BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020C09 204 bp,

Length=204
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|AAK27969.1|AF242373_1  cysteine protease                             109   9e-27   Ipomoea batatas [batate]
gb|AAF40415.1|AF216784_1  papain-like cysteine proteinase isoform II    108   2e-26   Ipomoea batatas [batate]
gb|AAF61441.1|AF138265_1  papain-like cysteine proteinase isoform II    108   2e-26   Ipomoea batatas [batate]
gb|AAF61440.1|AF138264_1  papain-like cysteine proteinase isoform I     108   2e-26   Ipomoea batatas [batate]
gb|AAF40414.1|AF216783_1  papain-like cysteine proteinase isoform I     108   2e-26   Ipomoea batatas [batate]
gb|AAF40416.1|AF216785_1  papain-like cysteine proteinase isoform...    107   6e-26   Ipomoea batatas [batate]
ref|XP_003606998.1|  Cysteine proteinase                                103   8e-25   Medicago truncatula
gb|ACI04578.1|  cysteine protease-like protein                          103   1e-24   Robinia pseudoacacia [black locust]
ref|XP_011088458.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...    103   2e-24   Sesamum indicum [beniseed]
gb|KDP41743.1|  hypothetical protein JCGZ_26761                         102   2e-24   Jatropha curcas
ref|XP_007131787.1|  hypothetical protein PHAVU_011G041600g             102   2e-24   Phaseolus vulgaris [French bean]
ref|XP_009406357.1|  PREDICTED: cysteine proteinase 1-like              102   3e-24   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002512963.1|  cysteine protease, putative                        102   4e-24   Ricinus communis
ref|XP_003523684.1|  PREDICTED: cysteine proteinase 15A-like            102   4e-24   Glycine max [soybeans]
gb|AIB06024.1|  CP2                                                     102   5e-24   Hevea brasiliensis [jebe]
ref|XP_003539008.1|  PREDICTED: cysteine proteinase RD19a-like          101   5e-24   Glycine max [soybeans]
emb|CDP20652.1|  unnamed protein product                                101   6e-24   Coffea canephora [robusta coffee]
ref|XP_007042077.1|  Papain family cysteine protease                    102   6e-24   
ref|XP_010271520.1|  PREDICTED: cysteine proteinase RD19a-like          101   6e-24   Nelumbo nucifera [Indian lotus]
ref|XP_006362019.1|  PREDICTED: cysteine proteinase RD19a-like          101   6e-24   Solanum tuberosum [potatoes]
gb|AAX19661.1|  cysteine proteinase                                     101   6e-24   Populus tomentosa [Chinese white poplar]
gb|KHG24064.1|  Cysteinease RD19a -like protein                         101   7e-24   Gossypium arboreum [tree cotton]
ref|NP_001241450.1|  uncharacterized protein LOC100778716 precursor     101   7e-24   Glycine max [soybeans]
ref|XP_004230928.1|  PREDICTED: cysteine proteinase RD19a               101   8e-24   Solanum lycopersicum
ref|XP_009602233.1|  PREDICTED: cysteine proteinase RD19a-like          101   8e-24   Nicotiana tomentosiformis
ref|XP_002313770.1|  cysteine proteinase A494 precursor                 101   8e-24   
ref|XP_002280798.2|  PREDICTED: cysteine proteinase 15A                 101   8e-24   Vitis vinifera
gb|KHN45894.1|  Cysteine proteinase RD19a                               101   9e-24   Glycine soja [wild soybean]
gb|ABK92536.1|  unknown                                                 101   9e-24   Populus trichocarpa [western balsam poplar]
ref|XP_004507484.1|  PREDICTED: cysteine proteinase RD19a-like          101   1e-23   Cicer arietinum [garbanzo]
ref|XP_011047717.1|  PREDICTED: cysteine proteinase RD19a               100   1e-23   Populus euphratica
ref|XP_009373025.1|  PREDICTED: cysteine proteinase RD19a-like          100   1e-23   Pyrus x bretschneideri [bai li]
ref|XP_003540987.1|  PREDICTED: cysteine proteinase RD19a-like          100   1e-23   Glycine max [soybeans]
gb|KHN39817.1|  Cysteine proteinase RD19a                               100   2e-23   Glycine soja [wild soybean]
ref|XP_011092831.1|  PREDICTED: cysteine proteinase RD19a-like          100   2e-23   Sesamum indicum [beniseed]
gb|KJB79047.1|  hypothetical protein B456_013G033800                    100   2e-23   Gossypium raimondii
emb|CAE54306.1|  putative papain-like cysteine proteinase               100   2e-23   Gossypium hirsutum [American cotton]
gb|KJB32561.1|  hypothetical protein B456_005G247000                    100   2e-23   Gossypium raimondii
ref|XP_004291404.1|  PREDICTED: cysteine proteinase 15A-like          99.8    3e-23   Fragaria vesca subsp. vesca
gb|ABQ10201.1|  cysteine protease Cp3                                 99.8    3e-23   Actinidia deliciosa [Chinese gooseberry]
gb|EYU37835.1|  hypothetical protein MIMGU_mgv1a008237mg              99.8    3e-23   Erythranthe guttata [common monkey flower]
ref|XP_007136047.1|  hypothetical protein PHAVU_009G013600g           99.8    4e-23   Phaseolus vulgaris [French bean]
gb|AGV54334.1|  cysteine proteinase RD19a-like protein                99.8    4e-23   Phaseolus vulgaris [French bean]
gb|KHN22211.1|  Cysteine proteinase 15A                               99.4    4e-23   Glycine soja [wild soybean]
ref|XP_010061009.1|  PREDICTED: cysteine proteinase RD19a-like        99.4    4e-23   Eucalyptus grandis [rose gum]
ref|XP_002275759.1|  PREDICTED: cysteine proteinase RD19a             99.4    4e-23   Vitis vinifera
gb|KHG15253.1|  Cysteinease RD19a -like protein                       99.4    4e-23   Gossypium arboreum [tree cotton]
ref|XP_010268619.1|  PREDICTED: cysteine proteinase RD19a-like        99.4    4e-23   Nelumbo nucifera [Indian lotus]
ref|XP_004290288.1|  PREDICTED: probable cysteine proteinase A494     99.4    4e-23   Fragaria vesca subsp. vesca
sp|P05993.1|PAPA5_CARPA  RecName: Full=Cysteine proteinase; AltNa...  94.7    4e-23   Carica papaya [mamon]
gb|EYU42593.1|  hypothetical protein MIMGU_mgv1a008336mg              99.4    4e-23   Erythranthe guttata [common monkey flower]
ref|XP_010066197.1|  PREDICTED: probable cysteine proteinase A494     99.4    4e-23   Eucalyptus grandis [rose gum]
ref|XP_009373000.1|  PREDICTED: cysteine proteinase RD19a             99.4    4e-23   Pyrus x bretschneideri [bai li]
ref|XP_007017672.1|  Papain family cysteine protease                  99.4    5e-23   
gb|KDO49483.1|  hypothetical protein CISIN_1g017318mg                 99.4    5e-23   Citrus sinensis [apfelsine]
ref|XP_006487337.1|  PREDICTED: cysteine proteinase RD19a-like        99.4    5e-23   Citrus sinensis [apfelsine]
dbj|BAC41322.1|  hypothetical protein                                 99.0    5e-23   Lotus japonicus
ref|XP_008236965.1|  PREDICTED: cysteine proteinase RD19a             99.0    5e-23   Prunus mume [ume]
ref|XP_008382317.1|  PREDICTED: cysteine proteinase RD19a             99.0    5e-23   
ref|XP_007201310.1|  hypothetical protein PRUPE_ppa007454mg           99.0    6e-23   Prunus persica
ref|NP_001266121.1|  uncharacterized protein LOC101501911 precursor   99.0    6e-23   Cicer arietinum [garbanzo]
gb|AJA74415.1|  cysteine protease                                     99.0    6e-23   Cicer arietinum [garbanzo]
ref|XP_011028940.1|  PREDICTED: cysteine proteinase 15A-like          98.6    7e-23   Populus euphratica
gb|ABF46642.1|  papain-like cysteine proteinase                       99.0    7e-23   Pachysandra terminalis
ref|XP_002510469.1|  cysteine protease, putative                      98.6    7e-23   Ricinus communis
ref|NP_001267989.1|  cysteine protease precursor                      98.6    7e-23   Vitis vinifera
emb|CAE45588.1|  papain-like cysteine proteinase-like protein 1       98.6    8e-23   Lotus japonicus
ref|XP_003607110.1|  Cysteine proteinase                              98.6    8e-23   Medicago truncatula
ref|XP_004150061.1|  PREDICTED: cysteine proteinase RD19a-like        98.6    8e-23   Cucumis sativus [cucumbers]
gb|KHN25410.1|  Cysteine proteinase RD19a                             98.6    8e-23   Glycine soja [wild soybean]
ref|XP_011037175.1|  PREDICTED: cysteine proteinase RD19a-like        98.6    8e-23   Populus euphratica
ref|XP_002305451.2|  cysteine proteinase A494 precursor               98.6    9e-23   
ref|XP_006423403.1|  hypothetical protein CICLE_v10028670mg           98.6    9e-23   Citrus clementina [clementine]
gb|AAR92156.1|  putative cysteine protease 3                          97.8    9e-23   Iris x hollandica [Dutch iris]
ref|XP_003550405.2|  PREDICTED: cysteine proteinase 15A               98.2    1e-22   
dbj|BAF98584.1|  CM0216.500.nc                                        98.2    1e-22   Lotus japonicus
gb|ABK94801.1|  unknown                                               98.2    1e-22   Populus trichocarpa [western balsam poplar]
gb|ABK96580.1|  unknown                                               98.2    1e-22   Populus trichocarpa x Populus deltoides
gb|KEH30505.1|  papain family cysteine protease                       97.8    1e-22   Medicago truncatula
ref|XP_009392632.1|  PREDICTED: cysteine proteinase 1-like            97.8    1e-22   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_008775532.1|  PREDICTED: cysteine proteinase 1-like            97.8    2e-22   Phoenix dactylifera
emb|CAE45589.1|  papain-like cysteine proteinase-like protein 2       97.4    2e-22   Lotus japonicus
ref|XP_008460996.1|  PREDICTED: cysteine proteinase RD19a-like        97.8    2e-22   Cucumis melo [Oriental melon]
ref|XP_010105270.1|  Cysteine proteinase 15A                          97.8    2e-22   Morus notabilis
ref|XP_003589348.1|  Cysteine proteinase                              97.4    2e-22   Medicago truncatula
ref|XP_007160702.1|  hypothetical protein PHAVU_001G009900g           97.4    2e-22   Phaseolus vulgaris [French bean]
gb|AAL69389.1|AF462226_1  putative cysteine proteinase                94.4    2e-22   Narcissus pseudonarcissus
gb|ACM80348.1|  cysteine proteinase                                   97.4    2e-22   Solanum lycopersicum
dbj|BAF98585.1|  CM0216.510.nc                                        97.4    2e-22   Lotus japonicus
dbj|BAF03553.1|  cysteine proteinase CP2                              97.4    2e-22   Phaseolus vulgaris [French bean]
ref|XP_010028631.1|  PREDICTED: cysteine proteinase RD19a-like        97.4    2e-22   Eucalyptus grandis [rose gum]
dbj|BAJ53178.1|  JHL18I08.12                                          97.4    2e-22   Jatropha curcas
gb|AAU81591.1|  cysteine proteinase                                   95.1    2e-22   Petunia x hybrida [garden petunia]
emb|CAA82995.1|  cysteine proteinase                                  97.1    2e-22   Vicia sativa [spring vetch]
sp|P25804.1|CYSP_PEA  RecName: Full=Cysteine proteinase 15A; AltN...  97.1    3e-22   Pisum sativum [garden pea]
ref|XP_002302004.2|  hypothetical protein POPTR_0002s03020g           97.1    3e-22   
ref|XP_006473584.1|  PREDICTED: cysteine proteinase 15A-like          97.1    3e-22   Citrus sinensis [apfelsine]
gb|AAO11786.1|  pre-pro cysteine proteinase                           97.1    3e-22   Vicia faba [broad bean]
gb|AAB67878.1|  pre-pro-cysteine proteinase                           96.7    3e-22   Vicia faba [broad bean]
ref|XP_009376976.1|  PREDICTED: cysteine proteinase RD19a-like        97.4    4e-22   
gb|AAU81589.1|  cysteine proteinase                                   95.9    4e-22   Petunia x hybrida [garden petunia]
ref|XP_011045161.1|  PREDICTED: cysteine proteinase 15A-like          96.7    4e-22   Populus euphratica
gb|KDO84720.1|  hypothetical protein CISIN_1g017548mg                 96.7    4e-22   Citrus sinensis [apfelsine]
emb|CDQ51995.1|  Cysteine proteinase                                  94.0    5e-22   Fagus sylvatica
ref|XP_006435090.1|  hypothetical protein CICLE_v10001559mg           96.3    5e-22   Citrus clementina [clementine]
ref|XP_003607150.1|  Cysteine proteinase                              95.9    6e-22   
gb|AES89347.2|  papain family cysteine protease                       95.9    6e-22   Medicago truncatula
ref|XP_010672379.1|  PREDICTED: cysteine proteinase RD19a-like        96.3    6e-22   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009376977.1|  PREDICTED: cysteine proteinase RD19a-like        97.1    6e-22   
ref|XP_009109502.1|  PREDICTED: cysteine proteinase RD19a-like        96.3    6e-22   Brassica rapa
ref|XP_003545051.1|  PREDICTED: cysteine proteinase 15A-like          96.3    6e-22   Glycine max [soybeans]
ref|XP_009146338.1|  PREDICTED: cysteine proteinase 15A-like          95.9    6e-22   Brassica rapa
gb|AAD29084.1|AF082181_1  cysteine proteinase precursor               95.9    6e-22   Solanum melongena [aubergine]
ref|XP_002280808.2|  PREDICTED: cysteine proteinase 15A               95.9    7e-22   Vitis vinifera
gb|KGN43159.1|  Papain-like cysteine proteinase isoform I             95.9    7e-22   Cucumis sativus [cucumbers]
ref|XP_004148554.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  95.9    7e-22   
ref|XP_004165230.1|  PREDICTED: cysteine proteinase RD19a-like        95.9    8e-22   
gb|KJB07487.1|  hypothetical protein B456_001G026600                  95.9    9e-22   Gossypium raimondii
ref|XP_002880378.1|  hypothetical protein ARALYDRAFT_481008           95.5    9e-22   Arabidopsis lyrata subsp. lyrata
gb|AIB06025.1|  CP3                                                   95.5    9e-22   Hevea brasiliensis [jebe]
gb|AAL05851.1|AF411121_1  cysteine proteinase precursor               95.5    9e-22   Sandersonia aurantiaca [Chinese-lantern lily]
gb|ABK96252.1|  unknown                                               92.8    1e-21   Populus trichocarpa x Populus deltoides
emb|CDY34441.1|  BnaC01g21920D                                        95.5    1e-21   Brassica napus [oilseed rape]
ref|XP_010531457.1|  PREDICTED: probable cysteine proteinase A494     95.5    1e-21   Tarenaya hassleriana [spider flower]
gb|AAM65162.1|  cysteine proteinase RD19A                             95.1    1e-21   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010530325.1|  PREDICTED: cysteine proteinase RD19a             95.1    1e-21   Tarenaya hassleriana [spider flower]
ref|XP_002306900.1|  hypothetical protein POPTR_0005s25540g           95.1    1e-21   
ref|XP_008448073.1|  PREDICTED: cysteine proteinase RD19a-like        95.1    2e-21   Cucumis melo [Oriental melon]
ref|XP_009351218.1|  PREDICTED: cysteine proteinase RD19a-like        94.4    2e-21   Pyrus x bretschneideri [bai li]
emb|CAB17075.1|  cysteine proteinase precursor                        94.7    2e-21   Phaseolus vulgaris [French bean]
ref|XP_008387995.1|  PREDICTED: cysteine proteinase 15A               94.7    2e-21   Malus domestica [apple tree]
ref|XP_010910124.1|  PREDICTED: cysteine proteinase 1-like            94.7    2e-21   Elaeis guineensis
gb|ACK57563.1|  cysteine protease-like protein                        94.4    2e-21   Arachis hypogaea [goober]
ref|XP_009611293.1|  PREDICTED: cysteine proteinase 15A-like          94.4    3e-21   Nicotiana tomentosiformis
dbj|BAD94010.1|  drought-inducible cysteine proteinase RD19A prec...  89.7    3e-21   Arabidopsis thaliana [mouse-ear cress]
gb|AAK07731.1|  CPR2-like cysteine proteinase                         94.4    3e-21   Nicotiana tabacum [American tobacco]
ref|XP_006404590.1|  hypothetical protein EUTSA_v10000210mg           94.4    3e-21   Eutrema salsugineum [saltwater cress]
emb|CAA78361.1|  tobacco pre-pro-cysteine proteinase                  94.0    3e-21   Nicotiana tabacum [American tobacco]
emb|CDX98179.1|  BnaC07g09190D                                        89.4    3e-21   
emb|CAA78365.1|  tobacco pre-pro-cysteine proteinase                  94.0    4e-21   Nicotiana tabacum [American tobacco]
emb|CDY09707.1|  BnaC07g33540D                                        94.0    4e-21   Brassica napus [oilseed rape]
ref|XP_004238314.1|  PREDICTED: cysteine proteinase 15A               94.0    4e-21   
emb|CAB53397.1|  cysteine protease                                    92.4    4e-21   Medicago sativa [alfalfa]
ref|XP_006828787.1|  hypothetical protein AMTR_s00001p00114210        93.6    5e-21   
gb|KJB29611.1|  hypothetical protein B456_005G110200                  93.6    5e-21   Gossypium raimondii
gb|KHN12668.1|  Cysteine proteinase 15A                               90.9    5e-21   Glycine soja [wild soybean]
ref|XP_006341997.1|  PREDICTED: cysteine proteinase 15A-like          93.6    5e-21   Solanum tuberosum [potatoes]
emb|CDX99593.1|  BnaC04g33500D                                        93.2    5e-21   
dbj|BAA92495.1|  cysteine protease                                    93.2    6e-21   Vigna mungo [urad dal]
gb|AAQ81938.1|  cysteine proteinase precursor                         93.2    6e-21   Ipomoea batatas [batate]
