brassica rapa]
 emb|CDY61673.1| BnaC01g40830D [Brassica napus]
 emb|CDY35163.1| BnaA09g18000D [Brassica napus]
 emb|CDY08886.1| BnaC08g11160D [Brassica napus]
 emb|CDY01520.1| BnaC07g35100D [Brassica napus]
 emb|CDX90420.1| BnaA03g43610D [Brassica napus]
 emb|CDX78825.1| BnaA01g08920D [Brassica napus]
 emb|CDX76545.1| BnaA08g08550D [Brassica napus]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>emb|CDP20386.1| unnamed protein product [Coffea canephora]
Length=133

 Score =   186 bits (471),  Expect = 7e-58, Method: Compositional matrix adjust.
 Identities = 87/94 (93%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SV  NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLM
Sbjct  28   SVNTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVE  +QL+VVVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVEHVAQLEVVVT  121



>gb|EMT03725.1| 60S ribosomal protein L32-1 [Aegilops tauschii]
Length=133

 Score =   186 bits (471),  Expect = 8e-58, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K++WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKQSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  121



>ref|XP_008372551.1| PREDICTED: 60S ribosomal protein L32-1 [Malus domestica]
 ref|XP_009372192.1| PREDICTED: 60S ribosomal protein L32-1 [Pyrus x bretschneideri]
 ref|XP_009334270.1| PREDICTED: 60S ribosomal protein L32-1 [Pyrus x bretschneideri]
 ref|XP_009340325.1| PREDICTED: 60S ribosomal protein L32-1 [Pyrus x bretschneideri]
Length=133

 Score =   185 bits (470),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPN FKKFVVHNV+E+ELLMM
Sbjct  29   VKESWRRPKGIDSRVRRKFKGCALMPNIGYGSDKKTRHYLPNKFKKFVVHNVKEVELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+ST+KRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNISTRKRKEIVERAAQLDVVVT  121



>ref|XP_004244534.1| PREDICTED: 60S ribosomal protein L32-1-like [Solanum lycopersicum]
Length=133

 Score =   185 bits (470),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTKKRKEIVERAAQLDVVIT  121



>ref|XP_006659599.1| PREDICTED: 60S ribosomal protein L32-1-like [Oryza brachyantha]
 dbj|BAC75414.1| putative ribosomal protein L32 [Oryza sativa Japonica Group]
 gb|EEC83908.1| hypothetical protein OsI_29957 [Oryza sativa Indica Group]
 gb|EEE69026.1| hypothetical protein OsJ_27999 [Oryza sativa Japonica Group]
Length=133

 Score =   185 bits (470),  Expect = 9e-58, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|NP_001148889.1| 60S ribosomal protein L32 [Zea mays]
 ref|XP_004957263.1| PREDICTED: 60S ribosomal protein L32-1-like [Setaria italica]
 gb|ACG33305.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACN31859.1| unknown [Zea mays]
 tpg|DAA62209.1| TPA: 60S ribosomal protein L32 [Zea mays]
Length=133

 Score =   185 bits (470),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|NP_001062288.2| Os08g0524600 [Oryza sativa Japonica Group]
 dbj|BAF24202.2| Os08g0524600, partial [Oryza sativa Japonica Group]
Length=151

 Score =   186 bits (471),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  47   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  106

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  107  HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  139



>ref|XP_011096476.1| PREDICTED: 60S ribosomal protein L32-1 [Sesamum indicum]
 ref|XP_011096477.1| PREDICTED: 60S ribosomal protein L32-1 [Sesamum indicum]
Length=133

 Score =   185 bits (470),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 86/94 (91%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKF+VHNV+ELELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGSTLMPNIGYGSDKKTRHYLPNGFKKFLVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNR YCAEIAHN+STKKRKEIVERA+QLDVVVT
Sbjct  88   MHNRIYCAEIAHNISTKKRKEIVERAAQLDVVVT  121



>ref|XP_009788393.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana sylvestris]
Length=133

 Score =   185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++L+
Sbjct  28   TVKTNWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDILL  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|NP_199455.1| 60S ribosomal protein L32-2 [Arabidopsis thaliana]
 ref|NP_851142.1| 60S ribosomal protein L32-2 [Arabidopsis thaliana]
 sp|Q9FHG2.1|RL322_ARATH RecName: Full=60S ribosomal protein L32-2 [Arabidopsis thaliana]
 gb|AAL38604.1|AF446871_1 AT5g46430/K11I1_2 [Arabidopsis thaliana]
 dbj|BAB10811.1| ribosomal protein L32 [Arabidopsis thaliana]
 gb|AAK68812.1| ribosomal protein L32 [Arabidopsis thaliana]
 gb|AAK97664.1| AT5g46430/K11I1_2 [Arabidopsis thaliana]
 gb|AAO00911.1| ribosomal protein L32 [Arabidopsis thaliana]
 gb|AED95384.1| 60S ribosomal protein L32-2 [Arabidopsis thaliana]
 gb|AED95385.1| 60S ribosomal protein L32-2 [Arabidopsis thaliana]
Length=133

 Score =   185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKF+VHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFIVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+STKKRK IVERASQLDVVV+
Sbjct  88   MHNRTYCAEIAHNISTKKRKAIVERASQLDVVVS  121



>ref|XP_003574802.1| PREDICTED: 60S ribosomal protein L32-1-like [Brachypodium distachyon]
Length=133

 Score =   185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  121



>ref|XP_003574804.1| PREDICTED: 60S ribosomal protein L32-1-like [Brachypodium distachyon]
Length=133

 Score =   185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  121



>ref|XP_007140722.1| hypothetical protein PHAVU_008G136100g [Phaseolus vulgaris]
 gb|ESW12716.1| hypothetical protein PHAVU_008G136100g [Phaseolus vulgaris]
Length=133

 Score =   185 bits (469),  Expect = 1e-57, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN+++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNIKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNR YCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRAYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>emb|CDY33476.1| BnaA06g35970D [Brassica napus]
 emb|CDY03219.1| BnaC09g19370D [Brassica napus]
 emb|CDX77662.1| BnaC07g19160D [Brassica napus]
Length=133

 Score =   185 bits (469),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNSADLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>pdb|3J61|EE Chain e, Localization Of The Large Subunit Ribosomal Proteins 
Into A 5.5 A Cryo-em Map Of Triticum Aestivum Translating 80s 
Ribosome
 emb|CAH55765.1| ribosomal L32 [Oryza sativa Indica Group]
 gb|EEC84832.1| hypothetical protein OsI_31922 [Oryza sativa Indica Group]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>gb|KHG00816.1| 60S ribosomal L32-1 -like protein [Gossypium arboreum]
Length=132

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 87/92 (95%), Positives = 89/92 (97%), Gaps = 0/92 (0%)
 Frame = +3

Query  9    KENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMH  188
            + NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNV ELELLMMH
Sbjct  29   QTNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVGELELLMMH  88

Query  189  NRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            NRTYCAEIAH+VSTKKRKEIVERA QLDVVVT
Sbjct  89   NRTYCAEIAHDVSTKKRKEIVERAVQLDVVVT  120



>ref|XP_002445836.1| hypothetical protein SORBIDRAFT_07g026620 [Sorghum bicolor]
 gb|EES15331.1| hypothetical protein SORBIDRAFT_07g026620 [Sorghum bicolor]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDK TRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKSTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERASQLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERASQLDIVVT  121



>ref|XP_003629717.1| 60S ribosomal protein L32 [Medicago truncatula]
 gb|ACJ86189.1| unknown [Medicago truncatula]
 gb|AET04193.1| 60S ribosomal protein L32-1 [Medicago truncatula]
 gb|AFK47527.1| unknown [Medicago truncatula]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVV NV +LELLMM
Sbjct  29   VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVCNVNDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST KRK+IVERA+QLDVV+T
Sbjct  89   HNRTYCAEIAHNVSTSKRKDIVERAAQLDVVLT  121



>ref|XP_006414148.1| hypothetical protein EUTSA_v10026550mg [Eutrema salsugineum]
 gb|ESQ55601.1| hypothetical protein EUTSA_v10026550mg [Eutrema salsugineum]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRK IVERASQLD+VV+
Sbjct  88   MHNRTYCAEIAHNVSTRKRKAIVERASQLDIVVS  121



>ref|NP_001175927.1| Os09g0501100 [Oryza sativa Japonica Group]
 dbj|BAG88852.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94040.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAH94655.1| Os09g0501100 [Oryza sativa Japonica Group]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_006362510.1| PREDICTED: 60S ribosomal protein L32-1-like [Solanum tuberosum]
Length=133

 Score =   184 bits (468),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  ELE+LM
Sbjct  28   TVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELEILM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVIT  121



>ref|XP_009605706.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana tomentosiformis]
Length=133

 Score =   184 bits (467),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++LM
Sbjct  28   TVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|EMS50093.1| 60S ribosomal protein L32-1 [Triticum urartu]
 gb|EMT05489.1| 60S ribosomal protein L32-1 [Aegilops tauschii]
Length=133

 Score =   184 bits (467),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K++WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKQSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTQKRKAIVERAAQLDVVVT  121



>ref|XP_008785360.1| PREDICTED: 60S ribosomal protein L32-1-like [Phoenix dactylifera]
 ref|XP_008785361.1| PREDICTED: 60S ribosomal protein L32-1-like [Phoenix dactylifera]
Length=133

 Score =   184 bits (467),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV EL+LLMM
Sbjct  29   VKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNCFKKFVVHNVSELDLLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>gb|AFK45640.1| unknown [Lotus japonicus]
Length=133

 Score =   184 bits (467),  Expect = 2e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 92/93 (99%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK++WRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKFVVHNV++LELLMM
Sbjct  29   VKQSWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVKDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>ref|XP_009761159.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana sylvestris]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++LM
Sbjct  28   TVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_002460481.1| hypothetical protein SORBIDRAFT_02g029030 [Sorghum bicolor]
 gb|EER97002.1| hypothetical protein SORBIDRAFT_02g029030 [Sorghum bicolor]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_010910370.1| PREDICTED: 60S ribosomal protein L32-1-like [Elaeis guineensis]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   VKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNHFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAH+VST+KRK+IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHDVSTRKRKDIVERAAQLDIVVT  121



>ref|XP_011085290.1| PREDICTED: 60S ribosomal protein L32-1-like [Sesamum indicum]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKF+VHNV+ELELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGSTLMPNIGYGSDKKTRHYLPNGFKKFLVHNVKELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNR YCAEIAH+VST+KRKEIVERA+QLD+VVT
Sbjct  88   MHNRKYCAEIAHDVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_007201259.1| hypothetical protein PRUPE_ppa013247mg [Prunus persica]
 ref|XP_008244697.1| PREDICTED: 60S ribosomal protein L32-1-like [Prunus mume]
 gb|EMJ02458.1| hypothetical protein PRUPE_ppa013247mg [Prunus persica]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRH+LPN FKKFVVHNV+E+E+LMM
Sbjct  29   VKESWRRPKGIDSRVRRKFKGCALMPNIGYGSDKKTRHFLPNKFKKFVVHNVKEVEILMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+STKKRKEIVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNISTKKRKEIVERAAQLDVVVT  121



