BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020B10 467 bp,

Length=439
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

ref|XP_011088786.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  99.4    8e-22   
ref|XP_011088778.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  99.0    1e-21   Sesamum indicum [beniseed]
ref|XP_007134415.1|  hypothetical protein PHAVU_010G045600g           97.4    3e-21   Phaseolus vulgaris [French bean]
ref|XP_009765388.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  97.8    3e-21   Nicotiana sylvestris
ref|XP_011088772.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  98.6    4e-21   Sesamum indicum [beniseed]
ref|XP_007134414.1|  hypothetical protein PHAVU_010G045600g           97.1    4e-21   Phaseolus vulgaris [French bean]
ref|XP_006576707.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  97.4    8e-21   
ref|XP_009765385.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  97.1    1e-20   Nicotiana sylvestris
ref|XP_009765384.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  97.1    2e-20   Nicotiana sylvestris
ref|XP_007134412.1|  hypothetical protein PHAVU_010G045600g           97.1    2e-20   Phaseolus vulgaris [French bean]
ref|XP_003521056.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  97.1    2e-20   
ref|XP_007134413.1|  hypothetical protein PHAVU_010G045600g           96.7    2e-20   Phaseolus vulgaris [French bean]
ref|NP_001117214.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  95.9    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077448.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  96.7    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|ABF59128.1|  unknown protein                                       95.9    2e-20   Arabidopsis thaliana [mouse-ear cress]
ref|NP_001077446.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  96.3    2e-20   Arabidopsis thaliana [mouse-ear cress]
gb|EYU40344.1|  hypothetical protein MIMGU_mgv1a005831mg              95.9    3e-20   Erythranthe guttata [common monkey flower]
ref|XP_009765386.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  96.3    3e-20   Nicotiana sylvestris
ref|XP_006583508.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  94.7    3e-20   
ref|XP_010089788.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  95.9    4e-20   
gb|KFK42589.1|  hypothetical protein AALP_AA1G015000                  95.1    4e-20   Arabis alpina [alpine rockcress]
ref|XP_006583509.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  95.9    4e-20   Glycine max [soybeans]
ref|XP_010246100.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  95.5    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_010246099.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  95.5    5e-20   Nelumbo nucifera [Indian lotus]
ref|XP_007052356.1|  Asparagine-linked glycosylation 12 isoform 3     94.4    5e-20   
ref|XP_004307243.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  95.5    5e-20   Fragaria vesca subsp. vesca
ref|XP_006418502.1|  hypothetical protein EUTSA_v10007459mg           94.4    6e-20   
ref|XP_002301238.2|  hypothetical protein POPTR_0002s14010g           95.1    6e-20   
ref|XP_006418503.1|  hypothetical protein EUTSA_v10007459mg           94.4    7e-20   
ref|XP_002892023.1|  hypothetical protein ARALYDRAFT_887214           94.7    8e-20   Arabidopsis lyrata subsp. lyrata
ref|XP_009375362.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  94.7    8e-20   Pyrus x bretschneideri [bai li]
ref|XP_008232378.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  94.7    1e-19   Prunus mume [ume]
ref|XP_010692030.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  94.7    1e-19   Beta vulgaris subsp. vulgaris [field beet]
gb|KJB24899.1|  hypothetical protein B456_004G166900                  93.6    1e-19   Gossypium raimondii
ref|XP_007052355.1|  Asparagine-linked glycosylation 12 isoform 2     94.0    1e-19   
ref|XP_006418501.1|  hypothetical protein EUTSA_v10007459mg           94.0    2e-19   Eutrema salsugineum [saltwater cress]
ref|NP_001077447.2|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  92.4    2e-19   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009603142.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  94.0    2e-19   Nicotiana tomentosiformis
ref|XP_008460079.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  92.4    2e-19   
ref|XP_009119758.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  93.2    2e-19   Brassica rapa
ref|XP_007052354.1|  Asparagine-linked glycosylation 12 isoform 1     94.0    3e-19   
ref|XP_006445446.1|  hypothetical protein CICLE_v10019843mg           93.2    3e-19   Citrus clementina [clementine]
ref|XP_009603143.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  93.2    3e-19   Nicotiana tomentosiformis
emb|CDY15127.1|  BnaC05g00060D                                        93.2    4e-19   Brassica napus [oilseed rape]
emb|CDX90078.1|  BnaA10g00040D                                        93.2    4e-19   
ref|XP_009119757.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  93.2    4e-19   Brassica rapa
gb|KJB24902.1|  hypothetical protein B456_004G166900                  92.8    4e-19   Gossypium raimondii
ref|XP_006306188.1|  hypothetical protein CARUB_v10011809mg           93.2    4e-19   Capsella rubella
gb|KJB24900.1|  hypothetical protein B456_004G166900                  92.4    4e-19   Gossypium raimondii
gb|KJB24901.1|  hypothetical protein B456_004G166900                  92.8    4e-19   Gossypium raimondii
ref|XP_003636166.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  91.7    5e-19   
ref|XP_002448266.1|  hypothetical protein SORBIDRAFT_06g024210        92.4    7e-19   Sorghum bicolor [broomcorn]
ref|XP_010325203.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    7e-19   Solanum lycopersicum
gb|KEH17914.1|  Alg9-like mannosyltransferase family protein          92.0    8e-19   Medicago truncatula
gb|AIE43865.1|  WRKY transcription factor 25                          92.4    1e-18   Gossypium hirsutum [American cotton]
ref|XP_004229733.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.7    1e-18   
ref|XP_008460077.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.7    1e-18   Cucumis melo [Oriental melon]
ref|XP_011017393.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.7    1e-18   Populus euphratica
ref|XP_011017394.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.7    1e-18   Populus euphratica
emb|CDP09422.1|  unnamed protein product                              90.9    1e-18   Coffea canephora [robusta coffee]
ref|XP_008460078.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    1e-18   Cucumis melo [Oriental melon]
ref|XP_006464407.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.7    1e-18   Citrus sinensis [apfelsine]
ref|XP_006464408.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    1e-18   Citrus sinensis [apfelsine]
ref|XP_008375731.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    2e-18   
ref|XP_011017391.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    2e-18   Populus euphratica
ref|XP_004145015.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    2e-18   
ref|XP_011017392.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    2e-18   Populus euphratica
ref|XP_004160680.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  91.3    2e-18   
emb|CDY38057.1|  BnaCnng09180D                                        90.9    2e-18   Brassica napus [oilseed rape]
ref|XP_006347991.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    2e-18   
ref|XP_010496471.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  90.5    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010496472.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  90.5    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010496473.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  90.1    3e-18   Camelina sativa [gold-of-pleasure]
ref|XP_004515328.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  90.5    3e-18   Cicer arietinum [garbanzo]
ref|XP_004515329.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  90.5    4e-18   Cicer arietinum [garbanzo]
ref|XP_010496687.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.7    4e-18   
ref|XP_009118864.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    4e-18   Brassica rapa
tpg|DAA36628.1|  TPA: hypothetical protein ZEAMMB73_968947            89.4    7e-18   
ref|XP_010496684.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010479311.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    8e-18   Camelina sativa [gold-of-pleasure]
ref|XP_009118862.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    8e-18   Brassica rapa
ref|XP_010496685.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.4    9e-18   Camelina sativa [gold-of-pleasure]
ref|XP_010496686.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.0    1e-17   Camelina sativa [gold-of-pleasure]
ref|XP_010540209.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_010540210.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.0    1e-17   Tarenaya hassleriana [spider flower]
ref|XP_006347989.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  88.2    1e-17   Solanum tuberosum [potatoes]
gb|KDP28876.1|  hypothetical protein JCGZ_14647                       89.0    1e-17   Jatropha curcas
ref|XP_006347988.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  89.0    1e-17   
ref|XP_009375365.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  88.6    1e-17   Pyrus x bretschneideri [bai li]
ref|XP_002271419.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  88.2    2e-17   Vitis vinifera
emb|CBI16681.3|  unnamed protein product                              87.8    2e-17   Vitis vinifera
ref|XP_008786182.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  86.7    4e-17   
ref|XP_008786180.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  87.4    4e-17   Phoenix dactylifera
ref|XP_008786179.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  87.4    4e-17   
ref|XP_008786181.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  87.4    4e-17   Phoenix dactylifera
ref|XP_008786178.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  87.4    5e-17   
ref|XP_008786177.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  87.0    5e-17   
gb|KCW73099.1|  hypothetical protein EUGRSUZ_E015451                  84.7    9e-17   Eucalyptus grandis [rose gum]
ref|XP_002526470.1|  glycosyltransferase, putative                    86.3    1e-16   
ref|XP_010056387.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.3    1e-16   
ref|XP_008375733.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  85.1    2e-16   
ref|XP_004956421.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.7    3e-16   Setaria italica
ref|XP_006652601.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.3    3e-16   
ref|XP_004956422.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.7    3e-16   
ref|XP_009381984.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.7    3e-16   
ref|XP_010056385.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  83.6    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010056384.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.0    5e-16   Eucalyptus grandis [rose gum]
ref|XP_010056383.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.0    6e-16   Eucalyptus grandis [rose gum]
ref|XP_003580264.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  84.0    6e-16   Brachypodium distachyon [annual false brome]
ref|XP_010933577.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  83.6    7e-16   
ref|XP_010933576.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  83.6    7e-16   
ref|XP_010933573.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  83.6    8e-16   Elaeis guineensis
ref|XP_010933572.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  83.6    8e-16   Elaeis guineensis
gb|EPS65150.1|  hypothetical protein M569_09628                       82.8    9e-16   Genlisea aurea
ref|XP_006838582.1|  hypothetical protein AMTR_s00002p00214180        82.4    2e-15   Amborella trichopoda
tpg|DAA36629.1|  TPA: hypothetical protein ZEAMMB73_968947            82.0    2e-15   
ref|NP_001053463.1|  Os04g0544900                                     82.0    3e-15   
ref|XP_008667967.1|  PREDICTED: dolichyl-P-Man Man isoform X1         81.6    3e-15   
tpg|DAA36630.1|  TPA: dolichyl-P-Man Man                              81.6    4e-15   
ref|XP_009381985.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  81.3    5e-15   Musa acuminata subsp. malaccensis [pisang utan]
ref|NP_001148825.1|  dolichyl-P-Man Man                               80.1    1e-14   Zea mays [maize]
ref|XP_002969331.1|  mannosyltransferase-like protein                 77.0    2e-13   
gb|KFO05594.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  72.4    1e-12   Balearica regulorum gibbericeps
ref|XP_008549304.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  75.5    1e-12   
ref|XP_010304542.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  72.8    1e-12   Balearica regulorum gibbericeps
gb|EFN68776.1|  Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  73.2    6e-12   Camponotus floridanus
ref|XP_011255575.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  73.2    6e-12   Camponotus floridanus
ref|XP_001758628.1|  predicted protein                                71.6    1e-11   
ref|XP_003491108.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  72.4    1e-11   
ref|XP_009118863.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  71.6    1e-11   
ref|XP_003402011.1|  PREDICTED: hypothetical protein LOC100650099     72.0    2e-11   
ref|XP_001117738.2|  PREDICTED: dolichyl-P-Man:Man(7)GlcNAc(2)-PP...  67.0    2e-11   
ref|XP_003700215.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  70.9    4e-11   
ref|XP_009030087.1|  hypothetical protein HELRODRAFT_70039            70.1    4e-11   Helobdella robusta
ref|XP_010933575.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  70.1    4e-11   Elaeis guineensis
ref|XP_011163791.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  70.5    5e-11   
gb|KFV12894.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  69.7    5e-11   Pterocles gutturalis
ref|XP_001640825.1|  predicted protein                                69.7    5e-11   Nematostella vectensis
ref|XP_010078902.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.7    5e-11   Pterocles gutturalis
gb|AJC98479.1|  AGAP000102                                            70.1    6e-11   Anopheles coluzzii
gb|AJC98491.1|  AGAP000102                                            70.1    6e-11   Anopheles coluzzii
ref|XP_009907509.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    7e-11   Picoides pubescens
gb|KFV76590.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  69.3    7e-11   Picoides pubescens
ref|XP_008934732.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    7e-11   Merops nubicus
ref|XP_010010445.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    7e-11   Nestor notabilis
gb|KFO86029.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  69.3    8e-11   Buceros rhinoceros silvestris
ref|XP_005150100.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    8e-11   Melopsittacus undulatus
ref|XP_011349260.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.7    8e-11   
ref|XP_010143942.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  69.3    8e-11   Buceros rhinoceros silvestris
ref|XP_007974352.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.9    9e-11   Chlorocebus sabaeus
gb|AJC98481.1|  AGAP000102                                            69.7    9e-11   Anopheles coluzzii
gb|AJC98474.1|  AGAP000102                                            69.7    9e-11   Anopheles coluzzii
gb|AJC98476.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
ref|XP_003689857.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.7    9e-11   
gb|AJC98490.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
gb|AJC98492.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
gb|AJC98482.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
gb|AJC98475.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
gb|AJC98493.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
gb|AJC98484.1|  AGAP000102                                            69.3    9e-11   Anopheles coluzzii
ref|XP_006617369.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.7    9e-11   Apis dorsata [rock honeybee]
gb|AJC98489.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
ref|XP_311046.4|  AGAP000102-PA                                       69.3    1e-10   Anopheles gambiae str. PEST
gb|AJC98486.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
gb|AJC98477.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
gb|AJC98485.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
gb|AJC98488.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
gb|AJC98483.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
ref|XP_011063596.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.3    1e-10   Acromyrmex echinatior
gb|EGI70265.1|  Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  69.3    1e-10   Acromyrmex echinatior
ref|XP_004438054.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.9    1e-10   Ceratotherium simum simum [southern square-lipped rhinoceros]
gb|AJC98480.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
gb|AJC98478.1|  AGAP000102                                            69.3    1e-10   Anopheles coluzzii
ref|XP_010371872.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   Rhinopithecus roxellana
ref|XP_011220646.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   
ref|XP_003770822.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   
ref|XP_011153544.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  69.3    1e-10   
ref|XP_009215805.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   
ref|XP_003905777.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   Papio anubis [baboon]
gb|EHH20343.1|  hypothetical protein EGK_03180                        68.6    1e-10   Macaca mulatta [rhesus macaque]
ref|XP_007974351.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   Chlorocebus sabaeus
ref|XP_005567025.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    1e-10   Macaca fascicularis [crab eating macaque]
ref|XP_009215802.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-10   
ref|XP_007974353.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-10   Chlorocebus sabaeus
ref|XP_007974350.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.6    2e-10   Chlorocebus sabaeus
gb|EFX61262.1|  hypothetical protein DAPPUDRAFT_340335                68.6    2e-10   Daphnia pulex
ref|XP_002917304.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-10   Ailuropoda melanoleuca
ref|XP_010371868.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  68.2    2e-10   Rhinopithecus roxellana
ref|XP_003732200.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  68.2    2e-10   Callithrix jacchus [common marmoset]
ref|XP_008205527.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  68.9    2e-10   
gb|AJC98494.1|  AGAP000102                                            68.6    2e-10   Anopheles merus
ref|XP_009215804.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.8    2e-10   Papio anubis [baboon]
gb|EOB00345.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  67.4    3e-10   Anas platyrhynchos [duck]
ref|XP_001901623.1|  Plasmid Maintenance Protein containing protein   67.4    3e-10   Brugia malayi [agent of lymphatic filariasis]
ref|XP_001663288.1|  AAEL013078-PA                                    67.8    3e-10   
ref|XP_004610821.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.8    3e-10   Sorex araneus [Eurasian shrew]
ref|XP_005020901.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.4    4e-10   
ref|XP_002831329.2|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  66.6    4e-10   
ref|XP_001648338.1|  AAEL014279-PA                                    67.4    4e-10   
ref|XP_006557963.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  67.8    4e-10   
gb|EFX74600.1|  hypothetical protein DAPPUDRAFT_307223                65.9    4e-10   Daphnia pulex
ref|XP_006557961.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  67.8    4e-10   
gb|EJW79963.1|  plasmid Maintenance protein containing protein        66.6    5e-10   Wuchereria bancrofti [agent of lymphatic filariasis]
ref|XP_004063719.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    5e-10   Gorilla gorilla gorilla [lowland gorilla]
ref|XP_004409739.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  67.0    5e-10   Odobenus rosmarus divergens
gb|KDR17512.1|  putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  67.4    5e-10   Zootermopsis nevadensis
gb|EHH65944.1|  hypothetical protein EGM_02821                        66.6    5e-10   Macaca fascicularis [crab eating macaque]
emb|CAC83681.1|  putative dolichyl-p-man: Man7GlcNAc2-PP-dolichyl...  66.6    6e-10   Homo sapiens [man]
gb|AAH98562.1|  Asparagine-linked glycosylation 12, alpha-1,6-man...  66.6    6e-10   Homo sapiens [man]
ref|NP_077010.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mann...  66.6    6e-10   Homo sapiens [man]
ref|XP_007889176.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    6e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_002831330.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    6e-10   
ref|XP_001489274.3|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.9    6e-10   
gb|EHJ73778.1|  putative glycosyltransferase                          66.6    7e-10   
ref|XP_001850969.1|  glycosyltransferase                              66.6    8e-10   Culex quinquefasciatus
ref|XP_002104066.1|  GD18643                                          66.6    8e-10   
ref|XP_007889175.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.5    8e-10   Callorhinchus milii [Australian ghost shark]
ref|XP_003932812.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  66.2    8e-10   Saimiri boliviensis boliviensis
ref|NP_001016120.1|  ALG12, alpha-1,6-mannosyltransferase precursor   66.2    9e-10   Xenopus tropicalis [western clawed frog]
gb|AAM94900.1|AF311904_1  membrane protein SB87 precursor             66.6    9e-10   Homo sapiens [man]
gb|AAI55513.1|  asparagine-linked glycosylation 12, alpha-1,6-man...  66.2    9e-10   Xenopus tropicalis [western clawed frog]
ref|XP_005207555.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.9    9e-10   
ref|XP_008701210.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  65.9    1e-09   Ursus maritimus [white bear]
gb|ENN80093.1|  hypothetical protein YQE_03452                        66.2    1e-09   Dendroctonus ponderosae
ref|XP_004007716.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  65.9    1e-09   
ref|NP_649939.1|  CG8412                                              65.9    1e-09   Drosophila melanogaster
ref|XP_002054547.1|  GJ22748                                          65.9    1e-09   Drosophila virilis
ref|XP_007519500.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.9    2e-09   
gb|EJK52362.1|  hypothetical protein THAOC_28372                      64.7    2e-09   Thalassiosira oceanica