ref|XP_008221329.1|  PREDICTED: cysteine proteinase 15A-like          93.2    7e-21   Prunus mume [ume]
gb|ABK93575.1|  unknown                                               90.5    8e-21   Populus trichocarpa [western balsam poplar]
ref|XP_010440192.1|  PREDICTED: cysteine proteinase RD19a-like        92.8    8e-21   Camelina sativa [gold-of-pleasure]
ref|XP_009776238.1|  PREDICTED: cysteine proteinase 15A-like          92.8    8e-21   Nicotiana sylvestris
emb|CDY15894.1|  BnaA04g12170D                                        92.8    8e-21   Brassica napus [oilseed rape]
ref|XP_009140277.1|  PREDICTED: probable cysteine proteinase A494     92.8    9e-21   Brassica rapa
gb|KHG15062.1|  Cysteinease RD19a -like protein                       92.8    1e-20   Gossypium arboreum [tree cotton]
ref|XP_009405542.1|  PREDICTED: cysteine proteinase 1-like            92.8    1e-20   Musa acuminata subsp. malaccensis [pisang utan]
dbj|BAF46302.1|  cysteine proteinase precursor                        92.8    1e-20   Ipomoea nil [qian niu]
gb|AJP16692.1|  cysteine protease                                     89.7    1e-20   Striga hermonthica [purple witchweed]
ref|XP_006283963.1|  hypothetical protein CARUB_v10005086mg           92.4    1e-20   Capsella rubella
ref|XP_010434865.1|  PREDICTED: cysteine proteinase 15A-like          92.4    1e-20   Camelina sativa [gold-of-pleasure]
dbj|BAD43619.1|  putative cysteine proteinase                         92.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_565512.1|  Papain family cysteine protease                     92.4    1e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CDX90537.1|  BnaA03g42440D                                        92.0    2e-20   
emb|CAA52403.1|  putative thiol protease                              92.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009136751.1|  PREDICTED: cysteine proteinase RD19a-like        92.0    2e-20   Brassica rapa
ref|XP_010449835.1|  PREDICTED: cysteine proteinase 15A-like          92.0    2e-20   Camelina sativa [gold-of-pleasure]
ref|XP_006414378.1|  hypothetical protein EUTSA_v10025521mg           92.0    2e-20   Eutrema salsugineum [saltwater cress]
ref|XP_003574963.1|  PREDICTED: cysteine proteinase 1-like            92.0    2e-20   Brachypodium distachyon [annual false brome]
ref|XP_006283974.1|  hypothetical protein CARUB_v10005098mg           92.0    2e-20   Capsella rubella
ref|NP_568052.1|  cysteine proteinase RD19a                           92.0    2e-20   Arabidopsis thaliana [mouse-ear cress]
emb|CAA78403.1|  pre-pro-cysteine proteinase                          91.7    2e-20   Solanum lycopersicum
ref|XP_007223351.1|  hypothetical protein PRUPE_ppa007441mg           92.0    2e-20   Prunus persica
gb|EPS70818.1|  cysteine proteinase                                   91.7    2e-20   Genlisea aurea
emb|CDY71205.1|  BnaCnng71840D                                        91.7    3e-20   Brassica napus [oilseed rape]
gb|ABK24153.1|  unknown                                               92.0    3e-20   Picea sitchensis
gb|AAL60581.1|AF454959_1  senescence-associated cysteine protease     91.7    3e-20   Brassica oleracea
gb|ACX54787.2|  cysteine protease                                     91.7    3e-20   Arachis diogoi
ref|XP_010437007.1|  PREDICTED: cysteine proteinase RD19a-like        91.7    3e-20   Camelina sativa [gold-of-pleasure]
gb|KFK24413.1|  hypothetical protein AALP_AAs58848U000200             91.7    3e-20   Arabis alpina [alpine rockcress]
ref|XP_010431862.1|  PREDICTED: cysteine proteinase RD19a             91.7    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_010446443.1|  PREDICTED: cysteine proteinase RD19a             91.3    3e-20   Camelina sativa [gold-of-pleasure]
ref|XP_008775280.1|  PREDICTED: cysteine proteinase 1-like            91.3    3e-20   Phoenix dactylifera
gb|KJB58164.1|  hypothetical protein B456_009G197400                  91.3    4e-20   Gossypium raimondii
ref|XP_009335626.1|  PREDICTED: cysteine proteinase 15A               90.9    4e-20   Pyrus x bretschneideri [bai li]
gb|AAB62937.1|  stress-induced cysteine proteinase                    89.0    5e-20   Lavatera thuringiaca
ref|XP_008444769.1|  PREDICTED: cysteine proteinase RD19a-like        90.9    5e-20   Cucumis melo [Oriental melon]
ref|XP_011083631.1|  PREDICTED: cysteine proteinase 15A-like          90.9    5e-20   Sesamum indicum [beniseed]
gb|EYU27644.1|  hypothetical protein MIMGU_mgv1a008452mg              90.9    5e-20   Erythranthe guttata [common monkey flower]
ref|XP_002452058.1|  hypothetical protein SORBIDRAFT_04g017830        90.5    7e-20   Sorghum bicolor [broomcorn]
gb|KFK30492.1|  hypothetical protein AALP_AA7G268600                  90.5    7e-20   Arabis alpina [alpine rockcress]
ref|XP_006411706.1|  hypothetical protein EUTSA_v10025494mg           90.5    7e-20   Eutrema salsugineum [saltwater cress]
emb|CDP07452.1|  unnamed protein product                              90.5    8e-20   Coffea canephora [robusta coffee]
ref|XP_004952477.1|  PREDICTED: cysteine proteinase 1-like            90.1    8e-20   Setaria italica
ref|NP_567489.1|  papain family cysteine protease                     90.1    9e-20   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010943608.1|  PREDICTED: cysteine proteinase 1-like            90.1    1e-19   Elaeis guineensis
dbj|BAG16515.1|  putative cysteine proteinase                         90.1    1e-19   Capsicum chinense [bonnet pepper]
ref|XP_003579573.2|  PREDICTED: cysteine proteinase 1-like            90.1    1e-19   Brachypodium distachyon [annual false brome]
gb|EEE60725.1|  hypothetical protein OsJ_14236                        89.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|XP_004152668.1|  PREDICTED: cysteine proteinase RD19a-like        89.7    1e-19   Cucumis sativus [cucumbers]
ref|XP_002870174.1|  hypothetical protein ARALYDRAFT_915142           89.7    1e-19   Arabidopsis lyrata subsp. lyrata
emb|CAQ00101.1|  papain-like cysteine proteinase                      89.7    1e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CAD40319.2|  OSJNBb0054B09.3                                      89.7    1e-19   Oryza sativa Japonica Group [Japonica rice]
ref|NP_001105685.1|  cysteine proteinase 1 precursor                  89.4    2e-19   Zea mays [maize]
gb|ACF86683.1|  unknown                                               89.4    2e-19   Zea mays [maize]
gb|EMT10192.1|  Cysteine proteinase 1                                 89.4    2e-19   
gb|EMT16425.1|  Cysteine proteinase 1                                 89.7    2e-19   
gb|EAY93546.1|  hypothetical protein OsI_15336                        89.0    2e-19   Oryza sativa Indica Group [Indian rice]
emb|CAH59428.1|  cysteine protease 2                                  88.2    2e-19   Plantago major [cart-track plant]
ref|XP_002868883.1|  hypothetical protein ARALYDRAFT_490677           89.0    2e-19   
tpe|CAD66657.1|  TPA: putative cysteine proteinase precursor          89.0    2e-19   Hordeum vulgare subsp. vulgare [two-rowed barley]
emb|CDY41960.1|  BnaA01g05320D                                        88.6    3e-19   Brassica napus [oilseed rape]
gb|AAZ32411.1|  cysteine proteinase glycinain type                    88.2    4e-19   Nicotiana benthamiana
gb|EPS65881.1|  cysteine proteinase                                   88.2    4e-19   Genlisea aurea
ref|XP_006653265.1|  PREDICTED: cysteine proteinase 1-like            88.6    4e-19   
gb|ABK21238.1|  unknown                                               88.2    5e-19   Picea sitchensis
gb|ABK24688.1|  unknown                                               88.2    5e-19   Picea sitchensis
gb|ACN40679.1|  unknown                                               88.2    5e-19   Picea sitchensis
gb|EMS53996.1|  Cysteine proteinase 1                                 88.6    6e-19   Triticum urartu
gb|AAW21813.1|  cysteine protease                                     87.8    6e-19   Triticum aestivum [Canadian hard winter wheat]
ref|XP_009150026.1|  PREDICTED: cysteine proteinase RD19a             87.8    6e-19   Brassica rapa
gb|EMS64962.1|  Cysteine proteinase 1                                 87.4    6e-19   Triticum urartu
gb|AAB16996.1|  thiol protease isoform B                              86.7    1e-18   Glycine max [soybeans]
ref|NP_001046828.1|  Os02g0469600                                     87.0    1e-18   
ref|XP_009786000.1|  PREDICTED: cysteine proteinase RD19a-like        87.0    1e-18   Nicotiana sylvestris
ref|XP_006665032.1|  PREDICTED: cysteine proteinase 1-like            85.5    1e-18   
ref|XP_004975256.1|  PREDICTED: cysteine proteinase 1-like            87.0    2e-18   Setaria italica
ref|XP_002279862.1|  PREDICTED: cysteine proteinase RD19a             86.3    2e-18   Vitis vinifera
emb|CAA57675.1|  cysteine proteinase                                  83.6    2e-18   Zea mays [maize]
gb|AGS43121.1|  cysteine protease 1                                   82.4    2e-18   Zea mays [maize]
ref|NP_001059639.1|  Os07g0480900                                     85.1    7e-18   
gb|AAB16997.1|  thiol protease isoform A                              84.3    8e-18   Glycine max [soybeans]
ref|NP_001052440.1|  Os04g0311400                                     85.1    9e-18   
dbj|BAD10859.1|  cysteine protease                                    84.3    1e-17   Tripolium pannonicum [sea starwort]
ref|XP_002460693.1|  hypothetical protein SORBIDRAFT_02g033270        84.3    1e-17   Sorghum bicolor [broomcorn]
ref|XP_006658557.1|  PREDICTED: LOW QUALITY PROTEIN: cysteine pro...  83.2    3e-17   Oryza brachyantha
gb|AEX97108.1|  cysteine proteinase                                   80.5    3e-17   Malus domestica [apple tree]
ref|XP_009404192.1|  PREDICTED: cysteine proteinase 15A               82.8    4e-17   
emb|CAQ00102.1|  papain-like cysteine proteinase                      82.8    5e-17   Hordeum vulgare subsp. vulgare [two-rowed barley]
ref|XP_002960585.1|  hypothetical protein SELMODRAFT_266583           82.4    5e-17   
ref|XP_002969223.1|  hypothetical protein SELMODRAFT_91274            82.4    7e-17   
ref|XP_004959670.1|  PREDICTED: cysteine proteinase 1-like            82.4    7e-17   Setaria italica
tpg|DAA40800.1|  TPA: putative cysteine protease family protein       82.0    1e-16   
ref|XP_009117680.1|  PREDICTED: probable cysteine proteinase A494     81.3    2e-16   Brassica rapa
ref|XP_010690815.1|  PREDICTED: cysteine proteinase RD19a             81.6    2e-16   Beta vulgaris subsp. vulgaris [field beet]
gb|EMS59778.1|  Cysteine proteinase 15A                               79.7    2e-16   Triticum urartu
ref|XP_006293095.1|  hypothetical protein CARUB_v10019394mg           81.3    2e-16   Capsella rubella
ref|XP_008776953.1|  PREDICTED: cysteine proteinase-like              78.6    2e-16   Phoenix dactylifera
dbj|BAC57957.1|  thiol protease                                       79.0    3e-16   Tripolium pannonicum [sea starwort]
ref|XP_010504326.1|  PREDICTED: cysteine proteinase 15A-like          80.9    3e-16   Camelina sativa [gold-of-pleasure]
ref|XP_002876278.1|  hypothetical protein ARALYDRAFT_485911           80.5    3e-16   
ref|XP_008362714.1|  PREDICTED: cysteine proteinase 15A               80.5    3e-16   
gb|KEH43476.1|  papain family cysteine protease                       80.5    3e-16   Medicago truncatula
ref|XP_008804021.1|  PREDICTED: cysteine proteinase RD19a-like        79.0    4e-16   Phoenix dactylifera
gb|KFK34737.1|  hypothetical protein AALP_AA5G186400                  79.7    6e-16   Arabis alpina [alpine rockcress]
ref|XP_010918606.1|  PREDICTED: probable cysteine proteinase A494     79.3    1e-15   Elaeis guineensis
ref|XP_003560213.1|  PREDICTED: cysteine proteinase 1                 79.0    1e-15   Brachypodium distachyon [annual false brome]
ref|XP_008802783.1|  PREDICTED: probable cysteine proteinase A494     79.0    1e-15   Phoenix dactylifera
gb|ABY75169.1|  cysteine protease                                     73.9    1e-15   Arachis diogoi
ref|XP_007218137.1|  hypothetical protein PRUPE_ppa007240mg           78.6    2e-15   Prunus persica
emb|CAB16316.1|  cysteine proteinase precursor                        78.6    2e-15   Vicia sativa [spring vetch]
gb|AAB53103.1|  cysteine protease                                     74.3    2e-15   Brassica napus [oilseed rape]
gb|EEC82027.1|  hypothetical protein OsI_25996                        79.3    4e-15   Oryza sativa Indica Group [Indian rice]
ref|XP_008354070.1|  PREDICTED: cysteine proteinase 15A-like          76.6    4e-15   
emb|CDY13816.1|  BnaA09g43180D                                        76.6    4e-15   Brassica napus [oilseed rape]
ref|XP_001781954.1|  predicted protein                                77.4    4e-15   
ref|XP_010534431.1|  PREDICTED: cysteine proteinase 15A               77.4    5e-15   Tarenaya hassleriana [spider flower]
emb|CAB41090.1|  cysteine proteinase precursor-like protein           77.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|NP_567010.5|  Papain family cysteine protease                     77.0    6e-15   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010243268.1|  PREDICTED: cysteine proteinase 15A               76.6    8e-15   Nelumbo nucifera [Indian lotus]
gb|KJB73490.1|  hypothetical protein B456_011G235500                  77.0    9e-15   Gossypium raimondii
gb|KHG08355.1|  Cysteinease 1                                         76.3    1e-14   Gossypium arboreum [tree cotton]
ref|XP_004496226.1|  PREDICTED: cysteine proteinase 15A-like          76.6    1e-14   Cicer arietinum [garbanzo]
gb|EYU39642.1|  hypothetical protein MIMGU_mgv1a008552mg              76.3    1e-14   Erythranthe guttata [common monkey flower]
gb|AEQ54770.1|  cysteine proteinase CP1                               76.3    2e-14   Coffea canephora [robusta coffee]
gb|KHN00877.1|  Cysteine proteinase 15A                               75.5    2e-14   Glycine soja [wild soybean]
ref|XP_006403513.1|  hypothetical protein EUTSA_v10010475mg           75.5    2e-14   Eutrema salsugineum [saltwater cress]
ref|XP_001761980.1|  predicted protein                                75.5    3e-14   
ref|XP_008233261.1|  PREDICTED: cysteine proteinase 15A               75.1    3e-14   
ref|XP_008446834.1|  PREDICTED: cysteine proteinase 15A               75.1    4e-14   
ref|XP_009116190.1|  PREDICTED: probable cysteine proteinase A494     74.7    4e-14   
ref|XP_007143764.1|  hypothetical protein PHAVU_007G099600g           75.1    5e-14   
ref|XP_004142497.1|  PREDICTED: cysteine proteinase 15A-like          74.7    7e-14   
ref|XP_004157559.1|  PREDICTED: cysteine proteinase 15A-like          74.7    7e-14   
ref|XP_009789260.1|  PREDICTED: cysteine proteinase 15A               74.3    7e-14   
emb|CAB17077.1|  cysteine proteinase precursor                        74.3    7e-14   
emb|CDO99795.1|  unnamed protein product                              74.3    8e-14   
gb|KHN37802.1|  Cysteine proteinase 1                                 73.6    9e-14   
ref|XP_009617441.1|  PREDICTED: cysteine proteinase 15A               73.9    1e-13   
gb|KDP30486.1|  hypothetical protein JCGZ_16165                       73.9    1e-13   
gb|AAD46920.1|AF167986_1  putative cysteine proteinase GmPM33         73.6    1e-13   
ref|NP_001236888.1|  cysteine proteinase precursor                    73.6    1e-13   
ref|XP_010034320.1|  PREDICTED: cysteine proteinase 1                 73.2    2e-13   
ref|XP_006436511.1|  hypothetical protein CICLE_v10031865mg           72.4    3e-13   
gb|ADY04293.1|  cysteine protease                                     70.1    4e-13   
ref|XP_010103534.1|  putative cysteine proteinase A494                72.4    4e-13   
gb|ADY04361.1|  cysteine protease                                     69.3    6e-13   
ref|XP_011094506.1|  PREDICTED: cysteine proteinase 15A               71.6    6e-13   
gb|ADY04358.1|  cysteine protease                                     69.3    6e-13   
gb|ADY04342.1|  cysteine protease                                     69.3    6e-13   
gb|ADY04336.1|  cysteine protease                                     69.3    6e-13   
gb|ADY04457.1|  cysteine protease                                     69.3    7e-13   
gb|ADY04262.1|  cysteine protease                                     69.3    7e-13   
gb|ADY04414.1|  cysteine protease                                     69.3    7e-13   
emb|CDY56961.1|  BnaA09g55030D                                        71.2    8e-13   
gb|ADE76932.1|  unknown                                               71.6    8e-13   
emb|CDX73424.1|  BnaC08g25790D                                        71.2    8e-13   