>ref|XP_009772347.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana sylvestris]
 ref|XP_009772348.1| PREDICTED: 60S ribosomal protein L32-1-like [Nicotiana sylvestris]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++LM
Sbjct  28   TVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>ref|XP_007138500.1| hypothetical protein PHAVU_009G214400g [Phaseolus vulgaris]
 gb|ESW10494.1| hypothetical protein PHAVU_009G214400g [Phaseolus vulgaris]
Length=133

 Score =   184 bits (467),  Expect = 3e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGC LMPNIGY SDKKTRHYLPNGFKKFVVHN ++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCALMPNIGYASDKKTRHYLPNGFKKFVVHNAKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>gb|EYU39177.1| hypothetical protein MIMGU_mgv1a016137mg [Erythranthe guttata]
 gb|EYU39178.1| hypothetical protein MIMGU_mgv1a016137mg [Erythranthe guttata]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 91/94 (97%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRH+LPNGFKKF+VHNV+ELE+LM
Sbjct  28   SVKANWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHFLPNGFKKFLVHNVEELEVLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNR YCAEIAH++STKKRK+IVERA+QLDV VT
Sbjct  88   MHNRKYCAEIAHSISTKKRKDIVERAAQLDVAVT  121



>ref|XP_009379989.1| PREDICTED: 60S ribosomal protein L32-1-like [Musa acuminata subsp. 
malaccensis]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 86/93 (92%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKK VV+NV ELELLMM
Sbjct  29   VKPNWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKLVVYNVAELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRK IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKLIVERAAQLDIVVT  121



>ref|XP_009632010.1| PREDICTED: 60S ribosomal protein L32-1-like isoform X3 [Nicotiana 
tomentosiformis]
 ref|XP_009632012.1| PREDICTED: 60S ribosomal protein L32-1-like isoform X3 [Nicotiana 
tomentosiformis]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++L+
Sbjct  28   TVKTNWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDILL  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVLT  121



>ref|XP_002462615.1| hypothetical protein SORBIDRAFT_02g029050 [Sorghum bicolor]
 gb|EER99136.1| hypothetical protein SORBIDRAFT_02g029050 [Sorghum bicolor]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAH+VSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHDVSTKKRKEIVERAAQLDIVVT  121



>ref|XP_003578370.1| PREDICTED: 60S ribosomal protein L32-1-like [Brachypodium distachyon]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDIVVT  121



>ref|XP_004957262.1| PREDICTED: 60S ribosomal protein L32-1-like [Setaria italica]
Length=133

 Score =   184 bits (466),  Expect = 4e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>ref|NP_001132800.1| uncharacterized protein LOC100194289 [Zea mays]
 gb|ACF81796.1| unknown [Zea mays]
 gb|ACG24480.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG24847.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG25010.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG27278.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG48528.1| 60S ribosomal protein L32 [Zea mays]
 gb|AFW61537.1| 60S ribosomal protein L32 isoform 1 [Zea mays]
 gb|AFW61538.1| 60S ribosomal protein L32 isoform 2 [Zea mays]
 gb|AFW61539.1| 60S ribosomal protein L32 isoform 3 [Zea mays]
 gb|AFW61540.1| 60S ribosomal protein L32 isoform 4 [Zea mays]
 tpg|DAA48139.1| TPA: hypothetical protein ZEAMMB73_996686 [Zea mays]
Length=133

 Score =   183 bits (465),  Expect = 5e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDK TRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKSTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>gb|EMS45337.1| 60S ribosomal protein L32-1 [Triticum urartu]
Length=163

 Score =   184 bits (467),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 92/94 (98%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +++++WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLM
Sbjct  58   NLEQSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLM  117

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  118  MHNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  151



>ref|XP_006661401.1| PREDICTED: 60S ribosomal protein L32-1-like [Oryza brachyantha]
Length=107

 Score =   182 bits (463),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/90 (93%), Positives = 88/90 (98%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMMHNR
Sbjct  6    SWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMMHNR  65

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            TYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  66   TYCAEIAHNVSTRKRKEIVERAAQLDIVVT  95



>ref|XP_004290150.1| PREDICTED: 60S ribosomal protein L32-1 [Fragaria vesca subsp. 
vesca]
Length=133

 Score =   183 bits (465),  Expect = 6e-57, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPN FKKFVVHNV+ELE+LMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVKELEILMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+ST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNISTRKRKEIVERAAQLDIVVT  121



>gb|ACJ85920.1| unknown [Medicago truncatula]
Length=133

 Score =   183 bits (464),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK++WRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYL NGFKKFVVHNVQ+LELLMM
Sbjct  29   VKQSWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLSNGFKKFVVHNVQDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>gb|EMT14243.1| 60S ribosomal protein L32-1 [Aegilops tauschii]
Length=148

 Score =   184 bits (466),  Expect = 7e-57, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            S   +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLM
Sbjct  43   STMTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLM  102

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  103  MHNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  136



>ref|XP_004973928.1| PREDICTED: 60S ribosomal protein L32-1-like [Setaria italica]
Length=133

 Score =   183 bits (464),  Expect = 8e-57, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR+YCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRSYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>ref|NP_001132263.1| uncharacterized protein LOC100193699 [Zea mays]
 ref|XP_008667854.1| PREDICTED: hypothetical protein isoform X1 [Zea mays]
 ref|XP_008650917.1| PREDICTED: uncharacterized protein LOC100193699 isoform X1 [Zea 
mays]
 gb|ACF81040.1| unknown [Zea mays]
 tpg|DAA40451.1| TPA: 60S ribosomal protein L32 [Zea mays]
 tpg|DAA62217.1| TPA: 60S ribosomal protein L32 [Zea mays]
Length=133

 Score =   183 bits (464),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELL+M
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>ref|XP_010670205.1| PREDICTED: 60S ribosomal protein L32-1-like [Beta vulgaris subsp. 
vulgaris]
Length=133

 Score =   183 bits (464),  Expect = 9e-57, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRH+LPNGFKKFVV+NV ELELLMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHFLPNGFKKFVVNNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN+STKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNISTKKRKEIVERAAQLDIVVT  121



>ref|XP_009632000.1| PREDICTED: 60S ribosomal protein L32-1-like isoform X2 [Nicotiana 
tomentosiformis]
Length=169

 Score =   184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++L+
Sbjct  64   TVKTNWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDILL  123

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  124  MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVLT  157



>gb|EEE69996.1| hypothetical protein OsJ_29906 [Oryza sativa Japonica Group]
Length=170

 Score =   184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  66   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  125

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  126  HNRMYCAEIAHNVSTKKRKEIVERAAQLDIVVT  158



>gb|EEC84833.1| hypothetical protein OsI_31924 [Oryza sativa Indica Group]
Length=171

 Score =   184 bits (467),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  67   LKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLMM  126

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  127  HNRMYCAEIAHNVSTKKRKEIVERAAQLDIVVT  159



>ref|XP_009101512.1| PREDICTED: 60S ribosomal protein L32-1-like [Brassica rapa]
Length=133

 Score =   182 bits (463),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLP+GFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPHGFKKFVVHNSADLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>ref|XP_009114357.1| PREDICTED: 60S ribosomal protein L32-1-like [Brassica rapa]
Length=133

 Score =   182 bits (463),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKK RHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKPRHYLPNGFKKFVVHNSADLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIAHNVSTKKRKAIVERASQLDIVVT  121



>ref|XP_010687630.1| PREDICTED: 60S ribosomal protein L32-1 [Beta vulgaris subsp. 
vulgaris]
Length=133

 Score =   182 bits (463),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRH+LPNGFKKFVVHNV +LELLM
Sbjct  28   SVKTNWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHFLPNGFKKFVVHNVGDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+STKKRK+IVERA+QLD+ VT
Sbjct  88   MHNRTYCAEIAHNISTKKRKDIVERAAQLDICVT  121



>ref|XP_009631993.1| PREDICTED: 60S ribosomal protein L32-1-like isoform X1 [Nicotiana 
tomentosiformis]
Length=170

 Score =   184 bits (466),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VK NWRRPKGIDSRVRRKFKGC LMPNIGYGSDKKTRHYLPNGFKKFVVHN  EL++L+
Sbjct  65   TVKTNWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKKTRHYLPNGFKKFVVHNASELDILL  124

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVV+T
Sbjct  125  MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVLT  158



>ref|XP_004973934.1| PREDICTED: 60S ribosomal protein L32-1-like [Setaria italica]
Length=133

 Score =   182 bits (462),  Expect = 1e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDK TRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKSTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  121



>dbj|BAK07662.1| predicted protein [Hordeum vulgare subsp. vulgare]
 gb|EMT05491.1| 60S ribosomal protein L32-1 [Aegilops tauschii]
Length=133

 Score =   182 bits (462),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K++WRRPKGIDSRVRRKFKGCTLMPNIGYGS+KKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  29   LKQSWRRPKGIDSRVRRKFKGCTLMPNIGYGSNKKTRHYLPNKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTQKRKAIVERAAQLDVVVT  121



>gb|ACG29450.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG41153.1| 60S ribosomal protein L32 [Zea mays]
Length=133

 Score =   182 bits (462),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELL+M
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRKEIVERA+Q+D+VVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKEIVERAAQMDIVVT  121



>gb|EMS51686.1| 60S ribosomal protein L32-1 [Triticum urartu]
Length=138

 Score =   182 bits (462),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K++WRRPKGIDSRVRRKFKGCTLMPNIGYGS+KKTRHYLPN FKKFVVHNV ELELLMM
Sbjct  34   LKQSWRRPKGIDSRVRRKFKGCTLMPNIGYGSNKKTRHYLPNKFKKFVVHNVSELELLMM  93

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK IVERA+QLDVVVT
Sbjct  94   HNRTYCAEIAHNVSTQKRKAIVERAAQLDVVVT  126



>gb|ACG24091.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG26106.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG27149.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG28156.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG31071.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG31101.1| 60S ribosomal protein L32 [Zea mays]
 gb|ACG39930.1| 60S ribosomal protein L32 [Zea mays]
Length=133

 Score =   182 bits (461),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDK TRHYLP+ FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKSTRHYLPSKFKKFVVHNVSELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>ref|XP_011045320.1| PREDICTED: LOW QUALITY PROTEIN: 60S ribosomal protein L32-1 [Populus 
euphratica]
Length=130

 Score =   182 bits (461),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRV RKFKGCTLMPNIGYGSDKKTRHYLPN FK+FVVHNV+ELE+LM
Sbjct  25   SVKTSWRRPKGIDSRVXRKFKGCTLMPNIGYGSDKKTRHYLPNCFKEFVVHNVKELEVLM  84

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA QLDVVVT
Sbjct  85   MHNRTYCAEIAHNVSTRKRKEIVERAXQLDVVVT  118



>gb|EEE69995.1| hypothetical protein OsJ_29904 [Oryza sativa Japonica Group]
Length=208

 Score =   184 bits (467),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 85/94 (90%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
             +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLM
Sbjct  103  GLKTSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLM  162

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  163  MHNRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  196



>gb|KEH21589.1| 60S ribosomal protein L32-1 [Medicago truncatula]
Length=133

 Score =   182 bits (461),  Expect = 2e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 91/93 (98%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK++WRRPKGIDS+VRRKFKG TLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQ+LE LMM
Sbjct  29   VKQSWRRPKGIDSQVRRKFKGVTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQDLEPLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>ref|XP_010670302.1| PREDICTED: 60S ribosomal protein L32-1-like [Beta vulgaris subsp. 
vulgaris]
Length=133