ref|XP_002031835.1|  GM23833                                          65.5    2e-09   Drosophila sechellia
ref|XP_010830422.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   Bison bison bison
ref|XP_003280777.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   Nomascus leucogenys [White-cheeked Gibbon]
gb|KFP30903.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  65.1    2e-09   Colius striatus
ref|XP_010198175.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   Colius striatus
ref|XP_007054631.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   
ref|XP_007651110.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   
gb|EGW09352.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  64.3    2e-09   Cricetulus griseus [Chinese hamsters]
gb|EJK72529.1|  hypothetical protein THAOC_05935                      64.7    2e-09   Thalassiosira oceanica
ref|XP_001140006.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   Pan troglodytes
ref|XP_006735449.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  65.1    2e-09   Leptonychotes weddellii
ref|XP_005519263.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    2e-09   
ref|XP_004320671.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    2e-09   
ref|XP_004279649.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    2e-09   Orcinus orca [Orca]
ref|XP_004650701.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    3e-09   Jaculus jaculus
ref|XP_004987604.1|  hypothetical protein PTSG_11395                  64.7    3e-09   Salpingoeca rosetta
gb|EJD76603.1|  glycosyltransferase family 22 protein                 64.3    3e-09   Loa loa
ref|XP_009927917.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    3e-09   Haliaeetus albicilla
ref|XP_001914875.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    3e-09   
ref|XP_009436925.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Pan troglodytes
gb|KFP76651.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  64.7    3e-09   Acanthisitta chloris
ref|XP_009069265.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  64.7    3e-09   Acanthisitta chloris
ref|XP_010804119.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    3e-09   
ref|NP_001096816.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  64.7    3e-09   Bos taurus [bovine]
ref|XP_002097006.1|  GE25981                                          65.1    3e-09   Drosophila yakuba
ref|XP_005903965.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    3e-09   Bos mutus
ref|XP_009941547.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    3e-09   Opisthocomus hoazin [hoatzin]
ref|XP_001964465.1|  GF23035                                          64.7    3e-09   Drosophila ananassae
ref|XP_006119658.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Pelodiscus sinensis [Chinese softshell turtle]
ref|XP_006107904.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    3e-09   
gb|KFB34980.1|  AGAP000102-PA-like protein                            64.7    3e-09   Anopheles sinensis
ref|XP_008640763.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Corvus brachyrhynchos
ref|XP_008051475.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Carlito syrichta
ref|XP_005981168.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Pantholops hodgsonii [Tibetan antelope]
ref|XP_009085055.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    3e-09   Serinus canaria [canary]
ref|XP_011504718.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.7    4e-09   Ceratosolen solmsi marchali
ref|XP_006976191.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    4e-09   Peromyscus maniculatus bairdii
ref|XP_011282653.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    4e-09   Felis catus [cat]
ref|XP_006066368.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    4e-09   Bubalus bubalis [domestic water buffalo]
ref|XP_007651107.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  64.3    4e-09   Cricetulus griseus [Chinese hamsters]
ref|XP_001980759.1|  GG17092                                          64.3    4e-09   Drosophila erecta
gb|KFV93233.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.9    4e-09   Eurypyga helias
ref|XP_010172344.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Antrostomus carolinensis
ref|XP_008924845.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Manacus vitellinus
ref|XP_009289185.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Aptenodytes forsteri
ref|XP_010149724.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Eurypyga helias
ref|XP_009498471.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Phalacrocorax carbo [common cormorant]
ref|XP_009317042.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Pygoscelis adeliae
ref|XP_009701833.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    4e-09   Cariama cristata
ref|XP_005039300.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   Ficedula albicollis
ref|XP_011406378.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    5e-09   
ref|XP_008153642.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   
ref|XP_002188335.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   
ref|XP_007126834.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   
gb|KFQ24125.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.9    5e-09   
ref|XP_004921841.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  64.3    5e-09   
ref|XP_004845419.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   
ref|XP_009984093.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    5e-09   
ref|XP_004885551.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.5    5e-09   
ref|XP_004885549.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.5    6e-09   
ref|XP_004845421.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.5    6e-09   
ref|XP_010284497.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    6e-09   
ref|XP_010186119.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.9    6e-09   
gb|KFQ64312.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.2    6e-09   
ref|XP_005481972.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.5    6e-09   
gb|ERE86443.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.5    6e-09   
ref|XP_004521214.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  63.9    6e-09   
ref|XP_002013739.1|  GL24301                                          63.9    6e-09   
ref|XP_009868394.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    6e-09   
ref|XP_009461136.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.5    6e-09   
ref|XP_001358592.2|  GA21058                                          63.9    6e-09   
gb|KFP46705.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.2    6e-09   
gb|KFP76475.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  63.2    7e-09   
ref|XP_008567178.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    7e-09   
ref|XP_001994768.1|  GH17417                                          63.5    7e-09   
ref|XP_009957696.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    7e-09   
ref|XP_005438718.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  63.5    8e-09   
ref|XP_005244060.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  63.2    8e-09   
ref|XP_004818790.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    8e-09   
ref|XP_005067129.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    8e-09   
ref|XP_009819306.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    8e-09   
ref|XP_010121704.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    8e-09   
gb|EKC27855.1|  Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolich...  63.2    9e-09   
gb|ETO83331.1|  hypothetical protein, variant 6                       62.4    9e-09   
ref|XP_009997748.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    1e-08   
gb|ETI54574.1|  hypothetical protein, variant 6                       62.4    1e-08   
ref|XP_009578588.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    1e-08   
ref|XP_011419681.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    1e-08   
gb|KFQ78426.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  62.8    1e-08   
gb|ETO83327.1|  hypothetical protein, variant 2                       62.4    1e-08   
gb|ETK94444.1|  hypothetical protein, variant 6                       62.4    1e-08   
ref|XP_008399364.1|  PREDICTED: bromodomain-containing protein 1-...  63.5    1e-08   
ref|XP_008915925.1|  hypothetical protein, variant                    62.4    1e-08   
ref|XP_004818783.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  63.2    1e-08   
gb|ETM00929.1|  hypothetical protein, variant                         62.4    1e-08   
gb|ETI54570.1|  hypothetical protein, variant 2                       62.4    1e-08   
ref|XP_006633542.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    1e-08   
gb|ETM54106.1|  hypothetical protein, variant 2                       62.4    1e-08   
dbj|GAM21373.1|  hypothetical protein SAMD00019534_045480             62.8    1e-08   
ref|XP_007189282.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    1e-08   
ref|XP_008915926.1|  hypothetical protein PPTG_19333                  62.8    1e-08   
ref|XP_009482482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.8    1e-08   
gb|ETO83325.1|  hypothetical protein F444_02634                       62.8    1e-08   
ref|XP_011210461.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  62.8    1e-08   
ref|XP_009646240.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    1e-08   
gb|ETM54104.1|  hypothetical protein L914_02513                       62.8    1e-08   
gb|ETK94438.1|  hypothetical protein L915_02518                       62.8    1e-08   
gb|ETP52374.1|  hypothetical protein F442_02612                       62.4    1e-08   
gb|ETO83326.1|  hypothetical protein, variant 1                       62.4    1e-08   
gb|ETM54105.1|  hypothetical protein, variant 1                       62.4    1e-08   
gb|ETM00928.1|  hypothetical protein L917_02424                       62.4    1e-08   
gb|ETI54568.1|  hypothetical protein F443_02633                       62.4    1e-08   
ref|XP_009966320.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    1e-08   
ref|XP_005653255.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    1e-08   
gb|ETI54569.1|  hypothetical protein, variant 1                       62.4    1e-08   
gb|ETK94439.1|  hypothetical protein, variant 1                       62.4    2e-08   
gb|KFV77693.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  62.4    2e-08   
ref|XP_005428578.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_005335067.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_009827625.1|  hypothetical protein, variant                    62.0    2e-08   
ref|XP_001952055.2|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  62.4    2e-08   
ref|XP_002163655.2|  PREDICTED: uncharacterized protein LOC100214068  62.8    2e-08   
ref|XP_004818782.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_004642467.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_010600391.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|XP_008539918.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_009827624.1|  hypothetical protein H257_04713                  62.0    2e-08   
ref|XP_002405545.1|  glycosyltransferase, putative                    62.0    2e-08   
ref|XP_009666099.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.4    2e-08   
ref|XP_004818789.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|XP_004521212.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  62.4    2e-08   
ref|XP_005354435.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|NP_001135829.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  62.0    2e-08   
ref|XP_008491198.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|XP_010600392.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    2e-08   
ref|XP_003422895.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|XP_006119662.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    2e-08   
ref|XP_008610854.1|  hypothetical protein SDRG_06828                  62.0    2e-08   
gb|EDL04396.1|  asparagine-linked glycosylation 12 homolog (yeast...  62.0    2e-08   
ref|XP_002000049.1|  GI22746                                          62.0    2e-08   
ref|XP_008567177.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  62.0    2e-08   
ref|XP_002070263.1|  GK11961                                          62.0    2e-08   
ref|XP_004775484.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
ref|XP_008567176.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
ref|XP_005797321.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
ref|XP_010727311.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
ref|XP_004589764.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    3e-08   
ref|NP_001101574.2|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  61.6    3e-08   
ref|XP_005878034.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
ref|XP_006780630.1|  PREDICTED: bromodomain-containing protein 1-...  62.0    3e-08   
ref|XP_006780629.1|  PREDICTED: bromodomain-containing protein 1-...  62.0    3e-08   
ref|XP_010738758.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.6    3e-08   
gb|ERL87612.1|  hypothetical protein D910_05003                       60.8    3e-08   
ref|XP_007664896.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    3e-08   
ref|NP_001034359.2|  alpha-1,6-mannosyltransferase ALG12 precursor    61.2    4e-08   
ref|XP_009554679.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    4e-08   
ref|XP_004818787.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    4e-08   
gb|KFZ49122.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  61.2    4e-08   
ref|XP_002901657.1|  dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  61.2    4e-08   
ref|XP_004775482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    4e-08   
ref|XP_003783146.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    4e-08   
ref|XP_005681294.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  61.2    4e-08   
ref|XP_004521213.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  61.2    4e-08   
ref|XP_010778995.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  61.2    4e-08   
ref|XP_848418.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alp...  60.8    4e-08   
ref|XP_008832941.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|XP_004818788.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|XP_004818791.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|XP_008115325.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    5e-08   
ref|XP_007232458.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|XP_011303562.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  61.2    5e-08   
ref|XP_005176687.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  61.2    5e-08   
ref|XP_010213853.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|XP_008832938.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    5e-08   
ref|NP_001092219.1|  dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-m...  60.8    6e-08   
ref|XP_003225017.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    6e-08   
ref|XP_008832937.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.8    6e-08   
gb|KGL77880.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  60.5    6e-08   
ref|XP_008832939.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    6e-08   
ref|XP_005286150.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    6e-08   
ref|XP_009881948.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    6e-08   
ref|XP_007578036.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    6e-08   
ref|XP_003461623.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_002126504.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_008171235.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_006771159.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    7e-08   
ref|XP_010600390.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_007453957.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_003972973.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_006876482.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.5    7e-08   
ref|XP_005725189.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    8e-08   
ref|XP_004380126.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    9e-08   
ref|XP_005096585.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  60.1    9e-08   
ref|XP_005915756.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  60.1    9e-08   
ref|XP_009058090.1|  hypothetical protein LOTGIDRAFT_228830           60.1    1e-07   
ref|XP_971608.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alp...  60.1    1e-07   
ref|XP_009516633.1|  hypothetical protein PHYSODRAFT_469873           59.7    1e-07   
gb|AAX25758.2|  SJCHGC04766 protein                                   59.3    1e-07   
ref|XP_010979931.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    1e-07   
ref|XP_002724007.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    1e-07   
ref|XP_006184325.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.7    1e-07   
ref|XP_006267869.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    1e-07   
emb|CAX69859.1|  alpha-1,6-mannosyltransferase                        59.3    1e-07   
ref|XP_008861839.1|  hypothetical protein H310_00735                  59.3    1e-07   
ref|XP_009232780.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.5    1e-07   
ref|XP_006212635.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    2e-07   
ref|XP_004554006.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    2e-07   
ref|XP_005379586.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  59.3    2e-07   
ref|XP_011178105.1|  PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2...  59.7    2e-07   
ref|XP_008861840.1|  hypothetical protein, variant                    59.3    2e-07   
ref|XP_006016560.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    2e-07   
ref|XP_006267868.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    2e-07   
emb|CCD59088.1|  glycosyltransferase, putative                        58.9    2e-07   
ref|XP_007952949.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.9    2e-07   
ref|XP_009232781.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    2e-07   
gb|KDO22510.1|  hypothetical protein SPRG_11694                       58.9    2e-07   
gb|ELK07527.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-...  57.8    2e-07   
gb|ELW49022.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  58.9    2e-07   
ref|XP_002290603.1|  dolichyl-phosphate-mannose-glycolipid alpha-...  58.5    3e-07   
emb|CAD22101.1|  putative mannosyltransferase                         58.5    3e-07   
ref|XP_006917916.1|  PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Ma...  58.5    3e-07   
ref|XP_011374734.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    4e-07   
ref|XP_010955584.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    4e-07   
ref|XP_004458227.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    4e-07   
ref|XP_003445116.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    4e-07   
ref|XP_010632593.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  58.2    4e-07   
ref|XP_001743896.1|  hypothetical protein                             57.8    5e-07   
emb|CDJ81963.1|  Alg9 mannosyltransferase domain containing protein   57.8    5e-07   
gb|ACN30752.1|  unknown                                               56.6    5e-07   
ref|XP_007428146.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.8    6e-07   
gb|EFA84739.1|  glycosyltransferase                                   58.2    6e-07   
ref|XP_003289352.1|  hypothetical protein DICPUDRAFT_80121            57.8    6e-07   
ref|XP_006157653.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.4    6e-07   
ref|XP_002427647.1|  glycosyltransferase, putative                    57.4    7e-07   
ref|XP_003083080.1|  GPI-alpha-mannosyltransferase III (GPI10/PIG...  57.4    7e-07   
emb|CEG02157.1|  GPI mannosyltransferase                              57.4    7e-07   
ref|XP_011282655.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  57.0    8e-07   
ref|XP_002594362.1|  hypothetical protein BRAFLDRAFT_72229            57.0    9e-07   
gb|EXM28540.1|  alpha-1,6-mannosyltransferase                         57.0    1e-06   
ref|XP_004364979.1|  membrane protein SB87                            57.0    1e-06   
gb|EXA53729.1|  alpha-1,6-mannosyltransferase                         57.0    1e-06   
gb|EMT62339.1|  Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannos...  57.0    1e-06   
gb|EGU89211.1|  hypothetical protein FOXB_00164                       57.0    1e-06   
gb|EXK89314.1|  alpha-1,6-mannosyltransferase                         56.6    1e-06   
gb|EWZ92386.1|  alpha-1,6-mannosyltransferase                         56.6    1e-06   
gb|EWZ50144.1|  alpha-1,6-mannosyltransferase                         56.6    1e-06   
ref|XP_004700681.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.6    1e-06   
gb|KDO18106.1|  hypothetical protein SPRG_16521                       56.6    1e-06   
gb|EXK47387.1|  alpha-1,6-mannosyltransferase                         56.6    1e-06   
gb|EWY94545.1|  alpha-1,6-mannosyltransferase                         56.6    1e-06   
ref|XP_011489251.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    1e-06   
ref|XP_011489250.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  56.2    2e-06   
gb|KFA64180.1|  hypothetical protein S40285_00828                     56.2    2e-06   
ref|XP_002114556.1|  hypothetical protein TRIADDRAFT_28195            55.8    2e-06   
ref|XP_006888086.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    2e-06   
ref|XP_006157656.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    2e-06   
gb|ETN63789.1|  glycosyltransferase                                   56.2    2e-06   
ref|XP_010885418.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    2e-06   
ref|XP_005839081.1|  hypothetical protein GUITHDRAFT_65500            55.5    3e-06   
ref|XP_647384.1|  hypothetical protein DDB_G0267884                   55.8    3e-06   
ref|XP_008280049.1|  PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol ...  55.8    3e-06   
emb|CDS09080.1|  hypothetical protein LRAMOSA10440                    55.8    3e-06   
ref|XP_005710744.1|  Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-a...  55.5    3e-06   
gb|EIE78569.1|  hypothetical protein RO3G_03273                       55.5    3e-06   
gb|KHN85099.1|  putative valine--tRNA ligase, cytoplasmic             55.8    3e-06   
emb|CDQ57116.1|  unnamed protein product                              55.5    3e-06   
ref|XP_005646870.1|  Alg9-like mannosyltransferase                    55.1    4e-06   
emb|CDQ75547.1|  unnamed protein product                              53.9    4e-06   
emb|CCI40877.1|  unnamed protein product                              55.1    4e-06   
gb|ACN31485.1|  unknown                                               53.9    5e-06   
gb|KIL94556.1|  alpha- -mannosyltransferase                           54.7    5e-06   