gb|ADY04359.1|  cysteine protease                                     68.9    8e-13   
ref|XP_004250044.1|  PREDICTED: cysteine proteinase 15A               71.6    8e-13   
emb|CBI31400.3|  unnamed protein product                              69.7    1e-12   
gb|ADY04482.1|  cysteine protease                                     68.6    1e-12   
gb|EPS63354.1|  hypothetical protein M569_11429                       70.5    1e-12   
gb|ADY04368.1|  cysteine protease                                     68.2    2e-12   
gb|AEW08440.1|  hypothetical protein 2_9845_02                        66.2    2e-12   
ref|XP_011024366.1|  PREDICTED: cysteine proteinase 15A               70.5    2e-12   
gb|ADY04480.1|  cysteine protease                                     68.2    2e-12   
gb|ADY04268.1|  cysteine protease                                     67.8    2e-12   
ref|XP_002266821.1|  PREDICTED: cysteine proteinase 15A               70.1    2e-12   
gb|ADY04295.1|  cysteine protease                                     67.4    4e-12   
ref|XP_011469621.1|  PREDICTED: cysteine proteinase 15A-like          67.4    5e-12   
ref|XP_010688493.1|  PREDICTED: cysteine proteinase 15A               68.6    8e-12   
ref|XP_002316398.1|  hypothetical protein POPTR_0010s23510g           68.2    9e-12   
ref|XP_006361690.1|  PREDICTED: cysteine proteinase 15A-like          68.6    1e-11   
ref|XP_002533377.1|  cysteine protease, putative                      68.2    1e-11   
emb|CAN64491.1|  hypothetical protein VITISV_015725                   66.6    2e-11   
ref|XP_007010012.1|  Papain family cysteine protease                  67.4    3e-11   
ref|XP_006850211.1|  hypothetical protein AMTR_s00022p00251800        66.6    3e-11   
ref|XP_011052455.1|  PREDICTED: LOW QUALITY PROTEIN: uncharacteri...  67.8    4e-11   
gb|EGI66903.1|  Putative cysteine proteinase                          67.8    4e-11   
ref|XP_002988513.1|  hypothetical protein SELMODRAFT_128220           63.5    7e-11   
gb|KIH48456.1|  cysteine proteinase family protein                    62.0    7e-11   
emb|CBY11269.1|  unnamed protein product                              65.9    7e-11   
ref|XP_011169692.1|  PREDICTED: putative cysteine proteinase CG12163  67.0    8e-11   
gb|EYC18288.1|  hypothetical protein Y032_0028g1777                   62.4    9e-11   
ref|XP_003707276.1|  PREDICTED: uncharacterized protein LOC100880620  66.6    1e-10   
ref|XP_002979143.1|  hypothetical protein SELMODRAFT_110288           63.5    1e-10   
gb|KHN72698.1|  Putative cysteine proteinase                          62.4    1e-10   
gb|ERG79645.1|  cysteine proteinase                                   62.0    2e-10   
gb|EFN80374.1|  Putative cysteine proteinase CG12163                  66.2    2e-10   
ref|XP_011145705.1|  PREDICTED: uncharacterized protein LOC105186896  66.2    2e-10   
gb|AFM37363.1|  cathepsin F1                                          65.5    2e-10   
dbj|BAD94378.1|  hypothetical protein                                 60.8    2e-10   
gb|KFB38327.1|  AGAP002879-PB-like protein                            66.2    2e-10   
ref|XP_003436277.1|  AGAP002879-PB                                    65.9    2e-10   
ref|XP_312034.5|  AGAP002879-PA                                       65.9    2e-10   
emb|CBY31096.1|  unnamed protein product                              63.9    3e-10   
ref|XP_007510080.1|  unknown                                          64.7    4e-10   
ref|XP_001607324.1|  PREDICTED: uncharacterized protein LOC100123649  65.1    4e-10   
ref|XP_011331416.1|  PREDICTED: uncharacterized protein LOC105275911  64.7    5e-10   
gb|EZA58965.1|  Putative cysteine proteinase                          64.3    6e-10   
ref|XP_005184486.1|  PREDICTED: putative cysteine proteinase CG12...  64.3    6e-10   
emb|CDJ88889.1|  Proteinase inhibitor I25 and Proteinase inhibito...  63.9    6e-10   
ref|XP_011493714.1|  AAEL017153-PA                                    64.7    6e-10   
emb|CDJ92562.1|  Proteinase inhibitor I25 and Proteinase inhibito...  63.9    6e-10   
ref|XP_005184487.1|  PREDICTED: putative cysteine proteinase CG12...  64.3    7e-10   
ref|XP_009111689.1|  PREDICTED: thiol protease aleurain-like          62.8    7e-10   
ref|XP_011184040.1|  PREDICTED: putative cysteine proteinase CG12163  64.3    7e-10   
ref|XP_003115597.1|  CRE-TAG-196 protein                              63.5    8e-10   
gb|AAO12867.1|  papain-like cysteine proteinase                       58.9    8e-10   
ref|XP_003148243.1|  hypothetical protein LOAG_12683                  61.2    8e-10   
gb|EFO15826.2|  hypothetical protein LOAG_12683                       61.2    9e-10   
emb|CDY19784.1|  BnaA09g04370D                                        61.2    9e-10   
gb|ETN61472.1|  hypothetical protein AND_006867                       63.9    1e-09   
ref|XP_004519757.1|  PREDICTED: putative cysteine proteinase CG12...  63.5    1e-09   
ref|XP_011203808.1|  PREDICTED: putative cysteine proteinase CG12163  63.5    1e-09   
ref|XP_001844355.1|  conserved hypothetical protein                   63.9    1e-09   
ref|XP_002682087.1|  predicted protein                                62.4    1e-09   
ref|XP_003378245.1|  cathepsin F                                      62.4    1e-09   
emb|CCA95098.1|  putative responsive to dehydration 19                60.5    1e-09   
ref|NP_505215.2|  Protein TAG-196                                     62.8    1e-09   
ref|XP_006827472.1|  hypothetical protein AMTR_s00009p00129100        62.4    1e-09   
ref|XP_003057227.1|  predicted protein                                62.0    1e-09   
ref|XP_009047014.1|  hypothetical protein LOTGIDRAFT_172186           61.2    1e-09   
ref|XP_003436276.1|  AGAP002879-PC                                    63.5    1e-09   
gb|AAP33049.1|  cysteine proteinase 1                                 62.0    1e-09   
ref|XP_011434325.1|  PREDICTED: uncharacterized protein LOC105333...  63.2    2e-09   
gb|EKC42097.1|  Cathepsin F                                           63.2    2e-09   
ref|XP_003284553.1|  hypothetical protein DICPUDRAFT_96752            62.0    2e-09   
ref|XP_011434326.1|  PREDICTED: uncharacterized protein LOC105333...  63.2    2e-09   
ref|XP_002635317.1|  C. briggsae CBR-TAG-196 protein                  62.4    2e-09   
ref|XP_001894882.1|  cathepsin F-like cysteine proteinase             59.7    2e-09   
gb|KDR17524.1|  Putative cysteine proteinase                          63.2    2e-09   
gb|ACR08662.1|  cathepsin F                                           60.1    2e-09   
ref|XP_002000409.1|  GI10216                                          62.4    2e-09   
gb|AAT07059.1|  cathepsin F-like cysteine proteinase                  62.0    2e-09   
ref|XP_011309436.1|  PREDICTED: uncharacterized protein LOC105270293  62.8    2e-09   
ref|XP_008647122.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin 7-...  60.8    3e-09   
gb|ENN81994.1|  hypothetical protein YQE_01705                        61.6    3e-09   
ref|XP_001994049.1|  GH22731                                          62.4    3e-09   
gb|EHJ64782.1|  cysteine proteinase inhibitor precursor               59.3    3e-09   
gb|EGT34543.1|  hypothetical protein CAEBREN_26318                    62.0    3e-09   
gb|ABE72973.1|  cathepsin L                                           60.5    3e-09   
gb|AEE62591.1|  unknown                                               61.6    3e-09   
gb|AAY81948.1|  cysteine protease 11                                  61.2    3e-09   
ref|XP_002427787.1|  Cathepsin F precursor, putative                  61.6    3e-09   
gb|ELT97360.1|  hypothetical protein CAPTEDRAFT_147978                60.5    3e-09   
ref|XP_002096026.1|  GE25302                                          62.0    3e-09   
gb|EGT34572.1|  hypothetical protein CAEBREN_13324                    62.0    3e-09   
ref|XP_002056575.1|  GJ11017                                          62.0    3e-09   
ref|XP_002017233.1|  GL22196                                          62.0    3e-09   
ref|XP_003578189.1|  PREDICTED: thiol protease aleurain               61.2    3e-09   
ref|XP_011260522.1|  PREDICTED: uncharacterized protein LOC105253881  62.4    3e-09   
gb|EFN65613.1|  Putative cysteine proteinase CG12163                  62.0    4e-09   
ref|NP_730901.1|  CG12163, isoform A                                  62.0    4e-09   
gb|ABC69431.1|  cysteine protease                                     60.8    4e-09   
ref|XP_635417.1|  cysteine proteinase 1                               60.8    4e-09   
emb|CAA26255.1|  cysteine proteinase I precursor                      60.8    4e-09   
ref|XP_002038380.1|  GM10654                                          61.6    4e-09   
ref|XP_002137768.1|  GA27408, isoform A                               61.6    4e-09   
ref|XP_001978897.1|  GG11133                                          61.6    4e-09   
ref|XP_003151185.1|  hypothetical protein LOAG_15647                  57.4    4e-09   
ref|XP_008177856.1|  PREDICTED: cathepsin W-like                      57.8    5e-09   
ref|XP_009029595.1|  hypothetical protein HELRODRAFT_157956           60.5    5e-09   
ref|XP_001955780.1|  GF16067                                          61.6    5e-09   
gb|ABJ89814.1|  cysteine protease preprotein                          60.5    5e-09   
gb|ABC69432.1|  cysteine protease                                     60.5    6e-09   
gb|ABC69433.1|  cysteine protease                                     60.5    6e-09   
ref|XP_003736743.1|  GA27408, isoform B                               60.8    6e-09   
gb|EJW79799.1|  cysteine protease 6                                   59.3    6e-09   
emb|CEF99324.1|  Cysteine peptidase, cysteine active site             60.5    6e-09   
ref|XP_008479905.1|  PREDICTED: cathepsin L-like                      60.1    8e-09   
ref|XP_010047474.1|  PREDICTED: thiol protease aleurain-like          60.1    8e-09   
emb|CDP90584.1|  Protein BM-TAG-196                                   60.8    8e-09   
ref|XP_006007112.1|  PREDICTED: cathepsin F-like                      60.5    8e-09   
ref|NP_649521.1|  CG12163, isoform B                                  60.5    9e-09   
ref|XP_004351999.1|  cysteine protease                                60.1    9e-09   
dbj|BAA84280.1|  Cysteine proteinase                                  58.5    9e-09   
ref|XP_004596903.1|  PREDICTED: cathepsin W                           60.1    1e-08   
gb|AAF21470.1|U85983_1  cysteine proteinase                           58.9    1e-08   
emb|CDX88753.1|  BnaA03g08960D                                        59.7    1e-08   
gb|AHJ86278.1|  cysteine protease                                     60.1    1e-08   
ref|XP_003081549.1|  Cysteine proteinase Cathepsin F (ISS)            59.3    1e-08   
ref|XP_009035142.1|  hypothetical protein AURANDRAFT_22962            60.1    1e-08   
ref|XP_005184488.1|  PREDICTED: putative cysteine proteinase CG12...  60.1    1e-08   
gb|KCW79401.1|  hypothetical protein EUGRSUZ_C00809                   59.7    1e-08   
ref|XP_010047478.1|  PREDICTED: thiol protease aleurain-like          59.7    1e-08   
ref|XP_011496222.1|  PREDICTED: uncharacterized protein LOC105360904  60.8    1e-08   
ref|XP_006038953.1|  PREDICTED: cathepsin W-like                      59.7    1e-08   
gb|ABK91811.1|  cathepsin F precursor                                 59.3    1e-08   
gb|ABC69429.1|  cysteine protease                                     59.3    1e-08   
gb|ABC69430.1|  cysteine protease                                     59.3    1e-08   
ref|XP_006258352.1|  PREDICTED: cathepsin W-like                      58.9    1e-08   
gb|ENN81374.1|  hypothetical protein YQE_02191                        60.8    1e-08   
ref|XP_005305646.1|  PREDICTED: cathepsin W-like                      59.3    1e-08   
ref|XP_008479908.1|  PREDICTED: putative cysteine proteinase CG12163  59.3    1e-08   
ref|XP_010666300.1|  PREDICTED: thiol protease aleurain-like          59.7    1e-08   
gb|AAF40479.1|  cystein protease                                      59.3    1e-08   
ref|XP_007438969.1|  PREDICTED: cathepsin F-like                      57.8    1e-08   
ref|XP_003492760.1|  PREDICTED: hypothetical protein LOC100745708     60.5    1e-08   
gb|ABK91805.1|  cysteine proteinase 7 precursor                       59.3    1e-08   
gb|ACG50796.1|  cathepsin B1                                          59.3    2e-08   
ref|XP_005305525.1|  PREDICTED: cathepsin W-like                      58.9    2e-08   
gb|AJF94882.1|  C1 family cathepsin F10                               60.5    2e-08   
ref|XP_003696602.1|  PREDICTED: putative cysteine proteinase CG12...  60.1    2e-08   
gb|ELV09527.1|  Cathepsin F                                           59.7    2e-08   
ref|XP_006608091.1|  PREDICTED: uncharacterized protein LOC102680728  60.1    2e-08   
gb|AAB82455.1|  lymphopain                                            59.3    2e-08   
gb|EGV94494.1|  Ras-specific guanine nucleotide-releasing factor 1    60.5    2e-08   
ref|NP_034115.2|  cathepsin W preproprotein                           59.3    2e-08   
gb|AAY81944.1|  cysteine protease 6                                   58.9    2e-08   
gb|ABC48936.1|  cathepsin F like protease                             59.7    2e-08   
dbj|BAI44279.1|  cysteine proteinase inhibitor precursor              60.5    2e-08   
ref|XP_002073772.1|  GK14287                                          59.7    2e-08   
ref|XP_004519758.1|  PREDICTED: putative cysteine proteinase CG12...  59.7    2e-08   
gb|KHN12281.1|  Thiol protease aleurain-like                          58.5    2e-08   
ref|XP_003375070.1|  viral cathepsin                                  59.3    2e-08   
ref|XP_010050440.1|  PREDICTED: thiol protease aleurain-like          58.9    2e-08   
ref|XP_006980634.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      59.3    2e-08   
gb|ADY04490.1|  cysteine protease                                     56.6    2e-08   
ref|XP_003386471.1|  PREDICTED: cysteine proteinase 1-like            58.9    2e-08   
ref|XP_009131925.1|  PREDICTED: thiol protease aleurain-like          58.5    3e-08   
ref|XP_009033807.1|  hypothetical protein AURANDRAFT_21107            57.8    3e-08   
ref|XP_005351748.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      59.3    3e-08   
ref|XP_006268168.1|  PREDICTED: cathepsin F-like                      58.9    3e-08   
ref|XP_006101640.1|  PREDICTED: cathepsin W                           58.5    3e-08   
ref|XP_006121731.1|  PREDICTED: cathepsin W-like                      57.0    3e-08   
dbj|GAM23991.1|  hypothetical protein SAMD00019534_071660             58.5    3e-08   
gb|ELW65130.1|  Cathepsin W                                           58.9    3e-08   
gb|KHN06070.1|  Thiol protease aleurain-like                          58.2    3e-08   
gb|AFQ01139.1|  cathepsin F-like protease                             58.9    3e-08   
ref|XP_008821074.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      58.9    3e-08   
gb|AAY81946.1|  cysteine protease 8                                   58.2    3e-08   
ref|XP_005770574.1|  hypothetical protein EMIHUDRAFT_349865           58.5    3e-08   
emb|CBK24241.2|  unnamed protein product                              58.9    3e-08   
ref|XP_009359733.1|  PREDICTED: thiol protease aleurain-like          58.5    3e-08   
ref|XP_006036386.1|  PREDICTED: cathepsin W-like                      56.2    3e-08   
gb|EHJ68876.1|  hypothetical protein KGM_22410                        57.4    4e-08   
ref|XP_010261858.1|  PREDICTED: thiol protease aleurain-like          58.2    4e-08   
gb|KHG00345.1|  hypothetical protein F383_18274                       58.2    4e-08   
gb|KCW79397.1|  hypothetical protein EUGRSUZ_C00804                   58.2    4e-08   
gb|AAV65885.1|  cathepsin B1 isotype 5 precursor                      58.2    4e-08   
ref|XP_003533785.1|  PREDICTED: cysteine proteinase                   58.2    4e-08   
ref|XP_007648967.1|  PREDICTED: LOW QUALITY PROTEIN: cathepsin F      58.5    4e-08   
ref|XP_009034680.1|  hypothetical protein AURANDRAFT_22129            58.2    4e-08   
gb|AAY81947.1|  cysteine protease 9                                   57.8    4e-08   
ref|XP_006771636.1|  PREDICTED: cathepsin W                           58.2    4e-08   
ref|XP_003747496.1|  PREDICTED: cathepsin L-like                      57.8    5e-08   
ref|XP_006036937.1|  PREDICTED: cathepsin F-like                      58.2    5e-08   
gb|AAW28152.1|  westerpain-10                                         57.8    5e-08   