 Score =   181 bits (460),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 85/93 (91%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRH+LPNGFKKFVV+NV ELELLMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHFLPNGFKKFVVNNVNELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHN STKKRKEIVERA+QLDVV+T
Sbjct  89   HNRTYCAEIAHNTSTKKRKEIVERATQLDVVIT  121



>gb|ACG48652.1| 60S ribosomal protein L32 [Zea mays]
Length=133

 Score =   181 bits (460),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDK TRHYLP+ FKKFVVHNV ELELLMM
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKSTRHYLPSKFKKFVVHNVXELELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVSTKKRKEIVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHNVSTKKRKEIVERAAQLDIVVT  121



>gb|AFK34887.1| unknown [Lotus japonicus]
Length=133

 Score =   181 bits (460),  Expect = 3e-56, Method: Compositional matrix adjust.
 Identities = 84/93 (90%), Positives = 90/93 (97%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK +WRRPKGIDSRVRRKFKGC LMPNIGYGS KKTRHYLPNGFKKFVVHNV++LELLMM
Sbjct  29   VKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSGKKTRHYLPNGFKKFVVHNVKDLELLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAHNVST+KRK+IVERA+QLDVVVT
Sbjct  89   HNRTYCAEIAHNVSTRKRKDIVERAAQLDVVVT  121



>gb|KFK23999.1| hypothetical protein AALP_AAs41098U000100 [Arabis alpina]
Length=133

 Score =   181 bits (460),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTADLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH VSTKKRK+IVERASQLD+VV+
Sbjct  88   MHNRTYCAEIAHCVSTKKRKDIVERASQLDIVVS  121



>ref|XP_010434578.1| PREDICTED: 60S ribosomal protein L32-2 [Camelina sativa]
 ref|XP_010449503.1| PREDICTED: 60S ribosomal protein L32-2 [Camelina sativa]
Length=133

 Score =   181 bits (459),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+STKKRK IVERA+QLD+ V+
Sbjct  88   MHNRTYCAEIAHNISTKKRKAIVERAAQLDICVS  121



>ref|XP_010439903.1| PREDICTED: 60S ribosomal protein L32-2-like [Camelina sativa]
Length=133

 Score =   181 bits (459),  Expect = 4e-56, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  ELELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSELELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHN+STKKRK IVERA+QLD+ V+
Sbjct  88   MHNRTYCAEIAHNISTKKRKAIVERAAQLDICVS  121



>ref|XP_007159414.1| hypothetical protein PHAVU_002G236400g [Phaseolus vulgaris]
 gb|ESW31408.1| hypothetical protein PHAVU_002G236400g [Phaseolus vulgaris]
Length=133

 Score =   181 bits (458),  Expect = 6e-56, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVK +WRRPKGIDSRVRRKFKGC LMPNIGYGSDK+T HYLPNGFKKFVV NV++LELLM
Sbjct  28   SVKPSWRRPKGIDSRVRRKFKGCVLMPNIGYGSDKRTLHYLPNGFKKFVVSNVKDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVST+KRKEIVERA+QLDVVVT
Sbjct  88   MHNRTYCAEIAHNVSTRKRKEIVERAAQLDVVVT  121



>gb|EMS61540.1| 60S ribosomal protein L32-1 [Triticum urartu]
Length=169

 Score =   182 bits (461),  Expect = 7e-56, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 89/94 (95%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            S+  NWRRPKGIDSRV+ KFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELLM
Sbjct  64   SIGMNWRRPKGIDSRVKGKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLM  123

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAHNVSTKKRK+IVERA+QLD+VVT
Sbjct  124  MHNRTYCAEIAHNVSTKKRKDIVERAAQLDIVVT  157



>gb|KFK31466.1| hypothetical protein AALP_AA6G115900 [Arabis alpina]
Length=133

 Score =   180 bits (457),  Expect = 8e-56, Method: Compositional matrix adjust.
 Identities = 82/94 (87%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMPN+GYGSDKKTRHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPNVGYGSDKKTRHYLPNGFKKFVVHNTSDLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIAH VST+KRK+IVERASQLD+VV+
Sbjct  88   MHNRTYCAEIAHCVSTRKRKDIVERASQLDIVVS  121



>ref|XP_004293659.1| PREDICTED: 60S ribosomal protein L32-1 [Fragaria vesca subsp. 
vesca]
Length=133

 Score =   179 bits (454),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/93 (89%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGSDKKTRHYLPN FKKFVVHNV+ELE+LMM
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGVTLMPNIGYGSDKKTRHYLPNRFKKFVVHNVKELEVLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HN TYCAEIAHN+ST+KRK+IVERA+QLDVVVT
Sbjct  89   HNMTYCAEIAHNISTRKRKDIVERAAQLDVVVT  121



>gb|ABM30195.1| ribosomal structural protein [Brassica juncea]
Length=133

 Score =   179 bits (454),  Expect = 3e-55, Method: Compositional matrix adjust.
 Identities = 83/94 (88%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKE+WRRPKGIDSRVRRKFKG TLMP +GYGSDKKTRHYLPNGFKKFVVHN  +LELLM
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGVTLMPYVGYGSDKKTRHYLPNGFKKFVVHNSADLELLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRTYCAEIA NVSTKKRK IVERASQLD+VVT
Sbjct  88   MHNRTYCAEIASNVSTKKRKAIVERASQLDIVVT  121



>ref|NP_001146622.1| hypothetical protein [Zea mays]
 gb|ACL54404.1| unknown [Zea mays]
 tpg|DAA40450.1| TPA: hypothetical protein ZEAMMB73_164725 [Zea mays]
 tpg|DAA62218.1| TPA: hypothetical protein ZEAMMB73_638619 [Zea mays]
Length=134

 Score =   178 bits (452),  Expect = 5e-55, Method: Compositional matrix adjust.
 Identities = 84/94 (89%), Positives = 90/94 (96%), Gaps = 1/94 (1%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K +WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPN FKKFVVHNV ELELL+M
Sbjct  29   LKPSWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNKFKKFVVHNVSELELLLM  88

Query  186  HN-RTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HN RTYCAEIAHNVST+KRKEIVERA+QLD+VVT
Sbjct  89   HNSRTYCAEIAHNVSTRKRKEIVERAAQLDIVVT  122



>gb|ABK21991.1| unknown [Picea sitchensis]
 gb|ABK23783.1| unknown [Picea sitchensis]
 gb|ABK25707.1| unknown [Picea sitchensis]
Length=133

 Score =   176 bits (447),  Expect = 2e-54, Method: Compositional matrix adjust.
 Identities = 80/94 (85%), Positives = 90/94 (96%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            +VKENWRRPKGIDSRVRRKFKGC LMPNIGYGS+KKTRHYLPNGFKKFVV NV++L+LLM
Sbjct  28   TVKENWRRPKGIDSRVRRKFKGCALMPNIGYGSNKKTRHYLPNGFKKFVVFNVKDLDLLM  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MHNRT+CAEIAH+VS+ KRK IVERA+QLD+VVT
Sbjct  88   MHNRTFCAEIAHSVSSLKRKAIVERAAQLDIVVT  121



>gb|AFY99063.1| ribosomal protein RPL32e, partial [Clermontia arborescens subsp. 
waihiae]
Length=92

 Score =   175 bits (444),  Expect = 3e-54, Method: Compositional matrix adjust.
 Identities = 81/87 (93%), Positives = 85/87 (98%), Gaps = 0/87 (0%)
 Frame = +3

Query  24   RPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNRTYC  203
            RPKGIDSRVRRKFKGC LMPN+GYGSDKKTRHYLPNGFKKFVVHN +ELE+LMMHNRTYC
Sbjct  1    RPKGIDSRVRRKFKGCILMPNVGYGSDKKTRHYLPNGFKKFVVHNAKELEVLMMHNRTYC  60

Query  204  AEIAHNVSTKKRKEIVERASQLDVVVT  284
            AEIAHNVSTKKRKEIVERA+QLDVVVT
Sbjct  61   AEIAHNVSTKKRKEIVERAAQLDVVVT  87



>gb|ABK22044.1| unknown [Picea sitchensis]
 gb|ABK23192.1| unknown [Picea sitchensis]
 gb|ACN40562.1| unknown [Picea sitchensis]
Length=133

 Score =   174 bits (441),  Expect = 2e-53, Method: Compositional matrix adjust.
 Identities = 79/93 (85%), Positives = 89/93 (96%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKE+WRRPKGIDSRVRRKFKGC LMPNIGYGS+KKT+HYLPNGFKKFVV+NV +L+LLMM
Sbjct  29   VKESWRRPKGIDSRVRRKFKGCALMPNIGYGSNKKTKHYLPNGFKKFVVYNVHDLDLLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNRTYCAEIAH+VS+ KRK IVERA+QLD+VVT
Sbjct  89   HNRTYCAEIAHSVSSLKRKSIVERAAQLDIVVT  121



>ref|XP_002969962.1| hypothetical protein SELMODRAFT_146656 [Selaginella moellendorffii]
 gb|EFJ29086.1| hypothetical protein SELMODRAFT_146656 [Selaginella moellendorffii]
Length=133

 Score =   170 bits (431),  Expect = 8e-52, Method: Compositional matrix adjust.
 Identities = 78/94 (83%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGS+KKTRH LPNGF KF+VH V +LELL+
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSNKKTRHLLPNGFYKFLVHTVADLELLL  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            M+NR YCAEIAHNVST+KRK+IVERA+QL+V +T
Sbjct  88   MNNRKYCAEIAHNVSTRKRKDIVERAAQLNVALT  121



>ref|XP_002981432.1| hypothetical protein SELMODRAFT_154490 [Selaginella moellendorffii]
 gb|EFJ17620.1| hypothetical protein SELMODRAFT_154490 [Selaginella moellendorffii]
Length=133

 Score =   169 bits (428),  Expect = 2e-51, Method: Compositional matrix adjust.
 Identities = 77/94 (82%), Positives = 88/94 (94%), Gaps = 0/94 (0%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLM  182
            SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGS+KKTRH LPNGF KF+VH V +L+LL+
Sbjct  28   SVKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSNKKTRHLLPNGFYKFLVHTVADLDLLL  87

Query  183  MHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            M+NR YCAEIAHNVST+KRK+IVERA+QL+V +T
Sbjct  88   MNNRKYCAEIAHNVSTRKRKDIVERAAQLNVALT  121



>gb|AFY99064.1| ribosomal protein RPL32e, partial [Cyanea asplenifolia]
Length=83

 Score =   166 bits (420),  Expect = 8e-51, Method: Compositional matrix adjust.
 Identities = 77/83 (93%), Positives = 81/83 (98%), Gaps = 0/83 (0%)
 Frame = +3

Query  36   IDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNRTYCAEIA  215
            IDSRVRRKFKGC LMPN+GYGSDKKTRHYLPNGFKKFVVHN +ELE+LMMHNRTYCAEIA
Sbjct  1    IDSRVRRKFKGCILMPNVGYGSDKKTRHYLPNGFKKFVVHNAKELEVLMMHNRTYCAEIA  60

Query  216  HNVSTKKRKEIVERASQLDVVVT  284
            HNVSTKKRKEIVERA+QLDVVVT
Sbjct  61   HNVSTKKRKEIVERAAQLDVVVT  83



>ref|XP_001779014.1| predicted protein [Physcomitrella patens]
 gb|EDQ56160.1| predicted protein [Physcomitrella patens]
Length=133