>ref|XP_011088786.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Sesamum indicum]
Length=403

 Score = 99.4 bits (246),  Expect = 8e-22, Method: Compositional matrix adjust.
 Identities = 46/58 (79%), Positives = 52/58 (90%), Gaps = 0/58 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L +RSISL KA++SC  TAL CIGLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWG  256



>ref|XP_011088778.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Sesamum indicum]
Length=428

 Score = 99.0 bits (245),  Expect = 1e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L +RSISL KA++SC  TAL CIGLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  257



>ref|XP_007134415.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06409.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=365

 Score = 97.4 bits (241),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 49/80 (61%), Positives = 56/80 (70%), Gaps = 4/80 (5%)
 Frame = -3

Query  341  DKLFSLCYISFYGDFL*LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFE  162
            D L  LC I        L T  IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFE
Sbjct  219  DMLLLLCSIGLQL----LLTNKISVWGALKHCTGMALFCIGLTIIVDSIMWKRLLWPEFE  274

Query  161  VFWFNSVLNRSSEWGVSWRH  102
            VFWFNSVLN+SSEWG +  H
Sbjct  275  VFWFNSVLNKSSEWGTNAFH  294



>ref|XP_009765388.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Nicotiana sylvestris]
Length=402

 Score = 97.8 bits (242),  Expect = 3e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S WKA+ SC   A   IGLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG  
Sbjct  209  LLTKSVSFWKALTSCLAAAFLSIGLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTH  268

Query  110  WRH  102
              H
Sbjct  269  PFH  271



>ref|XP_011088772.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Sesamum indicum]
Length=494