>gb|AAK27969.1|AF242373_1 cysteine protease [Ipomoea batatas]
Length=366

 Score =   109 bits (273),  Expect = 9e-27, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  316  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF40415.1|AF216784_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=368

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  318  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF61441.1|AF138265_1 papain-like cysteine proteinase isoform II [Ipomoea batatas]
Length=366

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  316  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>gb|AAF61440.1|AF138264_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  318  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40414.1|AF216783_1 papain-like cysteine proteinase isoform I [Ipomoea batatas]
Length=368

 Score =   108 bits (270),  Expect = 2e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  318  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  368



>gb|AAF40416.1|AF216785_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
 gb|AAF61442.1|AF138266_1 papain-like cysteine proteinase isoform III [Ipomoea batatas]
Length=366

 Score =   107 bits (267),  Expect = 6e-26, Method: Composition-based stats.
 Identities = 46/51 (90%), Positives = 49/51 (96%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R+KEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T TSD
Sbjct  316  RMKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVSTTTSD  366



>ref|XP_003606998.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89195.1| papain family cysteine protease [Medicago truncatula]
Length=362

 Score =   103 bits (258),  Expect = 8e-25, Method: Composition-based stats.
 Identities = 45/49 (92%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  314  RLKEKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>gb|ACI04578.1| cysteine protease-like protein [Robinia pseudoacacia]
Length=335

 Score =   103 bits (257),  Expect = 1e-24, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAAV+T
Sbjct  286  RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAVHT  332



>ref|XP_011088458.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Sesamum indicum]
Length=379

 Score =   103 bits (256),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/47 (94%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE WGEKGYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  331  RRKEKPYWIIKNSWGEKWGEKGYYKICRGRNICGVDSMVSTVAAVST  377



>gb|KDP41743.1| hypothetical protein JCGZ_26761 [Jatropha curcas]
Length=370

 Score =   102 bits (255),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAAV T +
Sbjct  321  RLKEKPYWIIKNSWGETWGESGYYKICRGRNVCGVDSMVSTVAAVQTSS  369



>ref|XP_007131787.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
 gb|ESW03781.1| hypothetical protein PHAVU_011G041600g [Phaseolus vulgaris]
Length=361

 Score =   102 bits (255),  Expect = 2e-24, Method: Composition-based stats.
 Identities = 44/49 (90%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  312  RMKEKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  360



>ref|XP_009406357.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=372

 Score =   102 bits (254),  Expect = 3e-24, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KP+WIIKNSWGE+WGEKGYYKICRGRN+CGVDSMVSTV A+NT
Sbjct  322  RLKQKPFWIIKNSWGETWGEKGYYKICRGRNVCGVDSMVSTVTAINT  368



>ref|XP_002512963.1| cysteine protease, putative [Ricinus communis]
 gb|EEF49466.1| cysteine protease, putative [Ricinus communis]
Length=373

 Score =   102 bits (254),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV T +
Sbjct  324  RMKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVQTAS  372



>ref|XP_003523684.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=366

 Score =   102 bits (253),  Expect = 4e-24, Method: Composition-based stats.
 Identities = 41/46 (89%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  317  RFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|AIB06024.1| CP2 [Hevea brasiliensis]
Length=372

 Score =   102 bits (253),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 45/50 (90%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA-VNTPT  148
            RLKEKPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA V TP+
Sbjct  322  RLKEKPYWIIKNSWGENWGESGYYKICRGRNICGVDSMVSTVAAVVQTPS  371



>ref|XP_003539008.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=363

 Score =   101 bits (252),  Expect = 5e-24, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  314  RMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  362



>emb|CDP20652.1| unnamed protein product [Coffea canephora]
Length=372

 Score =   101 bits (252),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKICRG NICGVDSMVSTVAAV+T T
Sbjct  324  RMKEKPYWIIKNSWGEHWGENGYYKICRGHNICGVDSMVSTVAAVHTST  372



>ref|XP_007042077.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOX97908.1| Papain family cysteine protease [Theobroma cacao]
Length=395

 Score =   102 bits (253),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV+T
Sbjct  346  RMKDKPYWIIKNSWGESWGEDGFYKICRGRNICGVDSMVSTVAAVDT  392



>ref|XP_010271520.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=370

 Score =   101 bits (252),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            RLK+KPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAVN
Sbjct  321  RLKDKPYWIIKNSWGEGWGENGYYKICRGRNVCGVDSMVSTVAAVN  366



>ref|XP_006362019.1| PREDICTED: cysteine proteinase RD19a-like [Solanum tuberosum]
Length=368

 Score =   101 bits (252),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  320  RMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>gb|AAX19661.1| cysteine proteinase [Populus tomentosa]
Length=374

 Score =   101 bits (252),  Expect = 6e-24, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T +
Sbjct  325  RMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQTSS  373



>gb|KHG24064.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=374

 Score =   101 bits (252),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDS+VSTVAAVNT
Sbjct  325  RLKDKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|NP_001241450.1| uncharacterized protein LOC100778716 precursor [Glycine max]
 gb|ACU20049.1| unknown [Glycine max]
Length=366

 Score =   101 bits (251),  Expect = 7e-24, Method: Composition-based stats.
 Identities = 41/46 (89%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  317  RFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_004230928.1| PREDICTED: cysteine proteinase RD19a [Solanum lycopersicum]
Length=369

 Score =   101 bits (251),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  320  RMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_009602233.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana tomentosiformis]
Length=369

 Score =   101 bits (251),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  320  RMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVSTSS  368



>ref|XP_002313770.1| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE87725.1| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score =   101 bits (251),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  319  RMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_002280798.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CAN73591.1| hypothetical protein VITISV_022889 [Vitis vinifera]
 emb|CBI19785.3| unnamed protein product [Vitis vinifera]
Length=371

 Score =   101 bits (251),  Expect = 8e-24, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGESWGE+GYYKICRG NICGVDSMVSTVAA++T
Sbjct  322  RFKEKPYWIIKNSWGESWGEQGYYKICRGHNICGVDSMVSTVAAIHT  368



>gb|KHN45894.1| Cysteine proteinase RD19a [Glycine soja]
Length=366

 Score =   101 bits (251),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 41/46 (89%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGESWGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  317  RFKEKPYWIIKNSWGESWGEEGYYKICRGRNVCGVDSMVSTVAAIH  362



>gb|ABK92536.1| unknown [Populus trichocarpa]
Length=368

 Score =   101 bits (251),  Expect = 9e-24, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  319  RMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_004507484.1| PREDICTED: cysteine proteinase RD19a-like [Cicer arietinum]
Length=363

 Score =   101 bits (251),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAAV+T T
Sbjct  314  RMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAVHTTT  362



>ref|XP_011047717.1| PREDICTED: cysteine proteinase RD19a [Populus euphratica]
Length=368

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 43/47 (91%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+KEKPYWIIKNSWGESWGE G+YKICRGRNICGVDSMVSTVAAV T
Sbjct  319  RMKEKPYWIIKNSWGESWGENGFYKICRGRNICGVDSMVSTVAAVQT  365



>ref|XP_009373025.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=371

 Score =   100 bits (250),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  320  RLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_003540987.1| PREDICTED: cysteine proteinase RD19a-like [Glycine max]
Length=365

 Score =   100 bits (249),  Expect = 1e-23, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVA+V+T T
Sbjct  316  RMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVASVHTTT  364



>gb|KHN39817.1| Cysteine proteinase RD19a [Glycine soja]
Length=332

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T T
Sbjct  283  RMKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTT  331



>ref|XP_011092831.1| PREDICTED: cysteine proteinase RD19a-like [Sesamum indicum]
Length=378

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTVAAV+T
Sbjct  330  RLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVDSMVSTVAAVST  376



>gb|KJB79047.1| hypothetical protein B456_013G033800 [Gossypium raimondii]
Length=373

 Score =   100 bits (249),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  324  RMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>emb|CAE54306.1| putative papain-like cysteine proteinase [Gossypium hirsutum]
Length=373

 Score =   100 bits (248),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  324  RMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>gb|KJB32561.1| hypothetical protein B456_005G247000 [Gossypium raimondii]
Length=374

 Score =   100 bits (248),  Expect = 2e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTVAAVNT
Sbjct  325  RLKDKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVAAVNT  371



>ref|XP_004291404.1| PREDICTED: cysteine proteinase 15A-like [Fragaria vesca subsp. 
vesca]
Length=365

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWG+SWGE+GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  319  RFKEKPYWIIKNSWGQSWGEEGYYKICRGRNVCGVDSMVSTVAAMHT  365



>gb|ABQ10201.1| cysteine protease Cp3 [Actinidia deliciosa]
Length=365

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R+KEKPYWIIKNSWGESWGE G+YKIC+GRN+CGVDSMVSTVAAV+T ++
Sbjct  316  RMKEKPYWIIKNSWGESWGENGFYKICQGRNVCGVDSMVSTVAAVHTTSN  365



>gb|EYU37835.1| hypothetical protein MIMGU_mgv1a008237mg [Erythranthe guttata]
Length=380

 Score = 99.8 bits (247),  Expect = 3e-23, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  331  RMKEKPYWIIKNSWGPNWGEDGYYKICRGRNICGVDSMVSTVAAVSTTS  379



>ref|XP_007136047.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
 gb|ESW08041.1| hypothetical protein PHAVU_009G013600g [Phaseolus vulgaris]
Length=366

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  317  RFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>gb|AGV54334.1| cysteine proteinase RD19a-like protein [Phaseolus vulgaris]
Length=366

 Score = 99.8 bits (247),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKP+WIIKNSWGESWGE GYYKICRG N+CGVDSMVSTVAA++T +
Sbjct  317  RFKEKPFWIIKNSWGESWGENGYYKICRGHNVCGVDSMVSTVAAIHTSS  365



>gb|KHN22211.1| Cysteine proteinase 15A [Glycine soja]
Length=366

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/46 (87%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGESWGE+GYY ICRGRN+CGVDSMVSTVAA++
Sbjct  317  RFKEKPYWIIKNSWGESWGEEGYYNICRGRNVCGVDSMVSTVAAIH  362



>ref|XP_010061009.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW67908.1| hypothetical protein EUGRSUZ_F01612 [Eucalyptus grandis]
Length=369

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVAA++T
Sbjct  320  RFKEKPYWIIKNSWGENWGENGYYKICRGRDICGVDSMVSTVAAIHT  366



>ref|XP_002275759.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI17456.3| unnamed protein product [Vitis vinifera]
Length=367

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/49 (86%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGESWGE GYYKICRG N CGVDSMVSTVAA+ T T
Sbjct  318  RFKEKPYWIIKNSWGESWGEDGYYKICRGHNACGVDSMVSTVAAIQTTT  366