 Score =   161 bits (407),  Expect = 3e-48, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGS+KKTRH LP+GF KF+VHNV++LELL+M
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGTTLMPNIGYGSNKKTRHVLPSGFVKFLVHNVKDLELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVST KRK IVERA+QL+V +T
Sbjct  89   HNRKYSAEIAHNVSTLKRKAIVERAAQLNVALT  121



>ref|XP_001766381.1| predicted protein [Physcomitrella patens]
 gb|EDQ68709.1| predicted protein [Physcomitrella patens]
Length=133

 Score =   159 bits (402),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGS+KKTRH LP+GF KF+VHNV+++ELL+M
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGTTLMPNIGYGSNKKTRHVLPSGFVKFLVHNVKDVELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVST KRK IVERA+QL++ +T
Sbjct  89   HNRKYSAEIAHNVSTLKRKAIVERAAQLNIALT  121



>ref|XP_001785699.1| predicted protein [Physcomitrella patens]
 gb|EDQ49494.1| predicted protein [Physcomitrella patens]
Length=133

 Score =   159 bits (402),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGS+KKTRH LP+GF KF+VHNV+++ELL+M
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGTTLMPNIGYGSNKKTRHVLPSGFVKFLVHNVKDVELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVST KRK IVERA+QL++ +T
Sbjct  89   HNRKYSAEIAHNVSTLKRKAIVERAAQLNIALT  121



>ref|XP_001767962.1| predicted protein [Physcomitrella patens]
 gb|EDQ67237.1| predicted protein [Physcomitrella patens]
Length=133

 Score =   159 bits (402),  Expect = 2e-47, Method: Compositional matrix adjust.
 Identities = 73/93 (78%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGIDSRVRRKFKG TLMPNIGYGS+KKTRH LP+GF KF+VHNV+++ELL+M
Sbjct  29   VKTNWRRPKGIDSRVRRKFKGTTLMPNIGYGSNKKTRHVLPSGFVKFLVHNVKDVELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVST KRK IVERA+QL++ +T
Sbjct  89   HNRKYSAEIAHNVSTLKRKAIVERAAQLNIALT  121



>ref|XP_006597935.1| PREDICTED: 60S ribosomal protein L32-1-like [Glycine max]
Length=136

 Score =   158 bits (400),  Expect = 4e-47, Method: Compositional matrix adjust.
 Identities = 72/81 (89%), Positives = 79/81 (98%), Gaps = 0/81 (0%)
 Frame = +3

Query  30   KGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNRTYCAE  209
            KGIDSRVRRKFKGCTLMPNIGYGSDKKT HYLPNGFKKFVVHNV++LELLMMHNRTYC +
Sbjct  32   KGIDSRVRRKFKGCTLMPNIGYGSDKKTYHYLPNGFKKFVVHNVKDLELLMMHNRTYCVK  91

Query  210  IAHNVSTKKRKEIVERASQLD  272
            I+HNVST+KRK+IVERA+QLD
Sbjct  92   ISHNVSTRKRKDIVERATQLD  112



>ref|XP_001771475.1| predicted protein [Physcomitrella patens]
 gb|EDQ63675.1| predicted protein [Physcomitrella patens]
Length=133

 Score =   157 bits (398),  Expect = 8e-47, Method: Compositional matrix adjust.
 Identities = 75/93 (81%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWRRPKGID RVRRKFKG TLMPNIGYGS+KKTRH LP+GF KF VHNV +LELL+M
Sbjct  29   VKTNWRRPKGIDCRVRRKFKGTTLMPNIGYGSNKKTRHVLPSGFVKFSVHNVTDLELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVST KRK IVERA+QL+V VT
Sbjct  89   HNRKYSAEIAHNVSTLKRKAIVERAAQLNVAVT  121



>ref|XP_005847255.1| hypothetical protein CHLNCDRAFT_35552 [Chlorella variabilis]
 gb|EFN55153.1| hypothetical protein CHLNCDRAFT_35552 [Chlorella variabilis]
Length=134

 Score =   157 bits (398),  Expect = 9e-47, Method: Compositional matrix adjust.
 Identities = 73/95 (77%), Positives = 86/95 (91%), Gaps = 1/95 (1%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGC-TLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELL  179
            +VKE+WRRPKGIDSRVRRKFKGC  +MPNIGYGS+KKTRH LPNGF KFVV+NV++LELL
Sbjct  28   TVKESWRRPKGIDSRVRRKFKGCGVIMPNIGYGSNKKTRHVLPNGFLKFVVNNVKDLELL  87

Query  180  MMHNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            MMHNR +C EIAHNVST KRK IVERA++L++ +T
Sbjct  88   MMHNRKFCGEIAHNVSTLKRKAIVERAAELNIALT  122



>ref|XP_002901678.1| 60S ribosomal protein L32-1 [Phytophthora infestans T30-4]
 gb|EEY58734.1| 60S ribosomal protein L32-1 [Phytophthora infestans T30-4]
Length=138

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            V E+WRRPKGID RVRRKFKG   MPNIGYGS+KKTRH LPNGF KFVV+NV ELE+L+M
Sbjct  31   VPESWRRPKGIDGRVRRKFKGAIKMPNIGYGSNKKTRHLLPNGFLKFVVNNVAELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNVS +KR+EI+ERA QL+V VT
Sbjct  91   HNRKYCAEIAHNVSGRKRREIIERAEQLNVRVT  123



>gb|AHA44493.1| 60S ribosomal-like protein [Pectinaria gouldii]
Length=135

 Score =   155 bits (391),  Expect = 9e-46, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK+NWR+PKGID+RVRR+FKG   MPNIGYGS+KKTRH LP+GFKKF+VHNV+ELE+LMM
Sbjct  31   VKQNWRKPKGIDNRVRRRFKGQFKMPNIGYGSNKKTRHMLPDGFKKFLVHNVKELEILMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+TY AEIAHNVS KKRK+IVERA QL + VT
Sbjct  91   TNKTYAAEIAHNVSAKKRKDIVERAQQLAIKVT  123



>ref|XP_008913469.1| hypothetical protein PPTG_17566 [Phytophthora parasitica INRA-310]
 gb|ETI34837.1| hypothetical protein F443_18736 [Phytophthora parasitica P1569]
 gb|ETK75122.1| hypothetical protein L915_18218 [Phytophthora parasitica]
 gb|ETL28548.1| hypothetical protein L916_18122 [Phytophthora parasitica]
 gb|ETL81802.1| hypothetical protein L917_17936 [Phytophthora parasitica]
 gb|ETM35010.1| hypothetical protein L914_18022 [Phytophthora parasitica]
 gb|ETN01142.1| hypothetical protein PPTG_17566 [Phytophthora parasitica INRA-310]
 gb|ETO63580.1| hypothetical protein F444_18734 [Phytophthora parasitica P1976]
 gb|ETP04677.1| hypothetical protein F441_18595 [Phytophthora parasitica CJ01A1]
 gb|ETP32825.1| hypothetical protein F442_18549 [Phytophthora parasitica P10297]
Length=135

 Score =   155 bits (391),  Expect = 1e-45, Method: Compositional matrix adjust.
 Identities = 72/93 (77%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            V E+WRRPKGID RVRRKFKG   MPNIGYGS+KKTRH LPNGF KFVV+NV ELE+L+M
Sbjct  31   VPESWRRPKGIDGRVRRKFKGAIKMPNIGYGSNKKTRHLLPNGFLKFVVNNVAELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNVS +KR+EI+ERA QL+V VT
Sbjct  91   HNRKYCAEIAHNVSGRKRREIIERAEQLNVRVT  123



>ref|XP_001656734.1| AAEL003396-PA [Aedes aegypti]
 gb|ABF18293.1| 60S ribosomal protein L32 [Aedes aegypti]
 gb|EAT45327.1| AAEL003396-PA [Aedes aegypti]
Length=134

 Score =   154 bits (389),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 81/90 (90%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            NWR+PKGID+RVRR+FKG  LMPNIGYGS+K+TRH LPNGFKKF+VHNV+ELE+LMM NR
Sbjct  33   NWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPNGFKKFLVHNVRELEVLMMQNR  92

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             YCAEIAH VS+KKRK+IVERA QL + VT
Sbjct  93   VYCAEIAHAVSSKKRKQIVERAKQLAIAVT  122



>ref|XP_009516675.1| hypothetical protein PHYSODRAFT_353635 [Phytophthora sojae]
 gb|EGZ29400.1| hypothetical protein PHYSODRAFT_353635 [Phytophthora sojae]
Length=135

 Score =   154 bits (389),  Expect = 2e-45, Method: Compositional matrix adjust.
 Identities = 71/93 (76%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            V E+WRRPKGID RVRRKFKG   MPN+GYGS+KKTRH LPNGF KFVV+NV ELE+L+M
Sbjct  31   VPESWRRPKGIDGRVRRKFKGAIKMPNVGYGSNKKTRHLLPNGFLKFVVNNVAELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNVS +KR+EI+ERA QL+V VT
Sbjct  91   HNRKYCAEIAHNVSGRKRREIIERAEQLNVRVT  123



>dbj|BAM76247.1| ribosomal protein [Pinctada fucata]
Length=134

 Score =   153 bits (387),  Expect = 3e-45, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWR+PKGID+RVRR+FKG  LMPNIGYG++KKTRH +P+GFKKF+VHN +ELE+L+M
Sbjct  30   VKANWRKPKGIDNRVRRRFKGQFLMPNIGYGTNKKTRHVMPDGFKKFLVHNTKELEVLLM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NRT+ AEIAHNVS+KKRKEIVERA QL + VT
Sbjct  90   QNRTFSAEIAHNVSSKKRKEIVERAQQLAIKVT  122



>ref|XP_005997880.1| PREDICTED: 60S ribosomal protein L32-like [Latimeria chalumnae]
Length=135

 Score =   153 bits (387),  Expect = 4e-45, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GFKKF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFKKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSYCAEIAHNVSSKNRKTIVERAAQLAIKVT  123



>dbj|BAD26685.1| Ribosomal protein L32 [Plutella xylostella]
Length=134

 Score =   152 bits (385),  Expect = 6e-45, Method: Compositional matrix adjust.
 Identities = 70/93 (75%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   IKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSAKKTRHMLPNGFRKVLVHNVKELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL V VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKAIVERAQQLSVRVT  122



>ref|XP_003224928.1| PREDICTED: 60S ribosomal protein L32 [Anolis carolinensis]
Length=135

 Score =   152 bits (385),  Expect = 8e-45, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GFKKF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFKKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKVT  123



>ref|XP_320915.2| AGAP002122-PA [Anopheles gambiae str. PEST]
 gb|EAA00946.3| AGAP002122-PA [Anopheles gambiae str. PEST]
Length=134

 Score =   152 bits (384),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 70/90 (78%), Positives = 77/90 (86%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            NWRRPKGID+RVRR+FKG  LMPNIGYGS K TRH LP GFKKF+VHNV+ELE+LMM NR
Sbjct  33   NWRRPKGIDNRVRRRFKGQYLMPNIGYGSKKSTRHMLPTGFKKFLVHNVRELEVLMMQNR  92

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  93   VYCAEIAHAVSSKKRKAIVERAKQLAIAVT  122