 Score = 98.6 bits (244),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 46/59 (78%), Positives = 52/59 (88%), Gaps = 0/59 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L +RSISL KA++SC  TAL CIGLTI+VDSV+WR+LLWPE EVFWFNSVLNRSSEWG 
Sbjct  199  LLSRSISLRKAILSCLVTALFCIGLTILVDSVLWRKLLWPELEVFWFNSVLNRSSEWGT  257



>ref|XP_007134414.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06408.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=336

 Score = 97.1 bits (240),  Expect = 4e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T  IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +
Sbjct  203  LLTNKISVWGALKHCTGMALFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTN  262

Query  110  WRH  102
              H
Sbjct  263  AFH  265



>ref|XP_006576707.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Glycine max]
Length=465

 Score = 97.4 bits (241),  Expect = 8e-21, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG  
Sbjct  234  LLTKKISVWGALKHCTGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTH  293

Query  110  WRH  102
              H
Sbjct  294  AFH  296



>ref|XP_009765385.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nicotiana sylvestris]
Length=499

 Score = 97.1 bits (240),  Expect = 1e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S WKA+ SC   A   IGLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG  
Sbjct  200  LLTKSVSFWKALTSCLAAAFLSIGLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_009765384.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nicotiana sylvestris]
Length=508

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S WKA+ SC   A   IGLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG  
Sbjct  209  LLTKSVSFWKALTSCLAAAFLSIGLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTH  268

Query  110  WRH  102
              H
Sbjct  269  PFH  271



>ref|XP_007134412.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06406.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=528

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T  IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +
Sbjct  232  LLTNKISVWGALKHCTGMALFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTN  291

Query  110  WRH  102
              H
Sbjct  292  AFH  294



>ref|XP_003521056.2| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Glycine max]
Length=529

 Score = 97.1 bits (240),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG  
Sbjct  234  LLTKKISVWGALKHCTGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTH  293

Query  110  WRH  102
              H
Sbjct  294  AFH  296



>ref|XP_007134413.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
 gb|ESW06407.1| hypothetical protein PHAVU_010G045600g [Phaseolus vulgaris]
Length=499

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T  IS+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG +
Sbjct  203  LLTNKISVWGALKHCTGMALFCIGLTIIVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTN  262

Query  110  WRH  102
              H
Sbjct  263  AFH  265



>ref|NP_001117214.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|AEE27392.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=453

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  158  LLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  217

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   LVD  +P  + I  V+SF
Sbjct  218  SIHWYFTSALPRSLLVAYPLSLLGTLVDRRVP--FFIVPVLSF  258



>ref|NP_001077448.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 sp|A8MR93.1|ALG12_ARATH RecName: Full=Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; 
AltName: Full=Alpha-1,6-mannosyltransferase 
ALG12; AltName: Full=Asparagine-linked glycosylation protein 
12; AltName: Full=EMS-mutagenized BRI1 suppressor 4 [Arabidopsis 
thaliana]
 gb|AEE27391.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=497

 Score = 96.7 bits (239),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  202  LLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  261

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   LVD  +P  + I  V+SF
Sbjct  262  SIHWYFTSALPRSLLVAYPLSLLGTLVDRRVP--FFIVPVLSF  302



>gb|ABF59128.1| unknown protein [Arabidopsis thaliana]
Length=449

 Score = 95.9 bits (237),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  154  LLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  213

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   LVD  +P  + I  V+SF
Sbjct  214  SIHWYFTSALPRSLLVAYPLSLLGTLVDRRVP--FFIVPVLSF  254



>ref|NP_001077446.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|AEE27389.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=493

 Score = 96.3 bits (238),  Expect = 2e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  198  LLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  257

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   LVD  +P  + I  V+SF
Sbjct  258  SIHWYFTSALPRSLLVAYPLSLLGTLVDRRVP--FFIVPVLSF  298



>gb|EYU40344.1| hypothetical protein MIMGU_mgv1a005831mg [Erythranthe guttata]
Length=468

 Score = 95.9 bits (237),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 45/63 (71%), Positives = 53/63 (84%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L +RSISL KA++SC  TAL CIGLT++VDS++WR+LLWPE EVFWFNSVLNRSSEWG  
Sbjct  173  LLSRSISLPKALLSCTVTALFCIGLTVLVDSILWRKLLWPELEVFWFNSVLNRSSEWGTH  232

Query  110  WRH  102
              H
Sbjct  233  AFH  235



>ref|XP_009765386.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Nicotiana sylvestris]
Length=484

 Score = 96.3 bits (238),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+S+S WKA+ SC   A   IGLT++VDSVMWRRLLWPE EVFWFNSVLNRSSEWG    
Sbjct  187  TKSVSFWKALTSCLAAAFLSIGLTVLVDSVMWRRLLWPELEVFWFNSVLNRSSEWGTHPF  246

Query  104  H  102
            H
Sbjct  247  H  247



>ref|XP_006583508.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Glycine max]
Length=394

 Score = 94.7 bits (234),  Expect = 3e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ +S+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG  
Sbjct  99   LLTKKVSVWGALKHCTGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTH  158

Query  110  WRH  102
              H
Sbjct  159  AFH  161



>ref|XP_010089788.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Morus notabilis]
 gb|EXB38380.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Morus notabilis]
Length=482

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 51/61 (84%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLW+ +  CF  AL CIGLT+++DS+MWRRLLWPEFEVFWFNSVLNRSSEWG    
Sbjct  188  TKSISLWETLKCCFWFALFCIGLTVLIDSIMWRRLLWPEFEVFWFNSVLNRSSEWGTHTF  247

Query  104  H  102
            H
Sbjct  248  H  248



>gb|KFK42589.1| hypothetical protein AALP_AA1G015000 [Arabis alpina]
Length=432

 Score = 95.1 bits (235),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 47/93 (51%), Positives = 62/93 (67%), Gaps = 9/93 (10%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  193  LLTRSISFWKALKYCVGTAVLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  252

Query  110  WRH---------HILICACISLNYVLVDIYMPV  39
              H          +L+   +SL   L+D  +P+
Sbjct  253  SIHWYFTSALPRSLLVAYPLSLVGTLLDRRVPL  285



>ref|XP_006583509.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Glycine max]
Length=497

 Score = 95.9 bits (237),  Expect = 4e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 51/63 (81%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ +S+W A+  C G AL CIGLTI+VDS+MW+RLLWPEFEVFWFNSVLN+SSEWG  
Sbjct  202  LLTKKVSVWGALKHCTGMALFCIGLTILVDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTH  261

Query  110  WRH  102
              H
Sbjct  262  AFH  264



>ref|XP_010246100.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nelumbo nucifera]
Length=489

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L TR I++W+A+  C  TAL CIGLT++VD+VMWRRL+WPEFEVFWFNSV+NRSSEWG
Sbjct  189  LLTRKITVWEALKCCISTALFCIGLTVMVDTVMWRRLVWPEFEVFWFNSVMNRSSEWG  246



>ref|XP_010246099.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nelumbo nucifera]
Length=500

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 42/58 (72%), Positives = 51/58 (88%), Gaps = 0/58 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L TR I++W+A+  C  TAL CIGLT++VD+VMWRRL+WPEFEVFWFNSV+NRSSEWG
Sbjct  200  LLTRKITVWEALKCCISTALFCIGLTVMVDTVMWRRLVWPEFEVFWFNSVMNRSSEWG  257



>ref|XP_007052356.1| Asparagine-linked glycosylation 12 isoform 3 [Theobroma cacao]
 gb|EOX96513.1| Asparagine-linked glycosylation 12 isoform 3 [Theobroma cacao]
Length=419

 Score = 94.4 bits (233),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SI+ WKA+  C   +L CIGLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG  
Sbjct  197  LLTKSIAFWKALKCCIMISLLCIGLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTH  256

Query  110  WRH  102
              H
Sbjct  257  SIH  259



>ref|XP_004307243.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Fragaria vesca subsp. vesca]
Length=496

 Score = 95.5 bits (236),  Expect = 5e-20, Method: Compositional matrix adjust.
 Identities = 46/63 (73%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISLWKA+  C   AL CIGLT+ VDS+MWRR+LWPEFEV WFNSVLNRSSEWG  
Sbjct  200  LLTRSISLWKALKYCTLCALLCIGLTVFVDSIMWRRVLWPEFEVLWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_006418502.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36855.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=417

 Score = 94.4 bits (233),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  261

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   L+D  +P  + I  V+SF
Sbjct  262  SIHWYFTSALPRSLLVAYPLSLLGTLLDRRVP--FLILPVLSF  302



>ref|XP_002301238.2| hypothetical protein POPTR_0002s14010g [Populus trichocarpa]
 gb|EEE80511.2| hypothetical protein POPTR_0002s14010g [Populus trichocarpa]
Length=475

 Score = 95.1 bits (235),  Expect = 6e-20, Method: Compositional matrix adjust.
 Identities = 43/61 (70%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLW A+  C G AL  IG TI+VDS+MW+R+LWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TKSISLWGAIKYCIGPALLSIGFTIMVDSIMWKRILWPEFEVFWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_006418503.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36856.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=419

 Score = 94.4 bits (233),  Expect = 7e-20, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  261

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   L+D  +P  + I  V+SF
Sbjct  262  SIHWYFTSALPRSLLVAYPLSLLGTLLDRRVP--FLILPVLSF  302



>ref|XP_002892023.1| hypothetical protein ARALYDRAFT_887214 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68282.1| hypothetical protein ARALYDRAFT_887214 [Arabidopsis lyrata subsp. 
lyrata]
Length=491

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 52/103 (50%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  196  LLTKSISFWKALKYCVGTALLAVGLTISVDSIMWKKCVWPEFEVFWFNSILNRSSDWGTH  255

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   LVD  +P  + I  V+SF
Sbjct  256  SIHWYFTSALPRSLLVAYPLSLLGTLVDRRVP--FFILPVLSF  296



>ref|XP_009375362.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pyrus x bretschneideri]
 ref|XP_009375364.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pyrus x bretschneideri]
Length=495

 Score = 94.7 bits (234),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 42/57 (74%), Positives = 50/57 (88%), Gaps = 0/57 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            TR ISLWKA+  C   A+ C+GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  202  TRRISLWKALKCCSLCAVLCVGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  258



>ref|XP_008232378.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Prunus mume]
 ref|XP_008232379.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Prunus mume]
Length=496

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/61 (72%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            TR ISLWKA+  C   A+ CIGLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TRRISLWKALKCCSLCAILCIGLTVLVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGTHPF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_010692030.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Beta vulgaris subsp. vulgaris]
Length=494

 Score = 94.7 bits (234),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 44/63 (70%), Positives = 52/63 (83%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRS+SLWKA+  C   A+  IGLT++VDS+MWRR+LWPEFEV WFNSVL+RSSEWGVS
Sbjct  200  LLTRSVSLWKAIKCCIVAAILSIGLTVMVDSLMWRRVLWPEFEVLWFNSVLDRSSEWGVS  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>gb|KJB24899.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=421

 Score = 93.6 bits (231),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W+A   C  T L CIGLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  219  TKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSI  278

Query  104  H  102
            H
Sbjct  279  H  279



>ref|XP_007052355.1| Asparagine-linked glycosylation 12 isoform 2 [Theobroma cacao]
 gb|EOX96512.1| Asparagine-linked glycosylation 12 isoform 2 [Theobroma cacao]
Length=493

 Score = 94.0 bits (232),  Expect = 1e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SI+ WKA+  C   +L CIGLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG  
Sbjct  197  LLTKSIAFWKALKCCIMISLLCIGLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTH  256

Query  110  WRH  102
              H
Sbjct  257  SIH  259



>ref|XP_006418501.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
 gb|ESQ36854.1| hypothetical protein EUTSA_v10007459mg [Eutrema salsugineum]
Length=495

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 50/103 (49%), Positives = 67/103 (65%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  202  LMTKSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  261

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL   L+D  +P  + I  V+SF
Sbjct  262  SIHWYFTSALPRSLLVAYPLSLLGTLLDRRVP--FLILPVLSF  302



>ref|NP_001077447.2| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
 gb|ABF59127.1| unknown protein [Arabidopsis thaliana]
 gb|AEE27390.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Arabidopsis thaliana]
Length=332

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/58 (69%), Positives = 49/58 (84%), Gaps = 0/58 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWG  117
            L T+SIS WKA+  C GTAL  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG
Sbjct  158  LLTKSISFWKALKYCVGTALLAVGLTIFVDSIMWKKFVWPEFEVFWFNSILNRSSDWG  215