>gb|KHG15253.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=373

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE G+Y+ICRGRNICGVDSMVSTVAAVNT
Sbjct  324  RMKDKPYWIIKNSWGENWGENGFYRICRGRNICGVDSMVSTVAAVNT  370



>ref|XP_010268619.1| PREDICTED: cysteine proteinase RD19a-like [Nelumbo nucifera]
Length=369

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGESWGE GYYKICRGR++CGVDSMVSTVAA++T
Sbjct  320  RMKDKPYWIIKNSWGESWGENGYYKICRGRDVCGVDSMVSTVAAIHT  366



>ref|XP_004290288.1| PREDICTED: probable cysteine proteinase A494 [Fragaria vesca 
subsp. vesca]
Length=372

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/45 (93%), Positives = 45/45 (100%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R+KEKPYWIIKNSWGE+WGEKG+YKICRGRNICGVDSMVSTVAAV
Sbjct  326  RMKEKPYWIIKNSWGENWGEKGFYKICRGRNICGVDSMVSTVAAV  370



>sp|P05993.1|PAPA5_CARPA RecName: Full=Cysteine proteinase; AltName: Full=Clone PLBPC13, 
partial [Carica papaya]
 emb|CAA27609.1| pot. cysteine proteinase [Carica papaya]
Length=96

 Score = 94.7 bits (234),  Expect = 4e-23, Method: Compositional matrix adjust.
 Identities = 43/49 (88%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            RLKEKPYW+IKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAAV+T +
Sbjct  47   RLKEKPYWVIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAVHTTS  95



>gb|EYU42593.1| hypothetical protein MIMGU_mgv1a008336mg [Erythranthe guttata]
Length=377

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+KEKPYWIIKNSWG +WGEKGYYKIC+GRN+CGVDSMVSTVAAV T
Sbjct  330  RMKEKPYWIIKNSWGPNWGEKGYYKICQGRNLCGVDSMVSTVAAVTT  376



>ref|XP_010066197.1| PREDICTED: probable cysteine proteinase A494 [Eucalyptus grandis]
 gb|KCW64029.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
 gb|KCW64030.1| hypothetical protein EUGRSUZ_G01706 [Eucalyptus grandis]
Length=376

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+KEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA++T
Sbjct  327  RMKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAIHT  373



>ref|XP_009373000.1| PREDICTED: cysteine proteinase RD19a [Pyrus x bretschneideri]
Length=371

 Score = 99.4 bits (246),  Expect = 4e-23, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  320  RLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_007017672.1| Papain family cysteine protease [Theobroma cacao]
 gb|EOY14897.1| Papain family cysteine protease [Theobroma cacao]
Length=401

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVS+VAA+ T +
Sbjct  352  RFKEKPYWIIKNSWGENWGEEGYYKICRGRNVCGVDSMVSSVAALQTKS  400



>gb|KDO49483.1| hypothetical protein CISIN_1g017318mg [Citrus sinensis]
Length=373

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            RLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  328  RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>ref|XP_006487337.1| PREDICTED: cysteine proteinase RD19a-like [Citrus sinensis]
Length=373

 Score = 99.4 bits (246),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/44 (95%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            RLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  328  RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAA  371



>dbj|BAC41322.1| hypothetical protein [Lotus japonicus]
Length=358

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  311  RMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>ref|XP_008236965.1| PREDICTED: cysteine proteinase RD19a [Prunus mume]
Length=367

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  316  RMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|XP_008382317.1| PREDICTED: cysteine proteinase RD19a [Malus domestica]
Length=371

 Score = 99.0 bits (245),  Expect = 5e-23, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  320  RLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  369



>ref|XP_007201310.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
 gb|EMJ02509.1| hypothetical protein PRUPE_ppa007454mg [Prunus persica]
Length=367

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 47/50 (94%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R+KEKPYWIIKNSWGE+WGEKG+YKIC+GRNICGVDSMVSTVAA +  T+
Sbjct  316  RMKEKPYWIIKNSWGENWGEKGFYKICKGRNICGVDSMVSTVAAASVETN  365



>ref|NP_001266121.1| uncharacterized protein LOC101501911 precursor [Cicer arietinum]
 emb|CAA08906.1| cysteine proteinase [Cicer arietinum]
Length=362

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  313  RLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  358



>gb|AJA74415.1| cysteine protease [Cicer arietinum]
Length=358

 Score = 99.0 bits (245),  Expect = 6e-23, Method: Composition-based stats.
 Identities = 42/46 (91%), Positives = 46/46 (100%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRNICGVDSMVSTVAAV+
Sbjct  309  RLKEKPYWIIKNSWGQNWGEEGYYKICRGRNICGVDSMVSTVAAVH  354



>ref|XP_011028940.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  318  RFKEKPFWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|ABF46642.1| papain-like cysteine proteinase [Pachysandra terminalis]
Length=374

 Score = 99.0 bits (245),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 43/49 (88%), Positives = 44/49 (90%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGESWGEKGYYKICRGRNICG+DSMVS VAA   PT
Sbjct  325  RFKEKPYWIIKNSWGESWGEKGYYKICRGRNICGMDSMVSAVAAA-VPT  372



>ref|XP_002510469.1| cysteine protease, putative [Ricinus communis]
 gb|EEF52656.1| cysteine protease, putative [Ricinus communis]
Length=366

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KP+WIIKNSWGE+WGE GYYKICRGRN+CGVD+MVSTVAA++T
Sbjct  317  RLKDKPFWIIKNSWGENWGENGYYKICRGRNVCGVDAMVSTVAAIHT  363



>ref|NP_001267989.1| cysteine protease precursor [Vitis vinifera]
 gb|ABX79341.1| cysteine protease [Vitis vinifera]
Length=377

 Score = 98.6 bits (244),  Expect = 7e-23, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 48/50 (96%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R+K+KPYWIIKNSWGE+WGE G+YKICRGRN+CGVDSMVSTVAAV+T ++
Sbjct  328  RMKDKPYWIIKNSWGENWGENGFYKICRGRNVCGVDSMVSTVAAVHTTSN  377



>emb|CAE45588.1| papain-like cysteine proteinase-like protein 1 [Lotus japonicus]
Length=359

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  312  RMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  358



>ref|XP_003607110.1| Cysteine proteinase [Medicago truncatula]
 gb|AES89307.1| papain family cysteine protease [Medicago truncatula]
Length=331

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  284  KEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTTT  330



>ref|XP_004150061.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004166953.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN61836.1| Cysteine protease [Cucumis sativus]
Length=377

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  328  RLKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>gb|KHN25410.1| Cysteine proteinase RD19a [Glycine soja]
Length=365

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 47/49 (96%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE+WGE GYYKICRGR+ICGVDSMVSTVA+V+T T
Sbjct  316  RMKEKPFWIIKNSWGENWGENGYYKICRGRSICGVDSMVSTVASVHTTT  364



>ref|XP_011037175.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
 ref|XP_011037176.1| PREDICTED: cysteine proteinase RD19a-like [Populus euphratica]
Length=368

 Score = 98.6 bits (244),  Expect = 8e-23, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+K+KPYWIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  319  RMKDKPYWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTTS  367



>ref|XP_002305451.2| cysteine proteinase A494 precursor [Populus trichocarpa]
 gb|EEE85962.2| cysteine proteinase A494 precursor [Populus trichocarpa]
Length=368

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  319  RMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  367



>ref|XP_006423403.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
 gb|ESR36643.1| hypothetical protein CICLE_v10028670mg [Citrus clementina]
Length=375

 Score = 98.6 bits (244),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 41/44 (93%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            RLKEKPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVST+AA
Sbjct  328  RLKEKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTIAA  371



>gb|AAR92156.1| putative cysteine protease 3 [Iris x hollandica]
Length=292

 Score = 97.8 bits (242),  Expect = 9e-23, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++T
Sbjct  241  RLKEKPYWIIKNSWGETWGENGYYKICRGRNVCGVDSMVSTVTAIHT  287



>ref|XP_003550405.2| PREDICTED: cysteine proteinase 15A [Glycine max]
Length=392

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  343  RFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  387



>dbj|BAF98584.1| CM0216.500.nc [Lotus japonicus]
Length=360

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  311  RMKQKPYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSTVAALHT  357



>gb|ABK94801.1| unknown [Populus trichocarpa]
Length=367

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  318  RFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|ABK96580.1| unknown [Populus trichocarpa x Populus deltoides]
Length=367

 Score = 98.2 bits (243),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  318  RFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>gb|KEH30505.1| papain family cysteine protease [Medicago truncatula]
Length=330

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            KEKPYWI+KNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA +T T
Sbjct  283  KEKPYWIVKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAHTNT  329



>ref|XP_009392632.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=369

 Score = 97.8 bits (242),  Expect = 1e-22, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+KP+WIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V+A++T
Sbjct  319  RLKDKPFWIIKNSWGENWGEHGYYKICRGRNICGVDSMVSSVSAIHT  365



>ref|XP_008775532.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=371

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV +
Sbjct  324  RFKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSMVSTVAAVRS  370



>emb|CAE45589.1| papain-like cysteine proteinase-like protein 2 [Lotus japonicus]
Length=361

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  312  RMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  358



>ref|XP_008460996.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=377

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/47 (87%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWG +WGE GYYKICRGRNICGVDSMVSTVAAV+T
Sbjct  328  RMKDKPYWIIKNSWGANWGENGYYKICRGRNICGVDSMVSTVAAVHT  374



>ref|XP_010105270.1| Cysteine proteinase 15A [Morus notabilis]
 gb|EXC04205.1| Cysteine proteinase 15A [Morus notabilis]
Length=372

 Score = 97.8 bits (242),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R K+KPYWIIKNSWGE+WGE+GYYKICRGRN+CGVDSMVSTVAA++
Sbjct  318  RFKDKPYWIIKNSWGENWGEQGYYKICRGRNVCGVDSMVSTVAALH  363



>ref|XP_003589348.1| Cysteine proteinase [Medicago truncatula]
 gb|AES59599.1| papain family cysteine protease [Medicago truncatula]
Length=364

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  318  RLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  364



>ref|XP_007160702.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
 gb|ESW32696.1| hypothetical protein PHAVU_001G009900g [Phaseolus vulgaris]
Length=365

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  316  RFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>gb|AAL69389.1|AF462226_1 putative cysteine proteinase [Narcissus pseudonarcissus]
Length=136

 Score = 94.4 bits (233),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 41/51 (80%), Positives = 46/51 (90%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R KEKPYWIIKNSWGE+WGEKGYYKIC+GRN+CGVDSMVSTV A++T   D
Sbjct  86   RFKEKPYWIIKNSWGENWGEKGYYKICKGRNVCGVDSMVSTVTAIHTTPKD  136



>gb|ACM80348.1| cysteine proteinase [Solanum lycopersicum]
Length=368

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 41/49 (84%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKI RGRN+CGVDSMVSTVAAV+T +
Sbjct  320  RMKEKPYWIIKNSWGEKWGESGYYKIRRGRNVCGVDSMVSTVAAVSTSS  368



>dbj|BAF98585.1| CM0216.510.nc [Lotus japonicus]
Length=360

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 46/47 (98%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA++T
Sbjct  311  RMKQKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAALHT  357



>dbj|BAF03553.1| cysteine proteinase CP2 [Phaseolus vulgaris]
Length=365

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  316  RFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>ref|XP_010028631.1| PREDICTED: cysteine proteinase RD19a-like [Eucalyptus grandis]
 gb|KCW55393.1| hypothetical protein EUGRSUZ_I01305 [Eucalyptus grandis]
Length=370

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 43/52 (83%), Positives = 46/52 (88%), Gaps = 2/52 (4%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV--NTPTS  151
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRNICGVDSMVSTVAA    TP S
Sbjct  318  RMKDKPYWIIKNSWGETWGENGYYKICRGRNICGVDSMVSTVAAAVHTTPGS  369



>dbj|BAJ53178.1| JHL18I08.12 [Jatropha curcas]
 gb|KDP38578.1| hypothetical protein JCGZ_04503 [Jatropha curcas]
Length=368

 Score = 97.4 bits (241),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 47/50 (94%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLK+KP+WIIKNSWGESWGE GYY+ICRGRNICGVD+MVS+VAA++ P S
Sbjct  318  RLKDKPFWIIKNSWGESWGENGYYRICRGRNICGVDAMVSSVAAIH-PNS  366



>gb|AAU81591.1| cysteine proteinase, partial [Petunia x hybrida]
Length=190

 Score = 95.1 bits (235),  Expect = 2e-22, Method: Compositional matrix adjust.
 Identities = 42/49 (86%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSMVSTVAAV+T +
Sbjct  142  RMKEKPYWIIKNSWGEKWGESGYYKICRGRNVCGVDSMVSTVAAVSTSS  190



>emb|CAA82995.1| cysteine proteinase [Vicia sativa]
Length=358

 Score = 97.1 bits (240),  Expect = 2e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  310  RLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  356



>sp|P25804.1|CYSP_PEA RecName: Full=Cysteine proteinase 15A; AltName: Full=Turgor-responsive 
protein 15A; Flags: Precursor [Pisum sativum]
 emb|CAA38242.1| unnamed protein product [Pisum sativum]
Length=363

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  315  RLKEKPYWIIKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_002302004.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
 gb|ABK94746.1| unknown [Populus trichocarpa]
 gb|EEE81277.2| hypothetical protein POPTR_0002s03020g [Populus trichocarpa]
Length=367

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWG++WGE GYYKICRGRNICGVDSMVSTVAA++T
Sbjct  318  RFKEKPFWIIKNSWGQNWGENGYYKICRGRNICGVDSMVSTVAAIHT  364



>ref|XP_006473584.1| PREDICTED: cysteine proteinase 15A-like [Citrus sinensis]
Length=369

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAAV+T +S
Sbjct  320  RFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAVHTTSS  369



>gb|AAO11786.1| pre-pro cysteine proteinase [Vicia faba]
Length=363

 Score = 97.1 bits (240),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  315  RLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>gb|AAB67878.1| pre-pro-cysteine proteinase [Vicia faba]
Length=363

 Score = 96.7 bits (239),  Expect = 3e-22, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWI+KNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  315  RLKEKPYWIVKNSWGQNWGEQGYYKICRGRNVCGVDSMVSTVAAAQS  361



>ref|XP_009376976.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=445

 Score = 97.4 bits (241),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  394  RLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  443



>gb|AAU81589.1| cysteine proteinase [Petunia x hybrida]
Length=257

 Score = 95.9 bits (237),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 42/47 (89%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE+GYYKICRGRNICGVD+MVSTV A +T
Sbjct  206  RLKEKPYWIIKNSWGESWGEQGYYKICRGRNICGVDAMVSTVTAAHT  252



>ref|XP_011045161.1| PREDICTED: cysteine proteinase 15A-like [Populus euphratica]
Length=367

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++
Sbjct  318  RFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>gb|KDO84720.1| hypothetical protein CISIN_1g017548mg [Citrus sinensis]
Length=369

 Score = 96.7 bits (239),  Expect = 4e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  320  RFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>emb|CDQ51995.1| Cysteine proteinase, partial [Fagus sylvatica]
Length=165

 Score = 94.0 bits (232),  Expect = 5e-22, Method: Compositional matrix adjust.
 Identities = 41/46 (89%), Positives = 45/46 (98%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            RLKEKP+WIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA+N
Sbjct  119  RLKEKPFWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAAIN  164



>ref|XP_006435090.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
 gb|ESR48330.1| hypothetical protein CICLE_v10001559mg [Citrus clementina]
Length=369

 Score = 96.3 bits (238),  Expect = 5e-22, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE GYYKIC GRN+CGVDSMVS+VAA++T +S
Sbjct  320  RFKEKPYWIIKNSWGENWGENGYYKICMGRNVCGVDSMVSSVAAIHTTSS  369



>ref|XP_003607150.1| Cysteine proteinase [Medicago truncatula]
Length=326

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  279  KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  325



>gb|AES89347.2| papain family cysteine protease [Medicago truncatula]
Length=327

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  8    KEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            KEKPYWI+K+SWGE+WGE GYYKICRGRNICGVDSMVSTVAA  T T
Sbjct  280  KEKPYWIVKSSWGETWGENGYYKICRGRNICGVDSMVSTVAAAQTTT  326