>sp|Q962T1.1|RL32_SPOFR RecName: Full=60S ribosomal protein L32 [Spodoptera frugiperda]
 gb|AAK92167.1|AF400195_1 ribosomal protein L32 [Spodoptera frugiperda]
 gb|AGC39040.1| ribosomal protein L32 [Helicoverpa armigera]
Length=134

 Score =   152 bits (384),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPNGFRKVLVHNVRELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKTIVERAQQLSIRVT  122



>dbj|BAH20804.1| ribosomal protein L32 [Triops granarius]
Length=134

 Score =   152 bits (383),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            V+ +WR+PKGID+RVRRKFKG  LMPNIGYGS K TRH LPNGFKK +VHN++ELELLMM
Sbjct  30   VRRSWRKPKGIDNRVRRKFKGQYLMPNIGYGSAKATRHLLPNGFKKVLVHNLKELELLMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NRT+CAEIAHN+S++KRK IVERA QL + +T
Sbjct  90   QNRTFCAEIAHNISSRKRKTIVERAKQLSIKIT  122



>ref|XP_011396614.1| 60S ribosomal protein L32-1 [Auxenochlorella protothecoides]
 gb|KFM23738.1| 60S ribosomal protein L32-1 [Auxenochlorella protothecoides]
Length=134

 Score =   152 bits (383),  Expect = 1e-44, Method: Compositional matrix adjust.
 Identities = 72/94 (77%), Positives = 84/94 (89%), Gaps = 1/94 (1%)
 Frame = +3

Query  3    SVKENWRRPKGIDSRVRRKFKGCTL-MPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELL  179
            SVKE+WRRPKGIDSRVRRKFKGC + MPNIGYG++KKTRH LPNGF KF+V NV++LELL
Sbjct  28   SVKESWRRPKGIDSRVRRKFKGCGVTMPNIGYGTNKKTRHVLPNGFLKFIVSNVKDLELL  87

Query  180  MMHNRTYCAEIAHNVSTKKRKEIVERASQLDVVV  281
            ++HNR Y AEIAHNVST KRK IVERA++L+V V
Sbjct  88   LLHNRKYAAEIAHNVSTLKRKAIVERAAELNVNV  121



>ref|NP_001091752.1| ribosomal protein L32 [Bombyx mori]
 gb|AAV34844.1| ribosomal protein L32 [Bombyx mori]
Length=134

 Score =   151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPNGFRKVLVHNVKELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKLIVERAQQLSIRVT  122



>emb|CBN78007.1| conserved unknown protein [Ectocarpus siliculosus]
Length=136

 Score =   151 bits (382),  Expect = 2e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            +WR+PKGID RVRR+FKGC  MPN+GYGSDK+TR+ LPNGF KF+VHNV+ELELL+MHNR
Sbjct  35   SWRKPKGIDGRVRRRFKGCLPMPNVGYGSDKRTRNILPNGFYKFLVHNVKELELLLMHNR  94

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             Y AEIAHNVS++KRKEIVERA QL + VT
Sbjct  95   KYAAEIAHNVSSRKRKEIVERAGQLHIRVT  124



>ref|XP_007423320.1| PREDICTED: 60S ribosomal protein L32-like [Python bivittatus]
Length=135

 Score =   151 bits (381),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSYCAEIAHNVSSKNRKIIVERAAQLAIKVT  123



>ref|XP_007126271.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Physeter catodon]
 ref|XP_007126272.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Physeter catodon]
Length=135

 Score =   151 bits (381),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR+YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNRSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>ref|XP_002592147.1| hypothetical protein BRAFLDRAFT_114866 [Branchiostoma floridae]
 gb|EEN48158.1| hypothetical protein BRAFLDRAFT_114866 [Branchiostoma floridae]
Length=134

 Score =   150 bits (380),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K+NWR+PKGID+RVRR+FKG  LMPNIGYGS KKT+H LP+GFKKF+VHNV +LE+L+M
Sbjct  30   LKQNWRKPKGIDNRVRRRFKGQYLMPNIGYGSAKKTKHLLPSGFKKFLVHNVTDLEVLLM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NRT+CAEIAHNVS++KRK IVERA QL + VT
Sbjct  90   QNRTFCAEIAHNVSSRKRKLIVERAQQLAIKVT  122



>gb|ABS57448.1| ribosomal protein L32 [Heliconius melpomene]
 gb|AEL28887.1| ribosomal protein L32 [Heliconius melpomene cythera]
Length=134

 Score =   150 bits (380),  Expect = 3e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMP+IGYGS+KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPSIGYGSNKKTRHMLPNGFRKVLVHNVKELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKSIVERAQQLSIRVT  122



>ref|XP_006631059.1| PREDICTED: 60S ribosomal protein L32-like [Lepisosteus oculatus]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K+NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+LMM
Sbjct  31   IKKNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+T+CAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKTHCAEIAHNVSSKNRKIIVERAAQLAIKVT  123



>gb|AAO31774.1| ribosomal protein L32 [Branchiostoma belcheri tsingtauense]
Length=134

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K+NWR+PKGID+RVRR+FKG  LMPNIGYGS KKT+H LP+GFKKF+VHNV +LE+L+M
Sbjct  30   LKQNWRKPKGIDNRVRRRFKGQYLMPNIGYGSAKKTKHLLPSGFKKFLVHNVTDLEVLLM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NRT+CAEIAHNVS++KRK IVERA QL + VT
Sbjct  90   QNRTFCAEIAHNVSSRKRKLIVERAQQLAIKVT  122



>ref|XP_009874431.1| PREDICTED: 60S ribosomal protein L32 [Apaloderma vittatum]
 gb|KFP92119.1| 60S ribosomal protein L32 [Apaloderma vittatum]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKIIVERAAQLAIKIT  123



>ref|XP_009938273.1| PREDICTED: 60S ribosomal protein L32 [Opisthocomus hoazin]
 gb|KFR14991.1| 60S ribosomal protein L32 [Opisthocomus hoazin]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_001842889.1| 60S ribosomal protein L32 [Culex quinquefasciatus]
 gb|EDS28732.1| 60S ribosomal protein L32 [Culex quinquefasciatus]
Length=134

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/90 (76%), Positives = 80/90 (89%), Gaps = 0/90 (0%)
 Frame = +3

Query  15   NWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNR  194
            NWR+PKGID+RVRR+FKG  LMPNIGYGS+K+TRH LPNGFKKF+VHNV+ELE+L+M NR
Sbjct  33   NWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKRTRHMLPNGFKKFLVHNVRELEVLLMQNR  92

Query  195  TYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             YCAEIAH V++KKRK IVERA QL + VT
Sbjct  93   VYCAEIAHGVASKKRKLIVERAKQLAIAVT  122



>gb|ABV44758.1| 60S ribosomal protein L32-like protein [Phlebotomus papatasi]
Length=134

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K+ WR+PKGID+RVRR+FKG  LMPNIGYGS+ KTRH LP GFKKF+VHNV+ELE+LMM
Sbjct  30   LKQKWRKPKGIDNRVRRRFKGQFLMPNIGYGSNSKTRHMLPTGFKKFLVHNVRELEVLMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKR++IVERA QL + VT
Sbjct  90   QNRVYCAEIAHGVSSKKRRDIVERAKQLSIRVT  122



>ref|XP_005053373.1| PREDICTED: 60S ribosomal protein L32-like [Ficedula albicollis]
 ref|XP_010219564.1| PREDICTED: 60S ribosomal protein L32 [Tinamus guttatus]
 gb|KGL73171.1| 60S ribosomal protein L32 [Tinamus guttatus]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|NP_001232440.1| putative ribosomal protein L32 [Taeniopygia guttata]
 gb|ACH44828.1| putative ribosomal protein L32 [Taeniopygia guttata]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_010568525.1| PREDICTED: 60S ribosomal protein L32 [Haliaeetus leucocephalus]
 ref|XP_010568533.1| PREDICTED: 60S ribosomal protein L32 [Haliaeetus leucocephalus]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|NP_001232799.1| 60S ribosomal protein L32-like [Taeniopygia guttata]
 ref|NP_001239184.1| ribosomal protein L32 [Gallus gallus]
 ref|XP_003210258.1| PREDICTED: 60S ribosomal protein L32 [Meleagris gallopavo]
 ref|XP_005012109.1| PREDICTED: 60S ribosomal protein L32-like [Anas platyrhynchos]
 ref|XP_005490216.1| PREDICTED: 60S ribosomal protein L32-like [Zonotrichia albicollis]
 ref|XP_005426694.1| PREDICTED: 60S ribosomal protein L32-like [Geospiza fortis]
 ref|XP_005522007.1| PREDICTED: 60S ribosomal protein L32-like [Pseudopodoces humilis]
 ref|XP_006024200.1| PREDICTED: 60S ribosomal protein L32-like [Alligator sinensis]
 ref|XP_006264854.1| PREDICTED: 60S ribosomal protein L32-like [Alligator mississippiensis]
 ref|XP_008632681.1| PREDICTED: 60S ribosomal protein L32 [Corvus brachyrhynchos]
 ref|XP_008924558.1| PREDICTED: 60S ribosomal protein L32 [Manacus vitellinus]
 ref|XP_009097604.1| PREDICTED: 60S ribosomal protein L32 [Serinus canaria]
 ref|XP_009468201.1| PREDICTED: 60S ribosomal protein L32 [Nipponia nippon]
 ref|XP_009819347.1| PREDICTED: 60S ribosomal protein L32 [Gavia stellata]
 ref|XP_009959001.1| PREDICTED: 60S ribosomal protein L32 [Leptosomus discolor]
 ref|XP_010156451.1| PREDICTED: 60S ribosomal protein L32 [Eurypyga helias]
 ref|XP_010186757.1| PREDICTED: 60S ribosomal protein L32 [Mesitornis unicolor]
 ref|XP_010388589.1| PREDICTED: 60S ribosomal protein L32 [Corvus cornix cornix]
 gb|ACH44827.1| putative ribosomal protein L32 [Taeniopygia guttata]
 gb|ACH44829.1| putative ribosomal protein L32 [Taeniopygia guttata]
 gb|KFO59723.1| 60S ribosomal protein L32 [Corvus brachyrhynchos]
 gb|KFP51751.1| 60S ribosomal protein L32 [Cathartes aura]
 gb|KFQ04310.1| 60S ribosomal protein L32 [Leptosomus discolor]
 gb|KFQ38580.1| 60S ribosomal protein L32 [Mesitornis unicolor]
 gb|KFR02378.1| 60S ribosomal protein L32 [Nipponia nippon]
 gb|KFV40263.1| 60S ribosomal protein L32 [Gavia stellata]
 gb|KFW11290.1| 60S ribosomal protein L32 [Eurypyga helias]
 gb|KFW82960.1| 60S ribosomal protein L32 [Manacus vitellinus]
Length=135

 Score =   150 bits (380),  Expect = 4e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_011439989.1| PREDICTED: 60S ribosomal protein L32-like [Crassostrea gigas]
Length=134

 Score =   150 bits (380),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK NWR+PKGID+RVRR+FKG   MPNIGYGS+KKTRH +P+GFKKF++HNV+ELE+L+M
Sbjct  30   VKSNWRKPKGIDNRVRRRFKGQYKMPNIGYGSNKKTRHVMPDGFKKFLIHNVKELEVLLM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NRT+ AEIAHNVS+KKRK+IVERA QL + +T
Sbjct  90   QNRTFAAEIAHNVSSKKRKDIVERAQQLSIKLT  122