>ref|XP_009603142.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Nicotiana tomentosiformis]
Length=499

 Score = 94.0 bits (232),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S WKA+ SC   A   IGLT++VDSV+WRRLLWPE EVFWFNSVLNRSSEWG  
Sbjct  200  LLTKSVSFWKALTSCLAAASLSIGLTVLVDSVIWRRLLWPELEVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_008460079.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Cucumis melo]
Length=384

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  +SIS W A+  C G AL CIGLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG  
Sbjct  200  LVIKSISFWGALKRCIGVALLCIGLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PMH  262



>ref|XP_009119758.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Brassica rapa]
Length=472

 Score = 93.2 bits (230),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  199  LLTRSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  258

Query  110  WRH  102
              H
Sbjct  259  SIH  261



>ref|XP_007052354.1| Asparagine-linked glycosylation 12 isoform 1 [Theobroma cacao]
 gb|EOX96511.1| Asparagine-linked glycosylation 12 isoform 1 [Theobroma cacao]
Length=558

 Score = 94.0 bits (232),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 43/63 (68%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SI+ WKA+  C   +L CIGLTI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG  
Sbjct  262  LLTKSIAFWKALKCCIMISLLCIGLTILVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTH  321

Query  110  WRH  102
              H
Sbjct  322  SIH  324



>ref|XP_006445446.1| hypothetical protein CICLE_v10019843mg [Citrus clementina]
 gb|ESR58686.1| hypothetical protein CICLE_v10019843mg [Citrus clementina]
Length=496

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 50/61 (82%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLWKA+  C G AL  +GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG    
Sbjct  203  TKSISLWKALKCCIGMALLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSF  262

Query  104  H  102
            H
Sbjct  263  H  263



>ref|XP_009603143.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Nicotiana tomentosiformis]
Length=475

 Score = 93.2 bits (230),  Expect = 3e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+S+S WKA+ SC   A   IGLT++VDSV+WRRLLWPE EVFWFNSVLNRSSEWG    
Sbjct  178  TKSVSFWKALTSCLAAASLSIGLTVLVDSVIWRRLLWPELEVFWFNSVLNRSSEWGTHPF  237

Query  104  H  102
            H
Sbjct  238  H  238



>emb|CDY15127.1| BnaC05g00060D [Brassica napus]
Length=498

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  203  LLTRSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  262

Query  110  WRH  102
              H
Sbjct  263  SIH  265



>emb|CDX90078.1| BnaA10g00040D [Brassica napus]
Length=495

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  200  LLTRSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  259

Query  110  WRH  102
              H
Sbjct  260  SIH  262



>ref|XP_009119757.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Brassica rapa]
Length=494

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 41/63 (65%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GTA+  +GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  199  LLTRSISFWKALKYCVGTAVVAVGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  258

Query  110  WRH  102
              H
Sbjct  259  SIH  261



>gb|KJB24902.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=454

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W+A   C  T L CIGLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  160  TKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSI  219

Query  104  H  102
            H
Sbjct  220  H  220



>ref|XP_006306188.1| hypothetical protein CARUB_v10011809mg [Capsella rubella]
 gb|EOA39086.1| hypothetical protein CARUB_v10011809mg [Capsella rubella]
Length=497

 Score = 93.2 bits (230),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 50/63 (79%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+SIS WKA+  C GTAL  +GLTI +DS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  202  LLTKSISFWKALKYCVGTALLAVGLTIFIDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  261

Query  110  WRH  102
              H
Sbjct  262  SVH  264



>gb|KJB24900.1| hypothetical protein B456_004G166900 [Gossypium raimondii]
Length=432

 Score = 92.4 bits (228),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W+A   C  T L CIGLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  138  TKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSI  197

Query  104  H  102
            H
Sbjct  198  H  198



>gb|KJB24901.1| hypothetical protein B456_004G166900, partial [Gossypium raimondii]
Length=513

 Score = 92.8 bits (229),  Expect = 4e-19, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W+A   C  T L CIGLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  219  TKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGTHSI  278

Query  104  H  102
            H
Sbjct  279  H  279



>ref|XP_003636166.1| Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase 
[Medicago truncatula]
Length=412

 Score = 91.7 bits (226),  Expect = 5e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+ IS+W A+  C G A  C+G+TI++DS+MW+RLLWPEFEVFWFNSVLN+SSEWG    
Sbjct  226  TKKISVWGALKYCTGMAFFCVGITILIDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAF  285

Query  104  H  102
            H
Sbjct  286  H  286



>ref|XP_002448266.1| hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
 gb|EES12594.1| hypothetical protein SORBIDRAFT_06g024210 [Sorghum bicolor]
Length=500

 Score = 92.4 bits (228),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            +RS+SL +AV  C  TAL CIG T++VDS+MWRR+LWPEF+V WFNSVLNRSSEWG    
Sbjct  209  SRSVSLLEAVKYCISTALICIGFTMLVDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSV  268

Query  104  H  102
            H
Sbjct  269  H  269



>ref|XP_010325203.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Solanum lycopersicum]
 ref|XP_010325204.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Solanum lycopersicum]
Length=414

 Score = 91.3 bits (225),  Expect = 7e-19, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L T+S+S WKA+ SC       IGLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG 
Sbjct  115  LLTKSVSFWKALTSCLAATFLSIGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGT  173



>gb|KEH17914.1| Alg9-like mannosyltransferase family protein [Medicago truncatula]
Length=494

 Score = 92.0 bits (227),  Expect = 8e-19, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+ IS+W A+  C G A  C+G+TI++DS+MW+RLLWPEFEVFWFNSVLN+SSEWG    
Sbjct  201  TKKISVWGALKYCTGMAFFCVGITILIDSIMWKRLLWPEFEVFWFNSVLNKSSEWGTHAF  260

Query  104  H  102
            H
Sbjct  261  H  261



>gb|AIE43865.1| WRKY transcription factor 25 [Gossypium hirsutum]
Length=679

 Score = 92.4 bits (228),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 41/57 (72%), Positives = 47/57 (82%), Gaps = 0/57 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+SIS W+A   C  T L CIGLT++VDS+MW+R LWPEFEVFWFNSVLNRSSEWG 
Sbjct  385  TKSISFWRAFKCCTVTTLLCIGLTVLVDSIMWKRFLWPEFEVFWFNSVLNRSSEWGT  441



>ref|XP_004229733.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Solanum lycopersicum]
Length=499

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 47/59 (80%), Gaps = 0/59 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L T+S+S WKA+ SC       IGLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG 
Sbjct  200  LLTKSVSFWKALTSCLAATFLSIGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGT  258



>ref|XP_008460077.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Cucumis melo]
Length=494

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  +SIS W A+  C G AL CIGLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG  
Sbjct  200  LVIKSISFWGALKRCIGVALLCIGLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PMH  262



>ref|XP_011017393.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Populus euphratica]
Length=499

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W A+  C G AL  IG TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TKSISSWGAIKYCIGPALLSIGFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_011017394.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Populus euphratica]
Length=495

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W A+  C G AL  IG TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TKSISSWGAIKYCIGPALLSIGFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>emb|CDP09422.1| unnamed protein product [Coffea canephora]
Length=421

 Score = 90.9 bits (224),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 44/64 (69%), Positives = 51/64 (80%), Gaps = 1/64 (2%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIG-LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            L ++SISLWKA+ +C    L CIG LT++VDSVMWRR LWPE EVFWFNSVLNRSSEWG+
Sbjct  200  LLSKSISLWKAIRTCIAATLFCIGSLTVLVDSVMWRRWLWPELEVFWFNSVLNRSSEWGI  259

Query  113  SWRH  102
               H
Sbjct  260  HPIH  263



>ref|XP_008460078.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Cucumis melo]
Length=473

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  +SIS W A+  C G AL CIGLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG  
Sbjct  179  LVIKSISFWGALKRCIGVALLCIGLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTH  238

Query  110  WRH  102
              H
Sbjct  239  PMH  241



>ref|XP_006464407.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Citrus sinensis]
 gb|KDO85470.1| hypothetical protein CISIN_1g010929mg [Citrus sinensis]
Length=497

 Score = 91.7 bits (226),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLWKA+  C G  L  +GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG    
Sbjct  204  TKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSF  263

Query  104  H  102
            H
Sbjct  264  H  264



>ref|XP_006464408.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Citrus sinensis]
 gb|KDO85469.1| hypothetical protein CISIN_1g010929mg [Citrus sinensis]
Length=496

 Score = 91.3 bits (225),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 40/61 (66%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLWKA+  C G  L  +GLT++VDS+MW++L+WPEFEV WFNSVLNRSSEWG    
Sbjct  203  TKSISLWKALKCCIGMVLLSVGLTVLVDSIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSF  262

Query  104  H  102
            H
Sbjct  263  H  263



>ref|XP_008375731.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Malus domestica]
 ref|XP_008375732.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Malus domestica]
Length=495

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/57 (70%), Positives = 48/57 (84%), Gaps = 0/57 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+ ISLWK    C   A+ C+GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  202  TKRISLWKTFKCCSLCAVLCVGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  258



>ref|XP_011017391.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Populus euphratica]
Length=522

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W A+  C G AL  IG TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TKSISSWGAIKYCIGPALLSIGFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_004145015.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
 ref|XP_004154129.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
Length=494

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  +SIS W A+  C G AL CIGLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG  
Sbjct  200  LVIKSISFWGALKRCTGVALLCIGLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PMH  262



>ref|XP_011017392.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Populus euphratica]
Length=518

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 42/61 (69%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS W A+  C G AL  IG TI+VDS+MW+R LWPEFEVFWFNSVLNRSSEWG    
Sbjct  202  TKSISSWGAIKYCIGPALLSIGFTIMVDSIMWKRKLWPEFEVFWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_004160680.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Cucumis sativus]
Length=494

 Score = 91.3 bits (225),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 40/63 (63%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  +SIS W A+  C G AL CIGLT+ +DS++W++LLWPEF VFWFNSVLNRSSEWG  
Sbjct  200  LVIKSISFWGALKRCTGVALLCIGLTVFIDSILWKKLLWPEFHVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PMH  262



>emb|CDY38057.1| BnaCnng09180D [Brassica napus]
Length=482

 Score = 90.9 bits (224),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/103 (48%), Positives = 66/103 (64%), Gaps = 13/103 (13%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SIS WK +  C GTA+   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    
Sbjct  187  TKSISFWKTLKYCVGTAVVTAGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSI  246

Query  104  HHILICA------CISLNY-----VLVDIYMPVHWHIYSVVSF  9
            H     A      CIS+N+     +L+D  +P  + +  V+SF
Sbjct  247  HWYFTSALPRRSDCISINFSHLFGILLDRRVP--FLVIPVISF  287



>ref|XP_006347991.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X4 [Solanum tuberosum]
Length=370

 Score = 89.4 bits (220),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S W A+  C   A   +GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG  
Sbjct  200  LLTKSVSFWNALTFCLAAAFLSVGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_010496471.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Camelina sativa]
Length=505

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GT L  +GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  209  LLTRSISFWKALKYCVGTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  268

Query  110  WRH  102
              H
Sbjct  269  SVH  271



>ref|XP_010496472.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Camelina sativa]
Length=500

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GT L  +GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  204  LLTRSISFWKALKYCVGTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  263

Query  110  WRH  102
              H
Sbjct  264  SVH  266



>ref|XP_010496473.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Camelina sativa]
Length=459

 Score = 90.1 bits (222),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C GT L  +GL+I VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  163  LLTRSISFWKALKYCVGTTLLAVGLSIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  222

Query  110  WRH  102
              H
Sbjct  223  SVH  225



>ref|XP_004515328.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Cicer arietinum]
Length=533

 Score = 90.5 bits (223),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            TR IS+W A+  C G A  C+G+T +VDS+MW+R LWPEFEVFWFNSVLN+SSEWG    
Sbjct  240  TRKISVWGALKHCTGMAFFCVGITSLVDSIMWKRFLWPEFEVFWFNSVLNKSSEWGTHAF  299

Query  104  H  102
            H
Sbjct  300  H  300



>ref|XP_004515329.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Cicer arietinum]
Length=531

 Score = 90.5 bits (223),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            TR IS+W A+  C G A  C+G+T +VDS+MW+R LWPEFEVFWFNSVLN+SSEWG    
Sbjct  240  TRKISVWGALKHCTGMAFFCVGITSLVDSIMWKRFLWPEFEVFWFNSVLNKSSEWGTHAF  299