>ref|XP_010672379.1| PREDICTED: cysteine proteinase RD19a-like [Beta vulgaris subsp. 
vulgaris]
Length=375

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWG +WG++GYYKICRG N+CGVDSMVSTVAAVN
Sbjct  325  RFKEKPYWIIKNSWGPNWGDQGYYKICRGHNVCGVDSMVSTVAAVN  370



>ref|XP_009376977.1| PREDICTED: cysteine proteinase RD19a-like [Pyrus x bretschneideri]
Length=447

 Score = 97.1 bits (240),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGESW E G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  396  RLKEKPYWIIKNSWGESWRESGFYKICRGRNICGVDSMVSTVAAASVKTN  445



>ref|XP_009109502.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
 emb|CDX90310.1| BnaA08g16740D [Brassica napus]
Length=369

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +PT+
Sbjct  319  RFKEKPYWIIKNSWGETWGENGFYKICRGRNVCGVDSLVSTVTAAVSPTA  368



>ref|XP_003545051.1| PREDICTED: cysteine proteinase 15A-like [Glycine max]
Length=367

 Score = 96.3 bits (238),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  318  RFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  362



>ref|XP_009146338.1| PREDICTED: cysteine proteinase 15A-like [Brassica rapa]
 emb|CDY32227.1| BnaA01g17570D [Brassica napus]
Length=368

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  318  RLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>gb|AAD29084.1|AF082181_1 cysteine proteinase precursor [Solanum melongena]
Length=363

 Score = 95.9 bits (237),  Expect = 6e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  312  RLKEKPYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>ref|XP_002280808.2| PREDICTED: cysteine proteinase 15A [Vitis vinifera]
 emb|CBI19783.3| unnamed protein product [Vitis vinifera]
Length=365

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 38/49 (78%), Positives = 44/49 (90%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYW++KNSWG++WGE GYYKICRG NICGVDSMVSTVAA+ + T
Sbjct  317  RFKEKPYWLLKNSWGQNWGEHGYYKICRGHNICGVDSMVSTVAAIQSAT  365



>gb|KGN43159.1| Papain-like cysteine proteinase isoform I [Cucumis sativus]
Length=387

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  328  RMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>ref|XP_004148554.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase RD19a-like 
[Cucumis sativus]
Length=381

 Score = 95.9 bits (237),  Expect = 7e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  322  RMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  367



>ref|XP_004165230.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
Length=387

 Score = 95.9 bits (237),  Expect = 8e-22, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R+++K YWIIKNSWGESWGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  328  RMRDKDYWIIKNSWGESWGENGYYKICRGRNICGVDSLVSTVAAVH  373



>gb|KJB07487.1| hypothetical protein B456_001G026600 [Gossypium raimondii]
Length=377

 Score = 95.9 bits (237),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 38/48 (79%), Positives = 44/48 (92%), Gaps = 0/48 (0%)
 Frame = +2

Query  5    LKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            LK+KPYWIIKNSWGE+WGE GYYKICRG N+CGVDS+VSTV A+NT +
Sbjct  329  LKDKPYWIIKNSWGENWGENGYYKICRGSNVCGVDSLVSTVVALNTKS  376



>ref|XP_002880378.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH56637.1| hypothetical protein ARALYDRAFT_481008 [Arabidopsis lyrata subsp. 
lyrata]
Length=360

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  314  RLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAAATS  360



>gb|AIB06025.1| CP3 [Hevea brasiliensis]
Length=366

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R K+KP+WIIKNSWGE+WGE GYYKICRGRNICG+D+MVS+VAA++T
Sbjct  317  RFKDKPFWIIKNSWGENWGENGYYKICRGRNICGMDAMVSSVAAIHT  363



>gb|AAL05851.1|AF411121_1 cysteine proteinase precursor [Sandersonia aurantiaca]
Length=360

 Score = 95.5 bits (236),  Expect = 9e-22, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVS+V+A +T
Sbjct  312  RFKEKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSSVSAFHT  358



>gb|ABK96252.1| unknown [Populus trichocarpa x Populus deltoides]
Length=156

 Score = 92.8 bits (229),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 40/49 (82%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R+KEKP+WIIKNSWGE WGE G+YKICRGRN+CGVDSMVSTVAAV T +
Sbjct  108  RMKEKPFWIIKNSWGEKWGENGFYKICRGRNVCGVDSMVSTVAAVQTSS  156



>emb|CDY34441.1| BnaC01g21920D [Brassica napus]
Length=368

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG +WGE GYYKICRGR NICG+D+MVSTVAAV+T T
Sbjct  318  RLKEKPYWIIKNSWGSTWGEDGYYKICRGRHNICGMDTMVSTVAAVHTST  367



>ref|XP_010531457.1| PREDICTED: probable cysteine proteinase A494 [Tarenaya hassleriana]
Length=364

 Score = 95.5 bits (236),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/44 (89%), Positives = 44/44 (100%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R+KEKP+WIIKNSWGE+WGEKG+YKICRGRNICGVDS+VSTVAA
Sbjct  317  RMKEKPFWIIKNSWGENWGEKGFYKICRGRNICGVDSLVSTVAA  360



>gb|AAM65162.1| cysteine proteinase RD19A [Arabidopsis thaliana]
Length=368

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  318  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>ref|XP_010530325.1| PREDICTED: cysteine proteinase RD19a [Tarenaya hassleriana]
Length=370

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 46/49 (94%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG +WGE+GYYKIC GRN+CG+D+MVS+VAAV+T T
Sbjct  321  RLKEKPYWIIKNSWGANWGEEGYYKICHGRNLCGMDTMVSSVAAVHTST  369



>ref|XP_002306900.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
 gb|ABK92924.1| unknown [Populus trichocarpa]
 gb|EEE93896.1| hypothetical protein POPTR_0005s25540g [Populus trichocarpa]
Length=367

 Score = 95.1 bits (235),  Expect = 1e-21, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++
Sbjct  318  RFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIH  363



>ref|XP_008448073.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=385

 Score = 95.1 bits (235),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 38/46 (83%), Positives = 44/46 (96%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R+++K YWIIKNSWGE+WGE GYYKICRGRNICGVDS+VSTVAAV+
Sbjct  326  RMRDKDYWIIKNSWGENWGENGYYKICRGRNICGVDSLVSTVAAVH  371



>ref|XP_009351218.1| PREDICTED: cysteine proteinase RD19a-like, partial [Pyrus x bretschneideri]
Length=282

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Compositional matrix adjust.
 Identities = 42/50 (84%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLKEKPYWIIKNSWGE+WGE G+YKICRGRNICGVDSMVSTVAA +  T+
Sbjct  231  RLKEKPYWIIKNSWGENWGENGFYKICRGRNICGVDSMVSTVAAASVKTN  280



>emb|CAB17075.1| cysteine proteinase precursor [Phaseolus vulgaris]
Length=365

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R KEKPYWIIKNSWGE+WG  GYYKICRGRN+CGVDSMVSTV A++  T
Sbjct  316  RFKEKPYWIIKNSWGENWGGNGYYKICRGRNVCGVDSMVSTVGAIHAST  364



>ref|XP_008387995.1| PREDICTED: cysteine proteinase 15A [Malus domestica]
Length=365

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA++T
Sbjct  316  RLKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALHT  362



>ref|XP_010910124.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=374

 Score = 94.7 bits (234),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKIC+GRN+CGVDSMVSTV AV +
Sbjct  327  RFKEKPYWIIKNSWGENWGEDGYYKICKGRNVCGVDSMVSTVTAVRS  373



>gb|ACK57563.1| cysteine protease-like protein [Arachis hypogaea]
Length=364

 Score = 94.4 bits (233),  Expect = 2e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVSTV A++T
Sbjct  315  RFKEKPYWIIKNSWGENWGENGYYKICRGPNMCGVDSMVSTVIAIHT  361



>ref|XP_009611293.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana tomentosiformis]
 emb|CAB44983.1| putative preprocysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  312  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>dbj|BAD94010.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
Length=86

 Score = 89.7 bits (221),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 40/51 (78%), Positives = 45/51 (88%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+ 
Sbjct  36   RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTAH  86



>gb|AAK07731.1| CPR2-like cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  312  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>ref|XP_006404590.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
 gb|ESQ46043.1| hypothetical protein EUTSA_v10000210mg [Eutrema salsugineum]
Length=363

 Score = 94.4 bits (233),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 38/43 (88%), Positives = 42/43 (98%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RLK+KPYWIIKNSWGE+WGE GYYK+CRGRNICGVDS+VSTVA
Sbjct  318  RLKKKPYWIIKNSWGETWGENGYYKLCRGRNICGVDSLVSTVA  360



>emb|CAA78361.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=363

 Score = 94.0 bits (232),  Expect = 3e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  312  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  358



>emb|CDX98179.1| BnaC07g09190D [Brassica napus]
Length=72

 Score = 89.4 bits (220),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 38/51 (75%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P + 
Sbjct  22   RFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAAH  72



>emb|CAA78365.1| tobacco pre-pro-cysteine proteinase [Nicotiana tabacum]
Length=365

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  314  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>emb|CDY09707.1| BnaC07g33540D [Brassica napus]
Length=366

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 42/48 (88%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  142
            RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAVNT
Sbjct  316  RLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVNT  363



>ref|XP_004238314.1| PREDICTED: cysteine proteinase 15A [Solanum lycopersicum]
Length=363

 Score = 94.0 bits (232),  Expect = 4e-21, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  312  RLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  358



>emb|CAB53397.1| cysteine protease [Medicago sativa]
Length=209

 Score = 92.4 bits (228),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 45/47 (96%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG++WGE+GYYKICRGRN+CGVDSMVSTVAA  +
Sbjct  163  RLKEKPYWIIKNSWGQNWGEEGYYKICRGRNVCGVDSMVSTVAAAQS  209



>ref|XP_006828787.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
 gb|ERM96203.1| hypothetical protein AMTR_s00001p00114210 [Amborella trichopoda]
Length=365

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK+K YWIIKNSWGE+WGEKGYYKICRG NICGVDSMVSTVA++ +
Sbjct  319  RLKDKAYWIIKNSWGETWGEKGYYKICRGHNICGVDSMVSTVASIQS  365



>gb|KJB29611.1| hypothetical protein B456_005G110200 [Gossypium raimondii]
Length=370

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R K+KP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA++T +
Sbjct  321  RFKDKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALHTKS  369



>gb|KHN12668.1| Cysteine proteinase 15A [Glycine soja]
Length=156

 Score = 90.9 bits (224),  Expect = 5e-21, Method: Compositional matrix adjust.
 Identities = 40/45 (89%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R K KPYWIIKNSWGESWGE GYYKICRGRN+CGVDSMVSTVAA+
Sbjct  107  RFKNKPYWIIKNSWGESWGENGYYKICRGRNVCGVDSMVSTVAAI  151



>ref|XP_006341997.1| PREDICTED: cysteine proteinase 15A-like [Solanum tuberosum]
Length=376

 Score = 93.6 bits (231),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK KPYWIIKNSWG++WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  325  RLKNKPYWIIKNSWGKTWGEHGYYKICRGHNICGVDAMVSTVTATHT  371



>emb|CDX99593.1| BnaC04g33500D [Brassica napus]
Length=343

 Score = 93.2 bits (230),  Expect = 5e-21, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CGVDSMVSTVAA
Sbjct  298  RFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGVDSMVSTVAA  341



>dbj|BAA92495.1| cysteine protease [Vigna mungo]
Length=364

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 39/46 (85%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGESWGE GYYKICRG+N CGVDSMVSTV A++
Sbjct  315  RFKEKPYWIIKNSWGESWGENGYYKICRGQNACGVDSMVSTVGAIH  360



>gb|AAQ81938.1| cysteine proteinase precursor [Ipomoea batatas]
Length=371

 Score = 93.2 bits (230),  Expect = 6e-21, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R K+KPYWIIKNSWGE+WGE+GYYKICRG NICGVDSMVS+V A +T
Sbjct  322  RFKDKPYWIIKNSWGENWGEEGYYKICRGNNICGVDSMVSSVTAAST  368



>ref|XP_008221329.1| PREDICTED: cysteine proteinase 15A-like [Prunus mume]
Length=366

 Score = 93.2 bits (230),  Expect = 7e-21, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVA+++T
Sbjct  317  RFKEKPYWILKNSWGQSWGEEGYYKICRGHNPCGVDSLVSTVASLHT  363



>gb|ABK93575.1| unknown [Populus trichocarpa]
Length=157

 Score = 90.5 bits (223),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 39/47 (83%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWGE+WGE GYYKICR RNICGVDSMVSTVAA++ 
Sbjct  108  RFKEKPFWIIKNSWGENWGENGYYKICRARNICGVDSMVSTVAAIHA  154



>ref|XP_010440192.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=365

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  315  RLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNVCGMDSMVSTVAAVHTTT  364



>ref|XP_009776238.1| PREDICTED: cysteine proteinase 15A-like [Nicotiana sylvestris]
Length=365

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 39/47 (83%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV A +T
Sbjct  314  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTVTAAHT  360



>emb|CDY15894.1| BnaA04g12170D [Brassica napus]
Length=362

 Score = 92.8 bits (229),  Expect = 8e-21, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>ref|XP_009140277.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=362

 Score = 92.8 bits (229),  Expect = 9e-21, Method: Composition-based stats.
 Identities = 36/44 (82%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YK+C+GRN+CG+DSMVSTVAA
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKLCKGRNVCGIDSMVSTVAA  360



>gb|KHG15062.1| Cysteinease RD19a -like protein [Gossypium arboreum]
Length=370

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 36/49 (73%), Positives = 45/49 (92%), Gaps = 0/49 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPT  148
            R K+KP+WIIKNSWG +WGE GYY+ICRGRN+CGVDSMVS+VAA++T +
Sbjct  321  RFKDKPFWIIKNSWGANWGEDGYYRICRGRNVCGVDSMVSSVAALHTKS  369



>ref|XP_009405542.1| PREDICTED: cysteine proteinase 1-like [Musa acuminata subsp. 
malaccensis]
Length=366

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R KEK YWIIKNSWGE+WGE GYYKICRGRNICGVDSMVS+V A+
Sbjct  320  RFKEKSYWIIKNSWGENWGENGYYKICRGRNICGVDSMVSSVTAI  364



>dbj|BAF46302.1| cysteine proteinase precursor [Ipomoea nil]
Length=369

 Score = 92.8 bits (229),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R K+KPYWI+KNSWGE+WGE+GYYKICRG NICG+DSMVSTV A +T
Sbjct  320  RFKDKPYWIVKNSWGENWGEEGYYKICRGNNICGIDSMVSTVTAAST  366



>gb|AJP16692.1| cysteine protease, partial [Striga hermonthica]
Length=148

 Score = 89.7 bits (221),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 39/44 (89%), Positives = 43/44 (98%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R+K+KPYWIIKNSWGE+WGE GYYKICRGRN+CGVDSMVSTVAA
Sbjct  105  RMKDKPYWIIKNSWGENWGENGYYKICRGRNVCGVDSMVSTVAA  148



>ref|XP_006283963.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
 gb|EOA16861.1| hypothetical protein CARUB_v10005086mg [Capsella rubella]
Length=368

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 38/50 (76%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  318  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  367



>ref|XP_010434865.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  315  RLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>dbj|BAD43619.1| putative cysteine proteinase [Arabidopsis thaliana]
Length=361

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  315  RLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>ref|NP_565512.1| Papain family cysteine protease [Arabidopsis thaliana]
 sp|P43295.2|A494_ARATH RecName: Full=Probable cysteine proteinase A494; Flags: Precursor 
[Arabidopsis thaliana]
 gb|AAD23687.1| cysteine proteinase [Arabidopsis thaliana]
 gb|ABJ98563.1| At2g21430 [Arabidopsis thaliana]
 gb|AEC07177.1| Papain family cysteine protease [Arabidopsis thaliana]
Length=361

 Score = 92.4 bits (228),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  315  RLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  361



>emb|CDX90537.1| BnaA03g42440D [Brassica napus]
Length=366

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  142
            RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  316  RLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  363