>gb|ADO95151.1| ribosomal protein L32 [Antheraea yamamai]
Length=134

 Score =   150 bits (379),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKTRH LP+GF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPSGFRKVLVHNVRELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKAIVERAQQLSIRVT  122



>ref|NP_001279165.1| ribosomal protein L32 [Callorhinchus milii]
 gb|AFK10979.1| 60S ribosomal protein L32-like protein [Callorhinchus milii]
 gb|AFM87378.1| 60S ribosomal protein L32-like protein [Callorhinchus milii]
 gb|AFM88215.1| 60S ribosomal protein L32-like protein [Callorhinchus milii]
Length=135

 Score =   150 bits (379),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF++HN++ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLIHNIKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSYCAEIAHNVSSKNRKLIVERAAQLAIKVT  123



>gb|EHJ73441.1| 60S ribosomal protein L32 [Danaus plexippus]
Length=134

 Score =   150 bits (379),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMP+IGYGS+KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPSIGYGSNKKTRHMLPNGFRKVLVHNVRELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHAVSSKKRKAIVERAQQLSIRVT  122



>ref|XP_005145854.1| PREDICTED: 60S ribosomal protein L32-like [Melopsittacus undulatus]
 ref|XP_005240254.1| PREDICTED: 60S ribosomal protein L32-like [Falco peregrinus]
 ref|XP_005443628.1| PREDICTED: 60S ribosomal protein L32-like [Falco cherrug]
 ref|XP_009282048.1| PREDICTED: 60S ribosomal protein L32 [Aptenodytes forsteri]
 ref|XP_009318373.1| PREDICTED: 60S ribosomal protein L32 [Pygoscelis adeliae]
 ref|XP_009482793.1| PREDICTED: 60S ribosomal protein L32 [Pelecanus crispus]
 ref|XP_009564115.1| PREDICTED: 60S ribosomal protein L32 [Cuculus canorus]
 ref|XP_009679428.1| PREDICTED: 60S ribosomal protein L32 [Struthio camelus australis]
 ref|XP_009632110.1| PREDICTED: 60S ribosomal protein L32 [Egretta garzetta]
 ref|XP_009881172.1| PREDICTED: 60S ribosomal protein L32 [Charadrius vociferus]
 ref|XP_010020595.1| PREDICTED: 60S ribosomal protein L32 [Nestor notabilis]
 ref|XP_010161149.1| PREDICTED: 60S ribosomal protein L32 [Caprimulgus carolinensis]
 ref|XP_010281367.1| PREDICTED: 60S ribosomal protein L32 [Phaethon lepturus]
 ref|XP_010301015.1| PREDICTED: 60S ribosomal protein L32 [Balearica regulorum gibbericeps]
 gb|KFM01352.1| 60S ribosomal protein L32 [Aptenodytes forsteri]
 gb|KFO10989.1| 60S ribosomal protein L32 [Balearica regulorum gibbericeps]
 gb|KFO79810.1| 60S ribosomal protein L32 [Cuculus canorus]
 gb|KFP11867.1| 60S ribosomal protein L32 [Egretta garzetta]
 gb|KFP65419.1| 60S ribosomal protein L32 [Cariama cristata]
 gb|KFQ56749.1| 60S ribosomal protein L32 [Nestor notabilis]
 gb|KFQ62052.1| 60S ribosomal protein L32 [Pelecanus crispus]
 gb|KFQ71749.1| 60S ribosomal protein L32 [Phaethon lepturus]
 gb|KFV84535.1| 60S ribosomal protein L32 [Struthio camelus australis]
 gb|KFW11581.1| 60S ribosomal protein L32 [Fulmarus glacialis]
 gb|KFW64390.1| 60S ribosomal protein L32 [Pygoscelis adeliae]
 gb|KFZ53562.1| 60S ribosomal protein L32 [Caprimulgus carolinensis]
 gb|KGL91526.1| 60S ribosomal protein L32 [Charadrius vociferus]
Length=135

 Score =   150 bits (379),  Expect = 5e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKIIVERAAQLAIKIT  123



>ref|NP_001011414.1| ribosomal protein L32 [Xenopus (Silurana) tropicalis]
 ref|XP_002936292.1| PREDICTED: 60S ribosomal protein L32-like [Xenopus (Silurana) 
tropicalis]
 gb|AAH87976.1| hypothetical LOC496894 [Xenopus (Silurana) tropicalis]
Length=135

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+R RR+FKG  LMPNIGYGS+KKT+H LP GFKKF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRARRRFKGQILMPNIGYGSNKKTKHMLPTGFKKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+T+CAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKTFCAEIAHNVSSKNRKTIVERAAQLAIKVT  123



>ref|XP_001637038.1| predicted protein [Nematostella vectensis]
 gb|EDO44975.1| predicted protein [Nematostella vectensis]
Length=133

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            V E+WR+PKGID+RVRR+FKG  LMPNIGYGS+KKTR  +P+GFKKFVVHNV+ELE+LMM
Sbjct  29   VGESWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRFLMPDGFKKFVVHNVKELEVLMM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR+Y AEIAHNVS++KRK IVERA QL + VT
Sbjct  89   MNRSYAAEIAHNVSSRKRKAIVERAQQLSIKVT  121



>gb|ACY95314.1| ribosomal protein L32 [Manduca sexta]
Length=134

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKTRH LPNGF+K  VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPNGFRKVHVHNVRELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKAIVERAQQLSIRVT  122



>dbj|BAM19062.1| ribosomal protein L32 [Papilio polytes]
Length=134

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 81/93 (87%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMP+IGYGS+KKTRH LPNGF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPRGIDNRVRRRFKGQYLMPSIGYGSNKKTRHMLPNGFRKVLVHNVRELEILMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKYCAEIAHGVSSKKRKTIVERAQQLSIRVT  122



>ref|XP_008499584.1| PREDICTED: 60S ribosomal protein L32 [Calypte anna]
 gb|KFP06693.1| 60S ribosomal protein L32 [Calypte anna]
Length=135

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSSKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_005709176.1| 60S ribosomal protein L32 [Galdieria sulphuraria]
 gb|EME32656.1| 60S ribosomal protein L32 [Galdieria sulphuraria]
Length=133

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VKENWR+PKGID RVRR+FKG TLMPNIGYGSDK+TR+ LPNGF KF+V+NV+ELE L+M
Sbjct  29   VKENWRKPKGIDCRVRRRFKGSTLMPNIGYGSDKRTRYLLPNGFYKFLVNNVKELEALLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR Y AEIAH VS KKRKEI+ERA++L++ VT
Sbjct  89   LNRKYAAEIAHGVSAKKRKEILERAAELNIKVT  121



>gb|ABV60337.1| 60S ribosomal protein L32-like protein [Lutzomyia longipalpis]
Length=134

 Score =   150 bits (379),  Expect = 6e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K+ WR+PKGID+RVRR+FKG  LMPNIGYGS+ KTRH LP GFKKF+VHNV+ELE+LMM
Sbjct  30   LKQKWRKPKGIDNRVRRRFKGQFLMPNIGYGSNSKTRHMLPTGFKKFLVHNVRELEVLMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR YCAEIAH VS+KKR+ IVERA QL + VT
Sbjct  90   QNRVYCAEIAHGVSSKKRRSIVERAKQLSIRVT  122



>ref|XP_004333102.1| ribosomal protein L32, putative [Acanthamoeba castellanii str. 
Neff]
 ref|XP_004338824.1| ribosomal protein L32, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR11089.1| ribosomal protein L32, putative [Acanthamoeba castellanii str. 
Neff]
 gb|ELR16811.1| ribosomal protein L32, putative [Acanthamoeba castellanii str. 
Neff]
Length=133

 Score =   150 bits (378),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            VK +WR+P+GID+RVRRKFKG  +MP IGYGS+KKTRH LPNGF +F V+NV +LELL+M
Sbjct  29   VKTSWRKPRGIDNRVRRKFKGSLIMPKIGYGSNKKTRHMLPNGFHRFRVYNVNDLELLLM  88

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR Y AEIAHNVS+KKR+EI+ERA+QL+V VT
Sbjct  89   HNRKYAAEIAHNVSSKKRREIIERAAQLNVKVT  121



>ref|NP_001087306.1| ribosomal protein L32 [Xenopus laevis]
 gb|AAH78535.1| MGC85374 protein [Xenopus laevis]
 gb|AAH80413.1| MGC85374 protein [Xenopus laevis]
Length=135

 Score =   150 bits (378),  Expect = 7e-44, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+R RR+FKG  LMPNIGYGS+KKT+H LP GFKKF+VHN++ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRARRRFKGQILMPNIGYGSNKKTKHMLPTGFKKFLVHNIKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+++CAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSFCAEIAHNVSSKNRKTIVERAAQLAIKVT  123



>ref|XP_004581376.1| PREDICTED: 60S ribosomal protein L32 [Ochotona princeps]
Length=135

 Score =   150 bits (378),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL V VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAVRVT  123



>ref|XP_006900940.1| PREDICTED: 60S ribosomal protein L32-like [Elephantulus edwardii]
Length=135

 Score =   150 bits (378),  Expect = 8e-44, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 85/93 (91%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            +N++YCAEIAHNVS+K RK IVERA++L + VT
Sbjct  91   YNKSYCAEIAHNVSSKNRKAIVERAARLAIRVT  123



>gb|AAH86909.1| Ribosomal protein L32 [Mus musculus]
Length=135

 Score =   150 bits (378),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 67/93 (72%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVRELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL V VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAVRVT  123



>ref|XP_002921300.1| PREDICTED: 60S ribosomal protein L32 [Ailuropoda melanoleuca]
 ref|XP_011225818.1| PREDICTED: 60S ribosomal protein L32 [Ailuropoda melanoleuca]
 gb|EFB23184.1| hypothetical protein PANDA_010196 [Ailuropoda melanoleuca]
Length=135

 Score =   150 bits (378),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKSIVERAAQLAIRVT  123



>ref|XP_003698444.1| PREDICTED: 60S ribosomal protein L32-like isoform 1 [Apis florea]
 ref|XP_003698445.1| PREDICTED: 60S ribosomal protein L32-like isoform 2 [Apis florea]
 ref|XP_003698446.1| PREDICTED: 60S ribosomal protein L32-like isoform 3 [Apis florea]
 ref|XP_003702457.1| PREDICTED: 60S ribosomal protein L32-like [Megachile rotundata]
 ref|XP_006564378.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Apis mellifera]
 ref|XP_006564379.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Apis mellifera]
 ref|XP_006619828.1| PREDICTED: 60S ribosomal protein L32-like [Apis dorsata]
Length=134

 Score =   149 bits (377),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+PKGID+RVRR+FKG  LMPNIGYGS+KKTRH LP GF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPTGFRKVLVHNVKELEVLMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR +CAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKFCAEIAHGVSSKKRKSIVERAQQLSIRVT  122



>ref|XP_001417185.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
 gb|ABO95478.1| predicted protein, partial [Ostreococcus lucimarinus CCE9901]
Length=111