Query  104  H  102
            H
Sbjct  300  H  300



>ref|XP_010496687.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X4 [Camelina sativa]
Length=431

 Score = 89.7 bits (221),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C  T L  +GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  209  LLTRSISFWKALKYCVATTLLALGLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  268

Query  110  WRH  102
              H
Sbjct  269  SVH  271



>ref|XP_009118864.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Brassica rapa]
Length=413

 Score = 89.4 bits (220),  Expect = 4e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS  K +  C GTA+   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  196  LLTRSISFLKTLKYCVGTAVVAAGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  255

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL  +L+D  +P  + +  V+SF
Sbjct  256  SIHWYFTSALPRSLLVAYPLSLFGILLDRRVP--FLVIPVISF  296



>tpg|DAA36628.1| TPA: hypothetical protein ZEAMMB73_968947 [Zea mays]
Length=474

 Score = 89.4 bits (220),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 48/61 (79%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            +RS+SL +A+  C  T L CIG T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    
Sbjct  183  SRSVSLLEAIKCCISTTLVCIGFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSI  242

Query  104  H  102
            H
Sbjct  243  H  243



>ref|XP_010496684.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Camelina sativa]
Length=506

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C  T L  +GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  209  LLTRSISFWKALKYCVATTLLALGLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  268

Query  110  WRH  102
              H
Sbjct  269  SVH  271



>ref|XP_010479311.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Camelina sativa]
Length=493

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C  T L  +GLTI+VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  197  LLTRSISFWKALKYCVRTTLLAVGLTILVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  256

Query  110  WRH  102
              H
Sbjct  257  SVH  259



>ref|XP_009118862.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Brassica rapa]
Length=491

 Score = 89.4 bits (220),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/103 (47%), Positives = 65/103 (63%), Gaps = 11/103 (11%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS  K +  C GTA+   GLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG  
Sbjct  196  LLTRSISFLKTLKYCVGTAVVAAGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTH  255

Query  110  WRH---------HILICACISLNYVLVDIYMPVHWHIYSVVSF  9
              H          +L+   +SL  +L+D  +P  + +  V+SF
Sbjct  256  SIHWYFTSALPRSLLVAYPLSLFGILLDRRVP--FLVIPVISF  296



>ref|XP_010496685.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Camelina sativa]
Length=501

 Score = 89.4 bits (220),  Expect = 9e-18, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C  T L  +GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  204  LLTRSISFWKALKYCVATTLLALGLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  263

Query  110  WRH  102
              H
Sbjct  264  SVH  266



>ref|XP_010496686.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Camelina sativa]
Length=460

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSIS WKA+  C  T L  +GLTI VDS+MW++ +WPEF+VFWFNS+LNRSS+WG  
Sbjct  163  LLTRSISFWKALKYCVATTLLALGLTIFVDSIMWKKFVWPEFDVFWFNSILNRSSDWGTH  222

Query  110  WRH  102
              H
Sbjct  223  SVH  225



>ref|XP_010540209.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Tarenaya hassleriana]
Length=501

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSI   KA   C G A+   GLTI VDS+MWRR +WPEFEVFWFNS+LNRSSEWG S
Sbjct  205  LLTRSIPFCKAFKCCVGAAVLSTGLTIFVDSIMWRRFVWPEFEVFWFNSILNRSSEWGTS  264

Query  110  WRH  102
              H
Sbjct  265  PIH  267



>ref|XP_010540210.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Tarenaya hassleriana]
Length=500

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSI   KA   C G A+   GLTI VDS+MWRR +WPEFEVFWFNS+LNRSSEWG S
Sbjct  204  LLTRSIPFCKAFKCCVGAAVLSTGLTIFVDSIMWRRFVWPEFEVFWFNSILNRSSEWGTS  263

Query  110  WRH  102
              H
Sbjct  264  PIH  266



>ref|XP_006347989.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Solanum tuberosum]
 ref|XP_006347990.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Solanum tuberosum]
Length=414

 Score = 88.2 bits (217),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S W A+  C   A   +GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG  
Sbjct  115  LLTKSVSFWNALTFCLAAAFLSVGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTH  174

Query  110  WRH  102
              H
Sbjct  175  PFH  177



>gb|KDP28876.1| hypothetical protein JCGZ_14647 [Jatropha curcas]
Length=500

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 41/61 (67%), Positives = 47/61 (77%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            TRSISL +A+  C G AL  +GLTI+VDS+MW+R  WPEFEV WFNSVLNRSSEWG    
Sbjct  202  TRSISLSEAIKYCTGIALLSVGLTILVDSIMWKRFTWPEFEVLWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>ref|XP_006347988.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Solanum tuberosum]
Length=499

 Score = 89.0 bits (219),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 39/63 (62%), Positives = 47/63 (75%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+S+S W A+  C   A   +GLT++VDSV+W+RLLWPE EVFWFNSVLNRSSEWG  
Sbjct  200  LLTKSVSFWNALTFCLAAAFLSVGLTVLVDSVIWKRLLWPELEVFWFNSVLNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_009375365.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pyrus x bretschneideri]
Length=494

 Score = 88.6 bits (218),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 42/59 (71%), Positives = 50/59 (85%), Gaps = 5/59 (8%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCI--GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            TR ISLWKA+  C   +LC +  GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  202  TRRISLWKALKCC---SLCAVLSGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  257



>ref|XP_002271419.2| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Vitis vinifera]
Length=496

 Score = 88.2 bits (217),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLW+++     TAL CIGLT +VD++MW++L+WPEFEV WFNSVLNRSSEWG    
Sbjct  202  TKSISLWESLKCGISTALLCIGLTTLVDTIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSF  261

Query  104  H  102
            H
Sbjct  262  H  262



>emb|CBI16681.3| unnamed protein product [Vitis vinifera]
Length=469

 Score = 87.8 bits (216),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 49/61 (80%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T+SISLW+++     TAL CIGLT +VD++MW++L+WPEFEV WFNSVLNRSSEWG    
Sbjct  175  TKSISLWESLKCGISTALLCIGLTTLVDTIMWKKLVWPEFEVLWFNSVLNRSSEWGTHSF  234

Query  104  H  102
            H
Sbjct  235  H  235



>ref|XP_008786182.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X6 [Phoenix dactylifera]
Length=412

 Score = 86.7 bits (213),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  117  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  176

Query  110  WRH  102
              H
Sbjct  177  PFH  179



>ref|XP_008786180.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Phoenix dactylifera]
Length=503

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  208  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  267

Query  110  WRH  102
              H
Sbjct  268  PFH  270



>ref|XP_008786179.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Phoenix dactylifera]
Length=506

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  211  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  270

Query  110  WRH  102
              H
Sbjct  271  PFH  273



>ref|XP_008786181.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X5 [Phoenix dactylifera]
Length=502

 Score = 87.4 bits (215),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  207  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  266

Query  110  WRH  102
              H
Sbjct  267  PFH  269



>ref|XP_008786178.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Phoenix dactylifera]
Length=515

 Score = 87.4 bits (215),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  220  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  279

Query  110  WRH  102
              H
Sbjct  280  PFH  282



>ref|XP_008786177.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Phoenix dactylifera]
Length=519

 Score = 87.0 bits (214),  Expect = 5e-17, Method: Compositional matrix adjust.
 Identities = 38/63 (60%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLWKA+  C   AL  IG T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  224  LLSKSISLWKAMKCCIAAALLSIGFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  283

Query  110  WRH  102
              H
Sbjct  284  PFH  286



>gb|KCW73099.1| hypothetical protein EUGRSUZ_E015451, partial [Eucalyptus grandis]
 gb|KCW73100.1| hypothetical protein EUGRSUZ_E015451, partial [Eucalyptus grandis]
Length=332

 Score = 84.7 bits (208),  Expect = 9e-17, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISL KA   C   AL  +G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG  
Sbjct  200  LLTRSISLLKACKWCIPMALLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGTY  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_002526470.1| glycosyltransferase, putative [Ricinus communis]
 gb|EEF35861.1| glycosyltransferase, putative [Ricinus communis]
Length=608

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 45/61 (74%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
             +SIS W+A   C G  L  IGLTI+VDS+MW + +WPEFEVFWFNSVLNRSSEWG    
Sbjct  320  AKSISFWEATKYCSGITLLSIGLTILVDSIMWEKKIWPEFEVFWFNSVLNRSSEWGTHSF  379

Query  104  H  102
            H
Sbjct  380  H  380



>ref|XP_010056387.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Eucalyptus grandis]
 ref|XP_010056388.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Eucalyptus grandis]
Length=366

 Score = 84.3 bits (207),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISL KA   C   AL  +G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG  
Sbjct  200  LLTRSISLLKACKWCIPMALLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGTY  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_008375733.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Malus domestica]
Length=494

 Score = 85.1 bits (209),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 40/59 (68%), Positives = 48/59 (81%), Gaps = 5/59 (8%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCI--GLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            T+ ISLWK    C   +LC +  GLT++VDS+MW+RLLWPEFEVFWFNSVLNRSSEWG+
Sbjct  202  TKRISLWKTFKCC---SLCAVFSGLTVIVDSIMWKRLLWPEFEVFWFNSVLNRSSEWGI  257



>ref|XP_004956421.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Setaria italica]
Length=501

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +AV  C  TAL CIG T+++DS+MWRR+LWPEFEV WFNSVLNRSSEWG    H
Sbjct  217  EAVKYCVSTALICIGFTVLIDSIMWRRILWPEFEVLWFNSVLNRSSEWGTHSIH  270



>ref|XP_006652601.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Oryza brachyantha]
Length=466

 Score = 84.3 bits (207),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +AV  C  TA+ CIG T++VDS+MWRR+LWPEFEV WFNSVLNRSSEWG    H
Sbjct  182  EAVKCCVSTAIICIGFTVLVDSIMWRRILWPEFEVLWFNSVLNRSSEWGTHPIH  235



>ref|XP_004956422.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Setaria italica]
Length=475

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +AV  C  TAL CIG T+++DS+MWRR+LWPEFEV WFNSVLNRSSEWG    H
Sbjct  217  EAVKYCVSTALICIGFTVLIDSIMWRRILWPEFEVLWFNSVLNRSSEWGTHSIH  270



>ref|XP_009381984.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=505

 Score = 84.7 bits (208),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LQ++SIS+ +A+  C  +A  CI  T+++D+VMW+R+LWPE EVFWFNSVLNRSSEWG  
Sbjct  210  LQSKSISISEAIKCCISSAFLCIVFTVLLDTVMWQRILWPELEVFWFNSVLNRSSEWGTQ  269

Query  110  WRH  102
              H
Sbjct  270  SFH  272



>ref|XP_010056385.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Eucalyptus grandis]
Length=411

 Score = 83.6 bits (205),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISL KA   C   AL  +G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG  
Sbjct  115  LLTRSISLLKACKWCIPMALLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGTY  174

Query  110  WRH  102
              H
Sbjct  175  PFH  177



>ref|XP_010056384.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Eucalyptus grandis]
Length=495

 Score = 84.0 bits (206),  Expect = 5e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISL KA   C   AL  +G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG  
Sbjct  200  LLTRSISLLKACKWCIPMALLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGTY  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_010056383.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Eucalyptus grandis]
Length=496

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 42/63 (67%), Positives = 46/63 (73%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TRSISL KA   C   AL  +G+T  VDS MW+R+LWPEFEVFWFNSVLNRSSEWG  
Sbjct  200  LLTRSISLLKACKWCIPMALLYVGVTTFVDSFMWKRILWPEFEVFWFNSVLNRSSEWGTY  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_003580264.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Brachypodium distachyon]
Length=498

 Score = 84.0 bits (206),  Expect = 6e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +AV  C  T L CIG T++VDS+MW+R+LWPEFEVFWFNSVLNRSSEWG    H
Sbjct  214  EAVKCCISTVLVCIGFTVLVDSIMWQRILWPEFEVFWFNSVLNRSSEWGTHSIH  267



>ref|XP_010933577.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X5 [Elaeis guineensis]
Length=465

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLW+A+  C  TAL  I  T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  170  LLSKSISLWRAMKCCIATALLSICFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  229

Query  110  WRH  102
              H
Sbjct  230  PFH  232



>ref|XP_010933576.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Elaeis guineensis]
Length=466

 Score = 83.6 bits (205),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLW+A+  C  TAL  I  T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  171  LLSKSISLWRAMKCCIATALLSICFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  230

Query  110  WRH  102
              H
Sbjct  231  PFH  233



>ref|XP_010933573.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Elaeis guineensis]
Length=502