>emb|CAA52403.1| putative thiol protease [Arabidopsis thaliana]
Length=313

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/47 (85%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTVAA  +
Sbjct  267  RLKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVAATTS  313



>ref|XP_009136751.1| PREDICTED: cysteine proteinase RD19a-like [Brassica rapa]
Length=368

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/48 (85%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  142
            RL+EKPYWIIKNSWG  WGEKGYYKICRG  NICGVD+MVSTVAAV+T
Sbjct  318  RLEEKPYWIIKNSWGSMWGEKGYYKICRGTPNICGVDTMVSTVAAVHT  365



>ref|XP_010449835.1| PREDICTED: cysteine proteinase 15A-like [Camelina sativa]
Length=365

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+DSMVSTVAAV+T T
Sbjct  315  RLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDSMVSTVAAVHTTT  364



>ref|XP_006414378.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
 gb|ESQ55831.1| hypothetical protein EUTSA_v10025521mg [Eutrema salsugineum]
Length=367

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 43/50 (86%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG  WGE GYYKICRG  NICG+D+MVSTVAAV T T
Sbjct  317  RLKEKPYWIIKNSWGSMWGEHGYYKICRGSHNICGMDTMVSTVAAVQTST  366



>ref|XP_003574963.1| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=377

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            RLK KPYW+IKNSWGE+WGEKGYYKICRG   RN CGVDSMVSTVAA +T
Sbjct  324  RLKNKPYWVIKNSWGENWGEKGYYKICRGSNVRNKCGVDSMVSTVAAAHT  373



>ref|XP_006283974.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
 gb|EOA16872.1| hypothetical protein CARUB_v10005098mg [Capsella rubella]
Length=365

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 1/50 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNTPT  148
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T T
Sbjct  315  RLKEKPYWIIKNSWGSMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHTTT  364



>ref|NP_568052.1| cysteine proteinase RD19a [Arabidopsis thaliana]
 sp|P43296.1|RD19A_ARATH RecName: Full=Cysteine proteinase RD19a; Short=RD19; Flags: Precursor 
[Arabidopsis thaliana]
 dbj|BAA02373.1| thiol protease [Arabidopsis thaliana]
 emb|CAB38829.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 emb|CAB80572.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AAL85009.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 gb|AAM91778.1| putative cysteine proteinase RD19A [Arabidopsis thaliana]
 dbj|BAE98545.1| drought-inducible cysteine proteinase RD19A precursor [Arabidopsis 
thaliana]
 gb|AEE87016.1| cysteine proteinase RD19a [Arabidopsis thaliana]
Length=368

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDSMVSTVAA  + T+
Sbjct  318  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSMVSTVAATVSTTA  367



>emb|CAA78403.1| pre-pro-cysteine proteinase [Solanum lycopersicum]
Length=361

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK KPYWIIKNSWG++WGE GYYKICRG +ICGVD+MVSTV A +T
Sbjct  310  RLKNKPYWIIKNSWGKTWGEHGYYKICRGHHICGVDAMVSTVTATHT  356



>ref|XP_007223351.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
 gb|EMJ24550.1| hypothetical protein PRUPE_ppa007441mg [Prunus persica]
Length=367

 Score = 92.0 bits (227),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 36/47 (77%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWI+KNSWG+SWGE+G+YKICRG N CGVDS+VSTVA+++T
Sbjct  318  RFKEKPYWILKNSWGQSWGEEGFYKICRGHNSCGVDSLVSTVASLHT  364



>gb|EPS70818.1| cysteine proteinase, partial [Genlisea aurea]
Length=355

 Score = 91.7 bits (226),  Expect = 2e-20, Method: Composition-based stats.
 Identities = 37/47 (79%), Positives = 44/47 (94%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLK KPYWI+KNSWG++WGEKGYYKICRG NICGV+SMVSTV A+++
Sbjct  309  RLKNKPYWIVKNSWGKNWGEKGYYKICRGSNICGVESMVSTVTAIHS  355



>emb|CDY71205.1| BnaCnng71840D [Brassica napus]
Length=368

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  318  RFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>gb|ABK24153.1| unknown [Picea sitchensis]
Length=394

 Score = 92.0 bits (227),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 36/51 (71%), Positives = 42/51 (82%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            RLK KP+WIIKNSWG  WGE GYYK+CRG N+CG+++MVSTVAA N  T D
Sbjct  343  RLKNKPFWIIKNSWGPDWGEDGYYKLCRGHNVCGINTMVSTVAAANIQTDD  393



>gb|AAL60581.1|AF454959_1 senescence-associated cysteine protease [Brassica oleracea]
Length=368

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKICRGRN+CGVDS+VSTV A  +P +
Sbjct  318  RFKEKPYWIIKNSWGETWGEDGFYKICRGRNVCGVDSLVSTVTATVSPAA  367



>gb|ACX54787.2| cysteine protease [Arachis diogoi]
Length=360

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/51 (73%), Positives = 44/51 (86%), Gaps = 0/51 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTSD  154
            R K+KP+WIIKNSWGESWGE GYYKICRG+N+CGVDSMVS+V A    +S+
Sbjct  309  RFKDKPFWIIKNSWGESWGEDGYYKICRGKNVCGVDSMVSSVVATTFTSSN  359



>ref|XP_010437007.1| PREDICTED: cysteine proteinase RD19a-like [Camelina sativa]
Length=368

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  318  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  361



>gb|KFK24413.1| hypothetical protein AALP_AAs58848U000200 [Arabis alpina]
Length=372

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 42/50 (84%), Positives = 45/50 (90%), Gaps = 2/50 (4%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVN-TP  145
            RLKEKPYWIIKNSWG+ WGE GYYKICRGR NICG+D+MVSTVAAV  TP
Sbjct  322  RLKEKPYWIIKNSWGKMWGEHGYYKICRGRHNICGMDTMVSTVAAVQITP  371



>ref|XP_010431862.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 91.7 bits (226),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_010446443.1| PREDICTED: cysteine proteinase RD19a [Camelina sativa]
Length=367

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/44 (84%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV+A
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVSA  360



>ref|XP_008775280.1| PREDICTED: cysteine proteinase 1-like [Phoenix dactylifera]
Length=368

 Score = 91.3 bits (225),  Expect = 3e-20, Method: Composition-based stats.
 Identities = 37/45 (82%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R K+KPYWIIKNSWGE+WGE GYYKICRG NICGV+SMVSTV A+
Sbjct  322  RFKDKPYWIIKNSWGENWGEDGYYKICRGHNICGVESMVSTVTAI  366



>gb|KJB58164.1| hypothetical protein B456_009G197400 [Gossypium raimondii]
Length=375

 Score = 91.3 bits (225),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 36/46 (78%), Positives = 42/46 (91%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R K KPYWIIKNSWGE+WGE GYYKICRG N+CGVDSMVS+V+A++
Sbjct  321  RFKNKPYWIIKNSWGENWGENGYYKICRGNNVCGVDSMVSSVSALH  366



>ref|XP_009335626.1| PREDICTED: cysteine proteinase 15A [Pyrus x bretschneideri]
Length=366

 Score = 90.9 bits (224),  Expect = 4e-20, Method: Composition-based stats.
 Identities = 37/46 (80%), Positives = 43/46 (93%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            R KEKPYWI+KNSWG+SWGE+GYYKICRG N CGVDS+VSTVAA++
Sbjct  317  RFKEKPYWILKNSWGQSWGEQGYYKICRGYNSCGVDSLVSTVAALH  362



>gb|AAB62937.1| stress-induced cysteine proteinase [Lavatera thuringiaca]
Length=175

 Score = 89.0 bits (219),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 43/47 (91%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKP+WIIKNSWG +WGE GYYKICRGRN+CGVDSMVS+VAA+ T
Sbjct  126  RFKEKPFWIIKNSWGANWGEDGYYKICRGRNVCGVDSMVSSVAALQT  172



>ref|XP_008444769.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis melo]
Length=373

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 36/48 (75%), Positives = 42/48 (88%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTP  145
            R KEKPYWIIKNSWGE+WGE GYY IC+G+N+CG +SMVS+VAA  TP
Sbjct  325  RFKEKPYWIIKNSWGENWGENGYYFICKGKNVCGSESMVSSVAAAATP  372



>ref|XP_011083631.1| PREDICTED: cysteine proteinase 15A-like [Sesamum indicum]
Length=371

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 43/49 (88%), Gaps = 1/49 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN-TP  145
            RLKEKPYWIIKNSWGE+WGE GYYKICRG N+CGV SMVSTV A + TP
Sbjct  322  RLKEKPYWIIKNSWGENWGENGYYKICRGHNVCGVASMVSTVTAAHVTP  370



>gb|EYU27644.1| hypothetical protein MIMGU_mgv1a008452mg [Erythranthe guttata]
Length=373

 Score = 90.9 bits (224),  Expect = 5e-20, Method: Composition-based stats.
 Identities = 36/50 (72%), Positives = 46/50 (92%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLK KPYWI+KNSWGESWGE+GYYKIC+G N+CGV+SMVS+V A++T ++
Sbjct  324  RLKNKPYWIVKNSWGESWGEEGYYKICKGHNVCGVESMVSSVNAIHTTSA  373



>ref|XP_002452058.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
 gb|EES05034.1| hypothetical protein SORBIDRAFT_04g017830 [Sorghum bicolor]
Length=371

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Composition-based stats.
 Identities = 41/50 (82%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV T
Sbjct  319  RLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVRT  368



>gb|KFK30492.1| hypothetical protein AALP_AA7G268600 [Arabis alpina]
Length=367

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTVAA  + T+
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVAATVSTTA  366



>ref|XP_006411706.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
 dbj|BAJ33785.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ53159.1| hypothetical protein EUTSA_v10025494mg [Eutrema salsugineum]
Length=373

 Score = 90.5 bits (223),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 45/50 (90%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGESWGE G+YKIC+GRNICGVDS+VSTV+A  + T+
Sbjct  323  RFKEKPYWIIKNSWGESWGENGFYKICKGRNICGVDSLVSTVSATVSTTA  372



>emb|CDP07452.1| unnamed protein product [Coffea canephora]
Length=376

 Score = 90.5 bits (223),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 44/48 (92%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYK CR  RN+CGVDSMVS+VAAV+T
Sbjct  329  RLKDKPYWIIKNSWGENWGENGYYKFCRADRNLCGVDSMVSSVAAVHT  376



>ref|XP_004952477.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 90.1 bits (222),  Expect = 8e-20, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            RLKEKPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++
Sbjct  321  RLKEKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAIH  369



>ref|NP_567489.1| papain family cysteine protease [Arabidopsis thaliana]
 emb|CAB10398.1| cysteine proteinase like protein [Arabidopsis thaliana]
 emb|CAB78661.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AAK62611.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM91059.1| AT4g16190/dl4135w [Arabidopsis thaliana]
 gb|AAM96982.1| cysteine proteinase [Arabidopsis thaliana]
 gb|AAN31875.1| putative cysteine proteinase [Arabidopsis thaliana]
 dbj|BAE98514.1| cysteine proteinase like protein [Arabidopsis thaliana]
 gb|AEE83713.1| papain family cysteine protease [Arabidopsis thaliana]
Length=373

 Score = 90.1 bits (222),  Expect = 9e-20, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  323  RLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>ref|XP_010943608.1| PREDICTED: cysteine proteinase 1-like [Elaeis guineensis]
Length=371

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R K+KPYWIIKNSWG +WGE GYYKICRG+NICGV+SMVSTV AV T
Sbjct  324  RFKDKPYWIIKNSWGGNWGEDGYYKICRGQNICGVESMVSTVTAVRT  370



>dbj|BAG16515.1| putative cysteine proteinase [Capsicum chinense]
Length=367

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 42/48 (88%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGR-NICGVDSMVSTVAAVNT  142
            RLK KPYWIIKNSWGE WGE GYYKICRG+ NICGVD+MVSTV A +T
Sbjct  315  RLKAKPYWIIKNSWGEHWGEHGYYKICRGQHNICGVDAMVSTVTAAHT  362



>ref|XP_003579573.2| PREDICTED: cysteine proteinase 1-like [Brachypodium distachyon]
Length=399

 Score = 90.1 bits (222),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/54 (72%), Positives = 44/54 (81%), Gaps = 3/54 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNTPTSD  154
            R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T   +
Sbjct  346  RFKEKPYWIIKNSWGENWGESGYYKICRGAHVKNKCGVDSMVSTVTAIHTSNKE  399



>gb|EEE60725.1| hypothetical protein OsJ_14236 [Oryza sativa Japonica Group]
Length=364

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  310  RFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  359



>ref|XP_004152668.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 ref|XP_004167370.1| PREDICTED: cysteine proteinase RD19a-like [Cucumis sativus]
 gb|KGN62647.1| Cysteine protease [Cucumis sativus]
Length=371

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 36/45 (80%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            RLKEKPYWIIKNSWGE+WGE GYY IC+G+NICG +SMVS+VAA+
Sbjct  325  RLKEKPYWIIKNSWGENWGENGYYFICKGKNICGSESMVSSVAAI  369



>ref|XP_002870174.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH46433.1| hypothetical protein ARALYDRAFT_915142 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/48 (81%), Positives = 43/48 (90%), Gaps = 1/48 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG-RNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG  WGE GYYKICRG  N+CG+D+MVSTVAAV+T
Sbjct  323  RLKEKPYWIIKNSWGAMWGEHGYYKICRGPHNMCGMDTMVSTVAAVHT  370



>emb|CAQ00101.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=381

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  328  RFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  377



>emb|CAD40319.2| OSJNBb0054B09.3 [Oryza sativa Japonica Group]
 emb|CAH66180.1| OSIGBa0130O15.4 [Oryza sativa Indica Group]
 emb|CAH66205.1| OSIGBa0148D14.11 [Oryza sativa Indica Group]
Length=381

 Score = 89.7 bits (221),  Expect = 1e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  327  RFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  376



>ref|NP_001105685.1| cysteine proteinase 1 precursor [Zea mays]
 sp|Q10716.1|CYSP1_MAIZE RecName: Full=Cysteine proteinase 1; Flags: Precursor [Zea mays]
 dbj|BAA08244.1| cysteine proteinase [Zea mays]
Length=371

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+
Sbjct  319  RLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>gb|ACF86683.1| unknown [Zea mays]
 gb|AFW71402.1| cysteine protease1 [Zea mays]
Length=371

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 40/49 (82%), Positives = 44/49 (90%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+
Sbjct  319  RLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVH  367



>gb|EMT10192.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=369

 Score = 89.4 bits (220),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +
Sbjct  316  RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  364



>gb|EMT16425.1| Cysteine proteinase 1 [Aegilops tauschii]
Length=379

 Score = 89.7 bits (221),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  326  RFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  375



>gb|EAY93546.1| hypothetical protein OsI_15336 [Oryza sativa Indica Group]
Length=348

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  294  RFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  343



>emb|CAH59428.1| cysteine protease 2 [Plantago major]
Length=245

 Score = 88.2 bits (217),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            RLK KPYWIIKNSWGESWGE GYYKICRGRN+CGV+SMVS+V A +  T+
Sbjct  196  RLKNKPYWIIKNSWGESWGESGYYKICRGRNVCGVESMVSSVTAAHFTTT  245



>ref|XP_002868883.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH45142.1| hypothetical protein ARALYDRAFT_490677 [Arabidopsis lyrata subsp. 
lyrata]
Length=368

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  318  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  367



>tpe|CAD66657.1| TPA: putative cysteine proteinase precursor [Hordeum vulgare 
subsp. vulgare]
 dbj|BAJ94057.1| predicted protein [Hordeum vulgare subsp. vulgare]
 dbj|BAJ93100.1| predicted protein [Hordeum vulgare subsp. vulgare]
Length=377

 Score = 89.0 bits (219),  Expect = 2e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A ++
Sbjct  324  RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATHS  373



>emb|CDY41960.1| BnaA01g05320D [Brassica napus]
Length=367

 Score = 88.6 bits (218),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 38/50 (76%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  317  RFKEKPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>gb|AAZ32411.1| cysteine proteinase glycinain type [Nicotiana benthamiana]
Length=355