 Score =   149 bits (376),  Expect = 9e-44, Method: Compositional matrix adjust.
 Identities = 69/93 (74%), Positives = 78/93 (84%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
             + +WRRPKGIDSR RRKFKG   MPNIGYGS KKTRH LPNGF KFVVHNV++L+LL+M
Sbjct  7    AQTSWRRPKGIDSRERRKFKGLPPMPNIGYGSAKKTRHLLPNGFLKFVVHNVKDLDLLLM  66

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            HNR YCAEIAHNV+T+ R  IVERA QL+V VT
Sbjct  67   HNRKYCAEIAHNVATRNRAAIVERARQLNVKVT  99



>gb|ETE71342.1| 60S ribosomal protein L32 [Ophiophagus hannah]
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+++CAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSFCAEIAHNVSSKNRKIIVERAAQLAIKVT  123



>ref|XP_003398978.1| PREDICTED: 60S ribosomal protein L32-like [Bombus terrestris]
 ref|XP_003485519.1| PREDICTED: 60S ribosomal protein L32-like [Bombus impatiens]
Length=134

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/93 (73%), Positives = 80/93 (86%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+PKGID+RVRR+FKG  LMPNIGYGS+KKTRH LP GF+K +VHNV+ELE+LMM
Sbjct  30   LKRNWRKPKGIDNRVRRRFKGQYLMPNIGYGSNKKTRHMLPTGFRKVLVHNVKELEVLMM  89

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             NR +CAEIAH VS+KKRK IVERA QL + VT
Sbjct  90   QNRKFCAEIAHGVSSKKRKSIVERAQQLSIRVT  122



>ref|XP_010749666.1| PREDICTED: 60S ribosomal protein L32 [Larimichthys crocea]
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            + +NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT++ LPNGFKKF+VHNV+ELE+LMM
Sbjct  31   IAKNWRKPRGIDNRVRRRFKGQMLMPNIGYGSNKKTKYMLPNGFKKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+T+CAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKTHCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_006740304.1| PREDICTED: 60S ribosomal protein L32, partial [Leptonychotes 
weddellii]
Length=124

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>gb|ACK76689.1| ribosomal protein L32, partial [Peromyscus polionotus subgriseus]
 gb|ACK76690.1| ribosomal protein L32, partial [Peromyscus maniculatus bairdii]
Length=123

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>ref|NP_000985.1| 60S ribosomal protein L32 [Homo sapiens]
 ref|NP_037358.1| 60S ribosomal protein L32 [Rattus norvegicus]
 ref|NP_742083.1| 60S ribosomal protein L32 [Mus musculus]
 ref|NP_001001636.1| 60S ribosomal protein L32 [Sus scrofa]
 ref|NP_001007074.1| 60S ribosomal protein L32 [Homo sapiens]
 ref|NP_001007075.1| 60S ribosomal protein L32 [Homo sapiens]
 ref|NP_001180502.1| ribosomal protein L32 [Macaca mulatta]
 ref|NP_001239098.1| 60S ribosomal protein L32 [Canis lupus familiaris]
 ref|NP_001270032.1| ribosomal protein L32 [Macaca fascicularis]
 ref|NP_001291859.1| ribosomal protein L32 [Ailuropoda melanoleuca]
 ref|XP_001156825.1| PREDICTED: 60S ribosomal protein L32 [Pan troglodytes]
 ref|XP_002708876.1| PREDICTED: 60S ribosomal protein L32 [Oryctolagus cuniculus]
 ref|XP_002709106.1| PREDICTED: 60S ribosomal protein L32 [Oryctolagus cuniculus]
 ref|XP_002713126.1| PREDICTED: 60S ribosomal protein L32 [Oryctolagus cuniculus]
 ref|XP_002719660.1| PREDICTED: 60S ribosomal protein L32 [Oryctolagus cuniculus]
 ref|XP_002752052.1| PREDICTED: 60S ribosomal protein L32 [Callithrix jacchus]
 ref|XP_002813159.1| PREDICTED: 60S ribosomal protein L32 [Pongo abelii]
 ref|XP_002813160.1| PREDICTED: 60S ribosomal protein L32 [Pongo abelii]
 ref|XP_002817461.1| PREDICTED: 60S ribosomal protein L32 [Pongo abelii]
 ref|XP_003265051.1| PREDICTED: 60S ribosomal protein L32 isoform 2 [Nomascus leucogenys]
 ref|XP_003265053.1| PREDICTED: 60S ribosomal protein L32 isoform 4 [Nomascus leucogenys]
 ref|XP_003409795.1| PREDICTED: 60S ribosomal protein L32 [Loxodonta africana]
 ref|XP_003463238.1| PREDICTED: 60S ribosomal protein L32 [Cavia porcellus]
 ref|XP_003734941.1| PREDICTED: 60S ribosomal protein L32 [Callithrix jacchus]
 ref|XP_003796280.1| PREDICTED: 60S ribosomal protein L32 isoform 1 [Otolemur garnettii]
 ref|XP_003796281.1| PREDICTED: 60S ribosomal protein L32 isoform 2 [Otolemur garnettii]
 ref|XP_003826297.1| PREDICTED: 60S ribosomal protein L32 [Pan paniscus]
 ref|XP_003893468.1| PREDICTED: 60S ribosomal protein L32 [Papio anubis]
 ref|XP_003926233.1| PREDICTED: 60S ribosomal protein L32 [Saimiri boliviensis boliviensis]
 ref|XP_003982553.1| PREDICTED: 60S ribosomal protein L32 [Felis catus]
 ref|XP_004033691.1| PREDICTED: 60S ribosomal protein L32 isoform 1 [Gorilla gorilla 
gorilla]
 ref|XP_004033692.1| PREDICTED: 60S ribosomal protein L32 isoform 2 [Gorilla gorilla 
gorilla]
 ref|XP_004033693.1| PREDICTED: 60S ribosomal protein L32 isoform 3 [Gorilla gorilla 
gorilla]
 ref|XP_004033694.1| PREDICTED: 60S ribosomal protein L32 isoform 4 [Gorilla gorilla 
gorilla]
 ref|XP_004091802.1| PREDICTED: 60S ribosomal protein L32 [Nomascus leucogenys]
 ref|XP_004284348.1| PREDICTED: 60S ribosomal protein L32 [Orcinus orca]
 ref|XP_004411401.1| PREDICTED: 60S ribosomal protein L32-like [Odobenus rosmarus 
divergens]
 ref|XP_004442475.1| PREDICTED: 60S ribosomal protein L32-like [Ceratotherium simum 
simum]
 ref|XP_004443204.1| PREDICTED: 60S ribosomal protein L32 [Ceratotherium simum simum]
 ref|XP_004458948.1| PREDICTED: 60S ribosomal protein L32-like [Dasypus novemcinctus]
 ref|XP_004462782.1| PREDICTED: 60S ribosomal protein L32-like [Dasypus novemcinctus]
 ref|XP_004464540.1| PREDICTED: 60S ribosomal protein L32-like [Dasypus novemcinctus]
 ref|XP_004477289.1| PREDICTED: 60S ribosomal protein L32-like isoform 1 [Dasypus 
novemcinctus]
 ref|XP_004477290.1| PREDICTED: 60S ribosomal protein L32-like isoform 2 [Dasypus 
novemcinctus]
 ref|XP_004613288.1| PREDICTED: 60S ribosomal protein L32 [Sorex araneus]
 ref|XP_004623106.1| PREDICTED: 60S ribosomal protein L32-like [Octodon degus]
 ref|XP_004645673.1| PREDICTED: 60S ribosomal protein L32 [Octodon degus]
 ref|XP_004902748.1| PREDICTED: 60S ribosomal protein L32-like isoform X1 [Heterocephalus 
glaber]
 ref|XP_004902749.1| PREDICTED: 60S ribosomal protein L32-like isoform X2 [Heterocephalus 
glaber]
 ref|XP_004870505.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Heterocephalus 
glaber]
 ref|XP_004870506.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Heterocephalus 
glaber]
 ref|XP_005343173.1| PREDICTED: 60S ribosomal protein L32-like [Microtus ochrogaster]
 ref|XP_005365106.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Microtus ochrogaster]
 ref|XP_005365107.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Microtus ochrogaster]
 ref|XP_005333845.1| PREDICTED: 60S ribosomal protein L32 [Ictidomys tridecemlineatus]
 ref|XP_005387149.1| PREDICTED: 60S ribosomal protein L32 [Chinchilla lanigera]
 ref|XP_005547923.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Macaca fascicularis]
 ref|XP_005565770.1| PREDICTED: 60S ribosomal protein L32-like [Macaca fascicularis]
 ref|XP_005632100.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Canis lupus 
familiaris]
 ref|XP_005632101.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Canis lupus 
familiaris]
 ref|XP_006083880.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Myotis lucifugus]
 ref|XP_006083881.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Myotis lucifugus]
 ref|XP_006160715.1| PREDICTED: 60S ribosomal protein L32 [Tupaia chinensis]
 ref|XP_006758355.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Myotis davidii]
 ref|XP_006758356.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Myotis davidii]
 ref|XP_006758357.1| PREDICTED: 60S ribosomal protein L32 isoform X3 [Myotis davidii]
 ref|XP_006758358.1| PREDICTED: 60S ribosomal protein L32 isoform X4 [Myotis davidii]
 ref|XP_006726926.1| PREDICTED: 60S ribosomal protein L32-like [Leptonychotes weddellii]
 ref|XP_006868730.1| PREDICTED: 60S ribosomal protein L32 [Chrysochloris asiatica]
 ref|XP_006917702.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Pteropus alecto]
 ref|XP_006917703.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Pteropus alecto]
 ref|XP_006987486.1| PREDICTED: 60S ribosomal protein L32-like [Peromyscus maniculatus 
bairdii]
 ref|XP_006998894.1| PREDICTED: 60S ribosomal protein L32-like [Peromyscus maniculatus 
bairdii]
 ref|XP_007075498.1| PREDICTED: 60S ribosomal protein L32 [Panthera tigris altaica]
 ref|XP_007192662.1| PREDICTED: 60S ribosomal protein L32 [Balaenoptera acutorostrata 
scammoni]
 ref|XP_007461621.1| PREDICTED: 60S ribosomal protein L32 [Lipotes vexillifer]
 ref|XP_007463045.1| PREDICTED: 60S ribosomal protein L32-like [Lipotes vexillifer]
 ref|XP_007954938.1| PREDICTED: 60S ribosomal protein L32 [Orycteropus afer afer]
 ref|XP_008002347.1| PREDICTED: 60S ribosomal protein L32 [Chlorocebus sabaeus]
 ref|XP_008009911.1| PREDICTED: 60S ribosomal protein L32 [Chlorocebus sabaeus]
 ref|XP_007972530.1| PREDICTED: 60S ribosomal protein L32 [Chlorocebus sabaeus]
 ref|XP_007983471.1| PREDICTED: 60S ribosomal protein L32 [Chlorocebus sabaeus]
 ref|XP_008073014.1| PREDICTED: 60S ribosomal protein L32 [Tarsius syrichta]
 ref|XP_008150494.1| PREDICTED: 60S ribosomal protein L32 [Eptesicus fuscus]
 ref|XP_008258431.1| PREDICTED: 60S ribosomal protein L32 isoform X1 [Oryctolagus 
cuniculus]
 ref|XP_008696076.1| PREDICTED: 60S ribosomal protein L32 [Ursus maritimus]
 ref|XP_008696077.1| PREDICTED: 60S ribosomal protein L32 [Ursus maritimus]
 ref|XP_009003800.1| PREDICTED: 60S ribosomal protein L32 [Callithrix jacchus]
 ref|XP_009197080.1| PREDICTED: 60S ribosomal protein L32 [Papio anubis]
 ref|XP_010360444.1| PREDICTED: 60S ribosomal protein L32 [Rhinopithecus roxellana]
 ref|XP_010360445.1| PREDICTED: 60S ribosomal protein L32 [Rhinopithecus roxellana]
 ref|XP_010360446.1| PREDICTED: 60S ribosomal protein L32 [Rhinopithecus roxellana]
 ref|XP_010362884.1| PREDICTED: 60S ribosomal protein L32 [Rhinopithecus roxellana]
 ref|XP_010364126.1| PREDICTED: 60S ribosomal protein L32 [Rhinopithecus roxellana]
 ref|XP_010636268.1| PREDICTED: 60S ribosomal protein L32 [Fukomys damarensis]
 ref|XP_010636269.1| PREDICTED: 60S ribosomal protein L32 [Fukomys damarensis]
 ref|XP_011368840.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Pteropus vampyrus]
 ref|XP_011368841.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Pteropus vampyrus]
 ref|XP_011368842.1| PREDICTED: 60S ribosomal protein L32 isoform X2 [Pteropus vampyrus]
 sp|Q6QAT0.3|RL32_PIG RecName: Full=60S ribosomal protein L32 [Sus scrofa]
 sp|Q76KA3.3|RL32_MACFA RecName: Full=60S ribosomal protein L32 [Macaca fascicularis]
 sp|P62912.2|RL32_RAT RecName: Full=60S ribosomal protein L32 [Rattus norvegicus]
 sp|P62910.2|RL32_HUMAN RecName: Full=60S ribosomal protein L32 [Homo sapiens]
 sp|P62911.2|RL32_MOUSE RecName: Full=60S ribosomal protein L32 [Mus musculus]
 sp|E2RKA8.1|RL32_CANFA RecName: Full=60S ribosomal protein L32 [Canis lupus familiaris]
 pdb|2ZKR|YY Chain y, Structure Of A Mammalian Ribosomal 60s Subunit Within 
An 80s Complex Obtained By Docking Homology Models Of The 
Rna And Proteins Into An 8.7 A Cryo-em Map
 pdb|3J3B|EE Chain e, Structure Of The Human 60s Ribosomal Proteins
 pdb|4CXD|EE Chain e, Regulation Of The Mammalian Elongation Cycle By 40s 
Subunit Rolling: A Eukaryotic-specific Ribosome Rearrangement
 pdb|4UPX|EE Chain e, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Pre-like State
 pdb|4UQ1|EE Chain e, Mammalian 80s Hcv-ires Initiation Complex With Eif5b 
Post-like State
 pdb|4W20|EE Chain e, Structure Of The Mammalian 60s Ribosomal Subunit (this 
Entry Contains The Large Ribosomal Proteins)
 pdb|4W22|EE Chain e, Structure Of The 80s Mammalian Ribosome Bound To Eef2 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W25|EE Chain e, Structure Of The Idle Mammalian Ribosome-sec61 Complex 
(this Entry Contains The Large Ribosomal Subunit Proteins)
 pdb|4W27|EE Chain e, Structure Of The Translating Mammalian Ribosome-sec61 
Complex (this Entry Contains The Large Ribosomal Subunit Proteins)
 gb|AAQ15271.1|AF370435_1 PP9932 [Homo sapiens]
 emb|CAA27048.1| unnamed protein product [Homo sapiens]
 emb|CAA29777.1| unnamed protein product [Rattus norvegicus]
 gb|AAC28897.1| ribosomal protein L32-3A [Mus musculus]
 dbj|BAB22032.1| unnamed protein product [Mus musculus]
 dbj|BAB27335.1| unnamed protein product [Mus musculus]
 dbj|BAB28296.1| unnamed protein product [Mus musculus]
 gb|AAH11514.1| Ribosomal protein L32 [Homo sapiens]
 dbj|BAB79469.1| ribosomal protein L32 [Homo sapiens]
 dbj|BAC21646.1| ribosomal protein L32 [Macaca fascicularis]
 dbj|BAC25812.1| unnamed protein product [Mus musculus]
 gb|AAH46339.1| Ribosomal protein L32 [Mus musculus]
 gb|AAH61562.1| Ribosomal protein L32 [Rattus norvegicus]
 gb|AAS55897.1| 60S ribosomal protein L32 [Sus scrofa]
 gb|AAH70209.1| Ribosomal protein L32 [Homo sapiens]
 gb|AAH82797.1| Ribosomal protein L32 [Rattus norvegicus]
 gb|AAX42594.1| ribosomal protein L32 [synthetic construct]
 dbj|BAE28563.1| unnamed protein product [Mus musculus]
 dbj|BAE27419.1| unnamed protein product [Mus musculus]
 dbj|BAE29784.1| unnamed protein product [Mus musculus]
 dbj|BAE40228.1| unnamed protein product [Mus musculus]
 gb|EAW64144.1| ribosomal protein L32, isoform CRA_a [Homo sapiens]
 gb|EAW64145.1| ribosomal protein L32, isoform CRA_a [Homo sapiens]
 gb|ABM82499.1| ribosomal protein L32 [synthetic construct]
 gb|ABM85693.1| ribosomal protein L32 [synthetic construct]
 gb|EDK99538.1| mCG132464 [Mus musculus]
 gb|EDL14093.1| mCG50717 [Mus musculus]
 gb|EDM02141.1| rCG29682, isoform CRA_a [Rattus norvegicus]
 gb|EDM02142.1| rCG29682, isoform CRA_a [Rattus norvegicus]
 dbj|BAG34850.1| unnamed protein product [Homo sapiens]
 gb|AEA39523.1| ribosomal protein L32 [Ailuropoda melanoleuca]
 gb|AEA39574.1| ribosomal protein L32 [Ailuropoda melanoleuca]
 gb|EHB14299.1| 60S ribosomal protein L32 [Heterocephalus glaber]
 gb|EHH54745.1| hypothetical protein EGM_15639 [Macaca fascicularis]
 gb|ELK34383.1| 60S ribosomal protein L32 [Myotis davidii]
 gb|ELW46956.1| 60S ribosomal protein L32 [Tupaia chinensis]
 gb|AIC49626.1| RPL32, partial [synthetic construct]
 gb|KFO27457.1| 60S ribosomal protein L32 [Fukomys damarensis]
 prf||1405339A ribosomal protein L32
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>gb|AAR05874.1| ribosomal protein L32 [Drosophila saltans]
Length=111