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLW+A+  C  TAL  I  T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  207  LLSKSISLWRAMKCCIATALLSICFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  266

Query  110  WRH  102
              H
Sbjct  267  PFH  269



>ref|XP_010933572.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Elaeis guineensis]
Length=503

 Score = 83.6 bits (205),  Expect = 8e-16, Method: Compositional matrix adjust.
 Identities = 37/63 (59%), Positives = 49/63 (78%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLW+A+  C  TAL  I  T+++D+VMW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  208  LLSKSISLWRAMKCCIATALLSICFTVLLDTVMWQRIVWPELEVFWFNSILNRSSEWGTH  267

Query  110  WRH  102
              H
Sbjct  268  PFH  270



>gb|EPS65150.1| hypothetical protein M569_09628, partial [Genlisea aurea]
Length=407

 Score = 82.8 bits (203),  Expect = 9e-16, Method: Compositional matrix adjust.
 Identities = 37/54 (69%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            KAV+SC   +L  IGLT  +DSV+WR+LLWPE EVFWFNSVLNRSSEWG    H
Sbjct  197  KAVVSCAAASLLSIGLTTTIDSVLWRKLLWPELEVFWFNSVLNRSSEWGTHPFH  250



>ref|XP_006838582.1| hypothetical protein AMTR_s00002p00214180 [Amborella trichopoda]
 gb|ERN01151.1| hypothetical protein AMTR_s00002p00214180 [Amborella trichopoda]
Length=508

 Score = 82.4 bits (202),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 39/61 (64%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T++IS+ +A+     T L CIG TI+VDS MWRR+LWPE EVFWFNSVLNRSSEWG    
Sbjct  214  TKAISVTQALRCGISTGLLCIGCTILVDSFMWRRILWPEMEVFWFNSVLNRSSEWGTHPF  273

Query  104  H  102
            H
Sbjct  274  H  274



>tpg|DAA36629.1| TPA: hypothetical protein ZEAMMB73_968947 [Zea mays]
Length=426

 Score = 82.0 bits (201),  Expect = 2e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +A+  C  T L CIG T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  214  EAIKCCISTTLVCIGFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>ref|NP_001053463.1| Os04g0544900 [Oryza sativa Japonica Group]
 emb|CAE04348.2| OSJNBb0038F03.12 [Oryza sativa Japonica Group]
 dbj|BAF15377.1| Os04g0544900 [Oryza sativa Japonica Group]
 emb|CAH67249.1| OSIGBa0101C23.1 [Oryza sativa Indica Group]
 gb|EEC77738.1| hypothetical protein OsI_16854 [Oryza sativa Indica Group]
 gb|EEE61433.1| hypothetical protein OsJ_15658 [Oryza sativa Japonica Group]
Length=497

 Score = 82.0 bits (201),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 35/54 (65%), Positives = 43/54 (80%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +A+  C  TA+ CIG T++VDS++WRR+LWPEFEV WFNSVLNRSSEWG    H
Sbjct  213  EAIKCCVSTAIICIGFTVLVDSILWRRILWPEFEVLWFNSVLNRSSEWGTHSIH  266



>ref|XP_008667967.1| PREDICTED: dolichyl-P-Man Man isoform X1 [Zea mays]
Length=436

 Score = 81.6 bits (200),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +A+  C  T L CIG T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  214  EAIKCCISTTLVCIGFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>tpg|DAA36630.1| TPA: dolichyl-P-Man Man [Zea mays]
Length=498

 Score = 81.6 bits (200),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 34/54 (63%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +A+  C  T L CIG T+++DS+MWRR+LWPEF+V WFNSVLNRSSEWG    H
Sbjct  214  EAIKCCISTTLVCIGFTVLIDSIMWRRILWPEFQVLWFNSVLNRSSEWGTHSIH  267



>ref|XP_009381985.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=504

 Score = 81.3 bits (199),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 36/63 (57%), Positives = 48/63 (76%), Gaps = 0/63 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SIS+ +A+  C  +A  CI  T+++D+VMW+R+LWPE EVFWFNSVLNRSSEWG  
Sbjct  209  LLSKSISISEAIKCCISSAFLCIVFTVLLDTVMWQRILWPELEVFWFNSVLNRSSEWGTQ  268

Query  110  WRH  102
              H
Sbjct  269  SFH  271



>ref|NP_001148825.1| dolichyl-P-Man Man [Zea mays]
 gb|ACG33037.1| dolichyl-P-Man Man [Zea mays]
Length=498

 Score = 80.1 bits (196),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 33/54 (61%), Positives = 42/54 (78%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +A+  C  T L CIG T+++DS+MWRR+LWPEF+V WFNSVLN+SSEWG    H
Sbjct  214  EAIKCCISTTLVCIGFTVLIDSIMWRRILWPEFQVLWFNSVLNQSSEWGTHSIH  267



>ref|XP_002969331.1| mannosyltransferase-like protein [Selaginella moellendorffii]
 gb|EFJ29419.1| mannosyltransferase-like protein [Selaginella moellendorffii]
Length=485

 Score = 77.0 bits (188),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 37/61 (61%), Positives = 46/61 (75%), Gaps = 0/61 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            TRS+++  A+  C   A+   GLT  VDS++WRR +WPE+EVFWFNSVLNRSSEWGVS  
Sbjct  160  TRSVTVADALKWCIPAAIVSAGLTFAVDSILWRRWVWPEWEVFWFNSVLNRSSEWGVSPF  219

Query  104  H  102
            H
Sbjct  220  H  220



>gb|KFO05594.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase, 
partial [Balearica regulorum gibbericeps]
Length=258

 Score = 72.4 bits (176),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       +CC+GLT+ VDS+ WR+L+WPE +V W+N++LN+SS+WG S
Sbjct  45   TKRISIFKVLSHAVPAGICCLGLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSDWGTS  102



>ref|XP_008549304.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Microplitis demolitor]
Length=886

 Score = 75.5 bits (184),  Expect = 1e-12, Method: Composition-based stats.
 Identities = 32/82 (39%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            + +++ + +  C    +C + LT+V+DS  W+R+LWPE EV +FN+VLN+SS+WG S   
Sbjct  197  KKLTIPRVLKICIPAGICSLALTLVIDSYFWKRILWPEGEVLYFNTVLNKSSQWGTSPFL  256

Query  110  WRHHILICACISLNYVLVDIYM  45
            W  +  +   + L+YVLV + M
Sbjct  257  WYFYSALPRGLGLSYVLVPLGM  278



>ref|XP_010304542.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like, 
partial [Balearica regulorum gibbericeps]
Length=298

 Score = 72.8 bits (177),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 44/58 (76%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       +CC+GLT+ VDS+ WR+L+WPE +V W+N++LN+SS+WG S
Sbjct  44   TKRISIFKVLSHAVPAGICCLGLTVAVDSLFWRQLVWPEGKVLWYNTILNKSSDWGTS  101



>gb|EFN68776.1| Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Camponotus floridanus]
Length=948

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            + +SL + +     T +  + LT+ VDS+ WRRL+WPE EVF+FN++LN+SSEWG S   
Sbjct  180  KKVSLQRLLKIAVPTGIFFLVLTVAVDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFL  239

Query  110  WRHHILICACISLNYVLVDIYM  45
            W  +  +   ++L+Y LV + M
Sbjct  240  WYFYSALPRGLALSYFLVPVGM  261



>ref|XP_011255575.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Camponotus floridanus]
Length=958

 Score = 73.2 bits (178),  Expect = 6e-12, Method: Composition-based stats.
 Identities = 34/82 (41%), Positives = 53/82 (65%), Gaps = 3/82 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            + +SL + +     T +  + LT+ VDS+ WRRL+WPE EVF+FN++LN+SSEWG S   
Sbjct  190  KKVSLQRLLKIAVPTGIFFLVLTVAVDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFL  249

Query  110  WRHHILICACISLNYVLVDIYM  45
            W  +  +   ++L+Y LV + M
Sbjct  250  WYFYSALPRGLALSYFLVPVGM  271



>ref|XP_001758628.1| predicted protein [Physcomitrella patens]
 gb|EDQ76606.1| predicted protein [Physcomitrella patens]
Length=471

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 32/54 (59%), Positives = 40/54 (74%), Gaps = 0/54 (0%)
 Frame = -3

Query  263  KAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            +  I C   ALCC  +T  +DSV+WR+ +WPEF+V WFNSVLNRS+EWGVS  H
Sbjct  181  RGTIDCSIRALCCAAVTCGLDSVVWRQWIWPEFQVLWFNSVLNRSTEWGVSPVH  234



>ref|XP_003491108.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Bombus impatiens]
Length=948

 Score = 72.4 bits (176),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 32/61 (52%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LTI VDS+ WRRLLWPE EVF+FN++LN+SSEWG S   W  +  +   + L+Y L+ + 
Sbjct  211  LTITVDSIFWRRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLGLSYFLIPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>ref|XP_009118863.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X2 [Brassica rapa]
Length=462

 Score = 71.6 bits (174),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/70 (50%), Positives = 47/70 (67%), Gaps = 9/70 (13%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH---------HILICACISL  72
            IGLTI VDS+MW++ +WPEFEVFWFNS+LNRSS+WG    H          +L+   +SL
Sbjct  189  IGLTISVDSIMWKKFVWPEFEVFWFNSILNRSSDWGTHSIHWYFTSALPRSLLVAYPLSL  248

Query  71   NYVLVDIYMP  42
              +L+D  +P
Sbjct  249  FGILLDRRVP  258



>ref|XP_003402011.1| PREDICTED: hypothetical protein LOC100650099 [Bombus terrestris]
Length=1038

 Score = 72.0 bits (175),  Expect = 2e-11, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LTI +DS+ WRRLLWPE EVF+FN++LN+SSEWG S   W  +  +   + L+Y L+ + 
Sbjct  211  LTITIDSIFWRRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLGLSYFLIPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>ref|XP_001117738.2| PREDICTED: dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase-like, 
partial [Macaca mulatta]
Length=113

 Score = 67.0 bits (162),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 29/59 (49%), Positives = 41/59 (69%), Gaps = 0/59 (0%)
 Frame = -3

Query  287  QTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
              R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WGVS
Sbjct  53   SNRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGVS  111



>ref|XP_003700215.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Megachile rotundata]
Length=930

 Score = 70.9 bits (172),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 31/61 (51%), Positives = 44/61 (72%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT+++DS+ WRRL+WPE EVF+FN+VLN+SSEWG S   W  +  +   + L+Y LV + 
Sbjct  211  LTVMIDSIFWRRLVWPEGEVFYFNTVLNKSSEWGTSPFLWYFYSALPRGLVLSYFLVPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>ref|XP_009030087.1| hypothetical protein HELRODRAFT_70039 [Helobdella robusta]
 gb|ESN91704.1| hypothetical protein HELRODRAFT_70039 [Helobdella robusta]
Length=492

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 35/80 (44%), Positives = 49/80 (61%), Gaps = 3/80 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            R IS  + ++     +L  I LT++VDS  WRR LWPEFEVFWFN+ LN+S +WG S   
Sbjct  194  RKISFGRTLLHGLVASLIAIMLTVLVDSYFWRRWLWPEFEVFWFNTALNKSHQWGTSPFL  253

Query  110  WRHHILICACISLNYVLVDI  51
            W  +  +  C+   Y+LV +
Sbjct  254  WYFYSALPRCLGPFYILVPL  273



>ref|XP_010933575.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Elaeis guineensis]
Length=495

 Score = 70.1 bits (170),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 34/63 (54%), Positives = 43/63 (68%), Gaps = 8/63 (13%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L ++SISLW+A+  C  TAL  I        +MW+R++WPE EVFWFNS+LNRSSEWG  
Sbjct  208  LLSKSISLWRAMKCCIATALLSI--------LMWQRIVWPELEVFWFNSILNRSSEWGTH  259

Query  110  WRH  102
              H
Sbjct  260  PFH  262



>ref|XP_011163791.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Solenopsis invicta]
Length=1054

 Score = 70.5 bits (171),  Expect = 5e-11, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y LV 
Sbjct  297  LALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLALSYFLVP  356

Query  53   IYM  45
              M
Sbjct  357  FGM  359



>gb|KFV12894.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pterocles gutturalis]
Length=490

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS+ K +       + C+GLT+ VDS+ WR+L+WPE EV W+N+VLN+SS WG S
Sbjct  202  TKRISILKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGEVLWYNTVLNKSSNWGTS  259