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 37/42 (88%), Positives = 39/42 (93%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTV  127
            RLKEK YWIIKNSWGE+WGE GYYKICRG NICGVD+MVSTV
Sbjct  314  RLKEKAYWIIKNSWGENWGEHGYYKICRGHNICGVDAMVSTV  355



>gb|EPS65881.1| cysteine proteinase, partial [Genlisea aurea]
Length=335

 Score = 88.2 bits (217),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 35/44 (80%), Positives = 42/44 (95%), Gaps = 0/44 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAA  133
            RLKEKPYWI+KNSWGE+WGE+GYYKIC+G N+CGV+S+VSTV A
Sbjct  292  RLKEKPYWIVKNSWGENWGEQGYYKICKGHNVCGVESLVSTVTA  335



>ref|XP_006653265.1| PREDICTED: cysteine proteinase 1-like, partial [Oryza brachyantha]
Length=366

 Score = 88.6 bits (218),  Expect = 4e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  313  RFKEKPYWIIKNSWGENWGENGYYKICRGPHVQNKCGVDSMVSTVTAIHT  362



>gb|ABK21238.1| unknown [Picea sitchensis]
 gb|ABR16087.1| unknown [Picea sitchensis]
 gb|ABR17330.1| unknown [Picea sitchensis]
 gb|ABR17545.1| unknown [Picea sitchensis]
 gb|ACN40765.1| unknown [Picea sitchensis]
Length=366

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  322  RMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ABK24688.1| unknown [Picea sitchensis]
 gb|ACN39791.1| unknown [Picea sitchensis]
 gb|ACN40241.1| unknown [Picea sitchensis]
Length=366

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  322  RMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|ACN40679.1| unknown [Picea sitchensis]
Length=366

 Score = 88.2 bits (217),  Expect = 5e-19, Method: Composition-based stats.
 Identities = 32/45 (71%), Positives = 42/45 (93%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R+K+KPYW+IKNSWG +WGE GYYK+CRG N+CG+++MVSTVAA+
Sbjct  322  RMKDKPYWVIKNSWGPNWGENGYYKLCRGHNVCGINNMVSTVAAI  366



>gb|EMS53996.1| Cysteine proteinase 1 [Triticum urartu]
Length=405

 Score = 88.6 bits (218),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 43/50 (86%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGE GYYKICRG   +N CGVDSMVSTV A++T
Sbjct  352  RFKEKPYWIIKNSWGENWGESGYYKICRGPHVKNKCGVDSMVSTVTAIHT  401



>gb|AAW21813.1| cysteine protease [Triticum aestivum]
Length=377

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +
Sbjct  324  RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  372



>ref|XP_009150026.1| PREDICTED: cysteine proteinase RD19a [Brassica rapa]
Length=367

 Score = 87.8 bits (216),  Expect = 6e-19, Method: Compositional matrix adjust.
 Identities = 37/50 (74%), Positives = 44/50 (88%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KE+PYWIIKNSWGE+WGE G+YKIC+GRNICGVDS+VSTV A  + T+
Sbjct  317  RFKERPYWIIKNSWGETWGENGFYKICKGRNICGVDSLVSTVTAAVSTTA  366



>gb|EMS64962.1| Cysteine proteinase 1 [Triticum urartu]
Length=302

 Score = 87.4 bits (215),  Expect = 6e-19, Method: Composition-based stats.
 Identities = 39/49 (80%), Positives = 43/49 (88%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGE+WG+KGYYKICRG   RN CGVDSMVSTV+A +
Sbjct  249  RFKEKPYWIIKNSWGENWGDKGYYKICRGSNVRNKCGVDSMVSTVSATH  297



>gb|AAB16996.1| thiol protease isoform B, partial [Glycine max]
Length=319

 Score = 86.7 bits (213),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 38/45 (84%), Positives = 41/45 (91%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            R K KPYWIIKNSWGESWGE GY +ICRGRN+CGVDSMVSTVAA+
Sbjct  270  RFKNKPYWIIKNSWGESWGENGYDEICRGRNVCGVDSMVSTVAAI  314



>ref|NP_001046828.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAD19579.1| putative cysteine proteinase 1 precursor [Oryza sativa Japonica 
Group]
 dbj|BAF08742.1| Os02g0469600 [Oryza sativa Japonica Group]
 dbj|BAG92750.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG93804.1| unnamed protein product [Oryza sativa Japonica Group]
 dbj|BAG94031.1| unnamed protein product [Oryza sativa Japonica Group]
 gb|EEC83204.1| hypothetical protein OsI_28465 [Oryza sativa Indica Group]
 gb|EEE56967.1| hypothetical protein OsJ_06681 [Oryza sativa Japonica Group]
Length=373

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            RLK+K YWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+A++T
Sbjct  321  RLKDKAYWIIKNSWGENWGEHGYYKICRGSNVRNKCGVDSMVSTVSAIHT  370



>ref|XP_009786000.1| PREDICTED: cysteine proteinase RD19a-like [Nicotiana sylvestris]
Length=370

 Score = 87.0 bits (214),  Expect = 1e-18, Method: Composition-based stats.
 Identities = 34/38 (89%), Positives = 36/38 (95%), Gaps = 0/38 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSM  115
            R+KEKPYWIIKNSWGE WGE GYYKICRGRN+CGVDSM
Sbjct  321  RMKEKPYWIIKNSWGEKWGENGYYKICRGRNVCGVDSM  358



>ref|XP_006665032.1| PREDICTED: cysteine proteinase 1-like [Oryza brachyantha]
Length=191

 Score = 85.5 bits (210),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNI---CGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYKICRG N+   CGVDSMVSTV A++T
Sbjct  139  RLKDKPYWIIKNSWGENWGEHGYYKICRGSNVRDKCGVDSMVSTVTAIHT  188



>ref|XP_004975256.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=388

 Score = 87.0 bits (214),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 37/49 (76%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVN  139
            R KEKPYWIIKNSWGE+WGE GYYK+CRG   +N CGVDSMVSTV A++
Sbjct  335  RFKEKPYWIIKNSWGENWGENGYYKLCRGPFVKNKCGVDSMVSTVTAIH  383



>ref|XP_002279862.1| PREDICTED: cysteine proteinase RD19a [Vitis vinifera]
 emb|CBI19784.3| unnamed protein product [Vitis vinifera]
Length=368

 Score = 86.3 bits (212),  Expect = 2e-18, Method: Composition-based stats.
 Identities = 35/50 (70%), Positives = 41/50 (82%), Gaps = 0/50 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTPTS  151
            R KEKPYWI+KNSW + WGE GYY+ICRG+N+CGVDSMVS+V A    TS
Sbjct  318  RFKEKPYWILKNSWSKYWGEHGYYRICRGQNMCGVDSMVSSVVAAIQTTS  367



>emb|CAA57675.1| cysteine proteinase [Zea mays]
Length=145

 Score = 83.6 bits (205),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  93   RLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  142



>gb|AGS43121.1| cysteine protease 1, partial [Zea mays]
Length=90

 Score = 82.4 bits (202),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/50 (80%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            RLK+KPYWIIKNSWGE+WGE GYYKICRG   RN CGVDSMVSTV+AV+ 
Sbjct  38   RLKDKPYWIIKNSWGENWGENGYYKICRGSNVRNKCGVDSMVSTVSAVHA  87



>ref|NP_001059639.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAC45132.1| putative cysteine proteinase [Oryza sativa Japonica Group]
 dbj|BAF21553.1| Os07g0480900 [Oryza sativa Japonica Group]
 dbj|BAG88694.1| unnamed protein product [Oryza sativa Japonica Group]
Length=376

 Score = 85.1 bits (209),  Expect = 7e-18, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 41/48 (85%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTP  145
            RL  +PYWIIKNSWG++WGE+GYY++CRGRN+CGVD+MVS VA    P
Sbjct  328  RLGHRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDTMVSAVAVAPPP  375



>gb|AAB16997.1| thiol protease isoform A, partial [Glycine max]
Length=318

 Score = 84.3 bits (207),  Expect = 8e-18, Method: Composition-based stats.
 Identities = 37/46 (80%), Positives = 41/46 (89%), Gaps = 1/46 (2%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEK-GYYKICRGRNICGVDSMVSTVAAV  136
            R K KPYWIIKNSWGESWGE  GY +ICRGRN+CGVD+MVSTVAA+
Sbjct  268  RFKNKPYWIIKNSWGESWGENDGYDEICRGRNVCGVDAMVSTVAAI  313



>ref|NP_001052440.1| Os04g0311400 [Oryza sativa Japonica Group]
 dbj|BAF14354.1| Os04g0311400, partial [Oryza sativa Japonica Group]
Length=384

 Score = 85.1 bits (209),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/50 (78%), Positives = 44/50 (88%), Gaps = 3/50 (6%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRG---RNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE+WGEKGYYKICRG   +N CGVDSMVS+V A++T
Sbjct  330  RFKEKPYWIIKNSWGENWGEKGYYKICRGPHDKNKCGVDSMVSSVTAIHT  379



>dbj|BAD10859.1| cysteine protease [Aster tripolium]
Length=363

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            R KEKPYWIIKNSWGE WGE GYYK+C G N CG+D+MVS V + NT
Sbjct  317  RFKEKPYWIIKNSWGEDWGEDGYYKLCSGYNACGMDTMVSAVVSTNT  363



>ref|XP_002460693.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
 gb|EER97214.1| hypothetical protein SORBIDRAFT_02g033270 [Sorghum bicolor]
Length=373

 Score = 84.3 bits (207),  Expect = 1e-17, Method: Composition-based stats.
 Identities = 34/48 (71%), Positives = 39/48 (81%), Gaps = 0/48 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTP  145
            RL  +PYWIIKNSWGE WGE+GYY++CRG N+CGVDSMVS VA    P
Sbjct  326  RLGYRPYWIIKNSWGERWGEQGYYRLCRGSNVCGVDSMVSAVAVAPVP  373



>ref|XP_006658557.1| PREDICTED: LOW QUALITY PROTEIN: cysteine proteinase 15A-like 
[Oryza brachyantha]
Length=346

 Score = 83.2 bits (204),  Expect = 3e-17, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 40/43 (93%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  +PYWIIKNSWG++WGE+GYY++CRGRN+CGVDSMVS VA
Sbjct  300  RLGYRPYWIIKNSWGKAWGEQGYYRLCRGRNVCGVDSMVSAVA  342



>gb|AEX97108.1| cysteine proteinase, partial [Malus domestica]
Length=128

 Score = 80.5 bits (197),  Expect = 3e-17, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 42/48 (88%), Gaps = 2/48 (4%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTP  145
            R KEKPYWIIKNSWG++WGE GYY IC+GRNICG +SMVS+VAA  TP
Sbjct  44   RFKEKPYWIIKNSWGQNWGENGYYLICKGRNICGSESMVSSVAA--TP  89



>ref|XP_009404192.1| PREDICTED: cysteine proteinase 15A [Musa acuminata subsp. malaccensis]
Length=361

 Score = 82.8 bits (203),  Expect = 4e-17, Method: Composition-based stats.
 Identities = 33/46 (72%), Positives = 40/46 (87%), Gaps = 0/46 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVN  139
            RL  +PYWIIKNSWG+ WGE+GYY++CRG NICG+DSMVS VAA +
Sbjct  316  RLGYRPYWIIKNSWGKQWGEQGYYRLCRGHNICGIDSMVSAVAAAS  361



>emb|CAQ00102.1| papain-like cysteine proteinase [Hordeum vulgare subsp. vulgare]
Length=368

 Score = 82.8 bits (203),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 33/43 (77%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  +PYW+IKNSWG  WGE GYYK+CRGRN+CGVDSMVS VA
Sbjct  323  RLGYRPYWLIKNSWGAQWGEGGYYKLCRGRNVCGVDSMVSAVA  365



>ref|XP_002960585.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
 gb|EFJ38124.1| hypothetical protein SELMODRAFT_266583 [Selaginella moellendorffii]
Length=330

 Score = 82.4 bits (202),  Expect = 5e-17, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            R  EKPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  288  RFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  330



>ref|XP_002969223.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
 gb|EFJ29311.1| hypothetical protein SELMODRAFT_91274 [Selaginella moellendorffii]
Length=367

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            R  EKPYWIIKNSWG +WGE+GYYKICRG  +CG+++MVSTVA
Sbjct  325  RFTEKPYWIIKNSWGATWGEQGYYKICRGHGMCGMNTMVSTVA  367



>ref|XP_004959670.1| PREDICTED: cysteine proteinase 1-like [Setaria italica]
Length=374

 Score = 82.4 bits (202),  Expect = 7e-17, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  +PYW+IKNSWGE WGEKGYY++CRG N+CGVD+MVS VA
Sbjct  324  RLGYRPYWVIKNSWGEQWGEKGYYRLCRGSNVCGVDTMVSAVA  366



>tpg|DAA40800.1| TPA: putative cysteine protease family protein [Zea mays]
Length=381

 Score = 82.0 bits (201),  Expect = 1e-16, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  +PYWIIKNSWG+ WGE+GYY++CRG N+CGVDSMVS VA
Sbjct  334  RLGYRPYWIIKNSWGKQWGEQGYYRLCRGSNVCGVDSMVSAVA  376



>ref|XP_009117680.1| PREDICTED: probable cysteine proteinase A494 [Brassica rapa]
Length=357

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/42 (76%), Positives = 38/42 (90%), Gaps = 0/42 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTV  127
            R KEKPYWIIKNSWGE+WGE G++K+C+GRNICG  S+VSTV
Sbjct  316  RFKEKPYWIIKNSWGETWGESGFFKLCKGRNICGFGSLVSTV  357



>ref|XP_010690815.1| PREDICTED: cysteine proteinase RD19a [Beta vulgaris subsp. vulgaris]
Length=403

 Score = 81.6 bits (200),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 33/48 (69%), Positives = 42/48 (88%), Gaps = 2/48 (4%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNTP  145
            R +EKPYWIIKNSWGE WGE GYY++CRG ++CGV+++VSTVA  +TP
Sbjct  357  RKEEKPYWIIKNSWGEYWGENGYYRLCRGYDLCGVNTLVSTVA--DTP  402



>gb|EMS59778.1| Cysteine proteinase 15A [Triticum urartu]
Length=195

 Score = 79.7 bits (195),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/43 (77%), Positives = 38/43 (88%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  +PYW+IKNSWG+ WGE GYYK+CRGRN+CGVDSMVS VA
Sbjct  150  RLGYRPYWLIKNSWGQQWGEGGYYKLCRGRNVCGVDSMVSAVA  192



>ref|XP_006293095.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
 gb|EOA25993.1| hypothetical protein CARUB_v10019394mg [Capsella rubella]
Length=367

 Score = 81.3 bits (199),  Expect = 2e-16, Method: Composition-based stats.
 Identities = 32/43 (74%), Positives = 37/43 (86%), Gaps = 0/43 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVA  130
            RL  KPYWIIKNSWG+ WGE GYYK+CRG +ICG++SMVS VA
Sbjct  320  RLSNKPYWIIKNSWGKKWGEDGYYKLCRGHDICGINSMVSAVA  362



>ref|XP_008776953.1| PREDICTED: cysteine proteinase-like [Phoenix dactylifera]
Length=144

 Score = 78.6 bits (192),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 33/45 (73%), Positives = 38/45 (84%), Gaps = 0/45 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAV  136
            RL  +PYWIIKNSWG+ WGE GYY++CRG NICG+DSMVS VAA 
Sbjct  94   RLGYRPYWIIKNSWGKQWGENGYYRLCRGHNICGIDSMVSAVAAT  138



>dbj|BAC57957.1| thiol protease [Aster tripolium]
Length=188

 Score = 79.0 bits (193),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 38/47 (81%), Gaps = 0/47 (0%)
 Frame = +2

Query  2    RLKEKPYWIIKNSWGESWGEKGYYKICRGRNICGVDSMVSTVAAVNT  142
            RLKEKPYWIIKNSWG  WGE GYYKIC G N+CG+D+MVS V + + 
Sbjct  142  RLKEKPYWIIKNSWGPDWGEDGYYKICSGHNLCGMDTMVSAVVSTSA  188



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 561488607120