 Score =   149 bits (375),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 68/89 (76%), Positives = 79/89 (89%), Gaps = 0/89 (0%)
 Frame = +3

Query  18   WRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMHNRT  197
            WR+PKGID+RVRR+FKG  LMPNIGYGS+++TRH LP GFKKF+VHNV+ELE+L+M NR 
Sbjct  23   WRKPKGIDNRVRRRFKGQYLMPNIGYGSNQRTRHMLPTGFKKFLVHNVRELEVLLMQNRV  82

Query  198  YCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            YCAEIAH VS+KKRKEIVERA QL V VT
Sbjct  83   YCAEIAHGVSSKKRKEIVERAKQLSVRVT  111



>gb|AAX36164.1| ribosomal protein L32 [synthetic construct]
Length=136

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>ref|XP_004692418.1| PREDICTED: 60S ribosomal protein L32 [Condylura cristata]
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNVSSKNRKAIVERAAQLAIRVT  123



>ref|XP_009902351.1| PREDICTED: 60S ribosomal protein L32 [Picoides pubescens]
 gb|KFP29378.1| 60S ribosomal protein L32 [Colius striatus]
 gb|KFV70046.1| 60S ribosomal protein L32 [Picoides pubescens]
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N+++CAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSFCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_005072153.1| PREDICTED: 60S ribosomal protein L32-like [Mesocricetus auratus]
Length=135

 Score =   149 bits (377),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   CNKSYCAEIAHNVSSKNRKSIVERAAQLAIRIT  123



>ref|XP_005066029.1| PREDICTED: 60S ribosomal protein L32, partial [Mesocricetus auratus]
Length=124

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   CNKSYCAEIAHNVSSKNRKSIVERAAQLAIRIT  123



>ref|XP_010140894.1| PREDICTED: 60S ribosomal protein L32 [Buceros rhinoceros silvestris]
 gb|KFO93759.1| 60S ribosomal protein L32 [Buceros rhinoceros silvestris]
Length=135

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 83/93 (89%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVER++QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERSAQLAIKIT  123



>ref|XP_007060005.1| PREDICTED: 60S ribosomal protein L32-like [Chelonia mydas]
 gb|EMP35580.1| 60S ribosomal protein L32 [Chelonia mydas]
Length=135

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 82/93 (88%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+R RR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM
Sbjct  31   IKRNWRKPRGIDNRARRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  91   SNKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  123



>ref|XP_007251555.1| PREDICTED: 60S ribosomal protein L32-like [Astyanax mexicanus]
Length=135

 Score =   149 bits (376),  Expect = 1e-43, Method: Compositional matrix adjust.
 Identities = 66/93 (71%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +++NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GFKKF+V+NV+ELE+LMM
Sbjct  31   IRKNWRKPRGIDNRVRRRFKGQMLMPNIGYGSNKKTKHMLPTGFKKFLVNNVKELEVLMM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHNVS+K RK IVERA+QL + VT
Sbjct  91   SNKSYCAEIAHNVSSKNRKLIVERAAQLAIKVT  123



>ref|XP_009078057.1| PREDICTED: 60S ribosomal protein L32, partial [Acanthisitta chloris]
Length=105

 Score =   148 bits (374),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/92 (71%), Positives = 82/92 (89%), Gaps = 0/92 (0%)
 Frame = +3

Query  9    KENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMMH  188
            + NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP GF+KF+VHNV+ELE+LMM 
Sbjct  2    QRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPTGFRKFLVHNVKELEVLMMS  61

Query  189  NRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
            N++YCAEIAHNVS+K RK IVERA+QL + +T
Sbjct  62   NKSYCAEIAHNVSSKNRKVIVERAAQLAIKIT  93



>ref|XP_006998507.1| PREDICTED: 60S ribosomal protein L32-like [Peromyscus maniculatus 
bairdii]
Length=135

 Score =   149 bits (376),  Expect = 2e-43, Method: Compositional matrix adjust.
 Identities = 65/93 (70%), Positives = 84/93 (90%), Gaps = 0/93 (0%)
 Frame = +3

Query  6    VKENWRRPKGIDSRVRRKFKGCTLMPNIGYGSDKKTRHYLPNGFKKFVVHNVQELELLMM  185
            +K NWR+P+GID+RVRR+FKG  LMPNIGYGS+KKT+H LP+GF+KF+VHNV+ELE+L+M
Sbjct  31   IKRNWRKPRGIDNRVRRRFKGQILMPNIGYGSNKKTKHMLPSGFRKFLVHNVKELEVLLM  90

Query  186  HNRTYCAEIAHNVSTKKRKEIVERASQLDVVVT  284
             N++YCAEIAHN+S+K RK IVERA+QL + VT
Sbjct  91   CNKSYCAEIAHNISSKNRKAIVERAAQLAIRVT  123



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 556016196600