>ref|XP_001640825.1| predicted protein [Nematostella vectensis]
 gb|EDO48762.1| predicted protein [Nematostella vectensis]
Length=487

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 43/58 (74%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR ++  KA++   G  +  +GLT+ +DS+ W+R LWPE EVF+FN+VLN+SS+WG S
Sbjct  198  TRRLTFCKALLHSVGAGVTGLGLTVCIDSIFWQRWLWPEGEVFYFNAVLNKSSQWGTS  255



>ref|XP_010078902.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pterocles gutturalis]
Length=510

 Score = 69.7 bits (169),  Expect = 5e-11, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS+ K +       + C+GLT+ VDS+ WR+L+WPE EV W+N+VLN+SS WG S
Sbjct  222  TKRISILKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGEVLWYNTVLNKSSNWGTS  279



>gb|AJC98479.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEVEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98491.1| AGAP000102 [Anopheles coluzzii]
Length=720

 Score = 70.1 bits (170),  Expect = 6e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_009907509.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Picoides pubescens]
Length=506

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  218  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  275



>gb|KFV76590.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Picoides pubescens]
Length=489

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  201  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_008934732.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Merops nubicus]
 gb|KFQ16776.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Merops nubicus]
Length=490

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ IS++K +         C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  200  LLTKRISIFKVLSHAVPAGFFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010010445.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nestor notabilis]
 gb|KFQ47355.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nestor notabilis]
Length=490

 Score = 69.3 bits (168),  Expect = 7e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>gb|KFO86029.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Buceros rhinoceros silvestris]
Length=490

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSSWGTS  259



>ref|XP_005150100.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Melopsittacus undulatus]
Length=490

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_011349260.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Cerapachys biroi]
 gb|EZA47769.1| putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Cerapachys biroi]
Length=1043

 Score = 69.7 bits (169),  Expect = 8e-11, Method: Composition-based stats.
 Identities = 31/79 (39%), Positives = 50/79 (63%), Gaps = 5/79 (6%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLV-  57
            + LT+  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++L+Y L+ 
Sbjct  209  LALTVATDSIFWRRLVWPEGEVFYFNAILNKSSEWGTSPFLWYFYSALPRGLALSYFLIP  268

Query  56   -DIYMPVHWHIYSVVSFAF  3
              I++     + +V +  F
Sbjct  269  LGIFLDARVRVLTVPAITF  287



>ref|XP_010143942.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Buceros rhinoceros silvestris]
Length=514

 Score = 69.3 bits (168),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 42/58 (72%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  226  TKRISIFKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSSWGTS  283



>ref|XP_007974352.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Chlorocebus sabaeus]
Length=430

 Score = 68.9 bits (167),  Expect = 9e-11, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  143  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  200



>gb|AJC98481.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98474.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98476.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_003689857.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Apis florea]
Length=880

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LTI +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ + 
Sbjct  211  LTIAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>gb|AJC98490.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98492.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98482.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98475.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98493.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98484.1| AGAP000102 [Anopheles coluzzii]
 gb|AJC98487.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_006617369.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Apis dorsata]
Length=959

 Score = 69.7 bits (169),  Expect = 9e-11, Method: Composition-based stats.
 Identities = 29/61 (48%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LTI +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ + 
Sbjct  211  LTIAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>gb|AJC98489.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_311046.4| AGAP000102-PA [Anopheles gambiae str. PEST]
 gb|EAA06341.4| AGAP000102-PA [Anopheles gambiae str. PEST]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98486.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98477.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98485.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98488.1| AGAP000102 [Anopheles coluzzii]
Length=723

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98483.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_011063596.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Acromyrmex echinatior]
Length=939

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ 
Sbjct  209  LALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIP  268

Query  53   IYMPVHWHI  27
            + M   W I
Sbjct  269  LGM--FWDI  275



>gb|EGI70265.1| Putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Acromyrmex echinatior]
Length=967

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/69 (45%), Positives = 45/69 (65%), Gaps = 5/69 (7%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LTI  DS+ WRRL+WPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ 
Sbjct  209  LALTIATDSIFWRRLVWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIP  268

Query  53   IYMPVHWHI  27
            + M   W I
Sbjct  269  LGM--FWDI  275



>ref|XP_004438054.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Ceratotherium simum simum]
Length=490

 Score = 68.9 bits (167),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ KA+       + C+GLT+ VDS  WR L+WPE +V W+N++LNRSS WG S
Sbjct  203  TRRVSVAKALRCAIPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTILNRSSNWGTS  260



>gb|AJC98480.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>gb|AJC98478.1| AGAP000102 [Anopheles coluzzii]
Length=722

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_010371872.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Rhinopithecus roxellana]
Length=430

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+         C+GLT+ VDS  WR L WPE +VFW+N+VLN+SS WG S
Sbjct  143  NRKISVVRALRHAIPAGTLCLGLTVAVDSYFWRELTWPEGKVFWYNTVLNKSSNWGTS  200



>ref|XP_011220646.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Ailuropoda melanoleuca]
Length=433

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ KAV       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  145  TRRLSVAKAVRCAVPAGVLCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  202



>ref|XP_003770822.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Sarcophilus harrisii]
Length=489

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            ++ ++L K +         C+GLT+ VDS+ WR +LWPE +V W+N+VLN+SS+WGVS
Sbjct  201  SKKVTLLKVLGHAIPAGAVCLGLTVAVDSMFWRHVLWPEGQVLWYNTVLNKSSDWGVS  258



>ref|XP_011153544.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Harpegnathos saltator]
 gb|EFN75071.1| Probable dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Harpegnathos saltator]
Length=1081

 Score = 69.3 bits (168),  Expect = 1e-10, Method: Composition-based stats.
 Identities = 31/82 (38%), Positives = 51/82 (62%), Gaps = 3/82 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            R +S+ + +       +  + LTI  DS+ WRRL+WPE EVF+FN++LN+SS+WG S   
Sbjct  190  RKLSIPRMLKIAVPAGILFLALTIATDSIFWRRLVWPEGEVFYFNAILNKSSDWGTSPFL  249

Query  110  WRHHILICACISLNYVLVDIYM  45
            W  +  +   ++L+Y L+ + M
Sbjct  250  WYFYSALPRGLALSYFLIPLGM  271



>ref|XP_009215805.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Papio anubis]
Length=456

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>ref|XP_003905777.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Papio anubis]
Length=488

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>gb|EHH20343.1| hypothetical protein EGK_03180 [Macaca mulatta]
Length=488

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>ref|XP_007974351.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Chlorocebus sabaeus]
Length=488

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>ref|XP_005567025.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Macaca fascicularis]
 ref|XP_005567026.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Macaca fascicularis]
 ref|XP_005567027.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Macaca fascicularis]
Length=488

 Score = 68.6 bits (166),  Expect = 1e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>ref|XP_009215802.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Papio anubis]
 ref|XP_009215803.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Papio anubis]
Length=503

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>ref|XP_007974353.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Chlorocebus sabaeus]
Length=419

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  132  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  189



>ref|XP_007974350.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Chlorocebus sabaeus]
Length=532

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  245  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  302



>gb|EFX61262.1| hypothetical protein DAPPUDRAFT_340335 [Daphnia pulex]
Length=541

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 37/83 (45%), Positives = 49/83 (59%), Gaps = 3/83 (4%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS--  111
            TR +SL K VI    + L  + LT++VDS  W+RLLWPE EV WFN VLN+S +WG S  
Sbjct  189  TRRLSLVKTVIFAVPSGLIWLSLTVLVDSFYWQRLLWPEGEVLWFNVVLNKSGDWGTSPF  248

Query  110  -WRHHILICACISLNYVLVDIYM  45
             W  +  I   +  +  LV + M
Sbjct  249  LWYFYSAIPRAMGTSLALVPVGM  271



>ref|XP_002917304.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Ailuropoda melanoleuca]
 ref|XP_011220645.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Ailuropoda melanoleuca]
 gb|EFB15088.1| hypothetical protein PANDA_005497 [Ailuropoda melanoleuca]
Length=491

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 30/58 (52%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ KAV       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  203  TRRLSVAKAVRCAVPAGVLCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  260



>ref|XP_010371868.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Rhinopithecus roxellana]
 ref|XP_010371870.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Rhinopithecus roxellana]
 ref|XP_010371871.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Rhinopithecus roxellana]
Length=488

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+         C+GLT+ VDS  WR L WPE +VFW+N+VLN+SS WG S
Sbjct  201  NRKISVVRALRHAIPAGTLCLGLTVAVDSYFWRELTWPEGKVFWYNTVLNKSSNWGTS  258



>ref|XP_003732200.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Callithrix jacchus]
Length=488

 Score = 68.2 bits (165),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +R +S+ +A+       + C+GLT+ VDS  WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  201  SRKVSVVRALRHAIPAGVLCLGLTVAVDSYFWRQLMWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_008205527.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nasonia vitripennis]
Length=992

 Score = 68.9 bits (167),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 31/63 (49%), Positives = 43/63 (68%), Gaps = 3/63 (5%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            +GLTI VDS  W+R LWPE EV +FN++LN+SSEWG S   W  +  +   ++L+Y LV 
Sbjct  201  LGLTITVDSYFWKRALWPEGEVLYFNTILNKSSEWGTSPFLWYFYSALPRGMALSYFLVP  260

Query  53   IYM  45
            + M
Sbjct  261  LGM  263



>gb|AJC98494.1| AGAP000102 [Anopheles merus]
Length=721

 Score = 68.6 bits (166),  Expect = 2e-10, Method: Composition-based stats.
 Identities = 34/73 (47%), Positives = 46/73 (63%), Gaps = 3/73 (4%)
 Frame = -3

Query  224  IGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVD  54
            + LT+ VDS  WRRLLWPE EVFWFN+V N+SSEWG S   W  +  +   + L+ V V 
Sbjct  209  VALTVTVDSYFWRRLLWPEAEVFWFNTVQNKSSEWGTSPFLWYVYSALPRAMGLSIVFVP  268

Query  53   IYMPVHWHIYSVV  15
            + + +   I S+V
Sbjct  269  LGLYLETRIRSLV  281



>ref|XP_009215804.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X3 [Papio anubis]
Length=480

 Score = 67.8 bits (164),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  WR+L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVFWYNTVLNKSANWGTS  258



>gb|EOB00345.1| Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 6-mannosyltransferase, 
partial [Anas platyrhynchos]
Length=490

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ +S+ K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRVSVLKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_001901623.1| Plasmid Maintenance Protein containing protein [Brugia malayi]
Length=432

 Score = 67.4 bits (163),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 30/61 (49%), Positives = 43/61 (70%), Gaps = 3/61 (5%)
 Frame = -3

Query  284  TRSISLWK---AVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            TR +SL+    AV+ C  TA+  +G+++ +DS +WRR LWPE EV WFN +LNRS E+G+
Sbjct  158  TRQLSLFGWNGAVVHCLSTAMLTLGISVPLDSFLWRRWLWPEGEVLWFNVILNRSHEYGI  217

Query  113  S  111
             
Sbjct  218  Q  218



>ref|XP_001663288.1| AAEL013078-PA [Aedes aegypti]
 gb|EAT34715.1| AAEL013078-PA [Aedes aegypti]
Length=689

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LT+ VDS  WRRLLWPE EVFWFN++LN+SSEWG S
Sbjct  211  LTVAVDSFFWRRLLWPEAEVFWFNTILNKSSEWGTS  246



>ref|XP_004610821.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Sorex araneus]
Length=585

 Score = 67.8 bits (164),  Expect = 3e-10, Method: Composition-based stats.
 Identities = 27/42 (64%), Positives = 33/42 (79%), Gaps = 0/42 (0%)
 Frame = -3

Query  236  ALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             LCC+ LT+VVDS  WR LLWPE +VFW+N+VLN+S  WG S
Sbjct  313  GLCCLALTVVVDSYFWRSLLWPEGKVFWYNTVLNKSGNWGTS  354



>ref|XP_005020901.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Anas platyrhynchos]
Length=555

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ +S+ K +       + C+GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  267  TKRVSVLKVLSHAVPAGIFCLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  324



>ref|XP_002831329.2| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pongo abelii]
Length=360

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  73   NRKVSVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  130



>ref|XP_001648338.1| AAEL014279-PA [Aedes aegypti]
 gb|EAT33447.1| AAEL014279-PA [Aedes aegypti]
Length=680

 Score = 67.4 bits (163),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            LT+ VDS  WRRLLWPE EVFWFN++LN+SSEWG S
Sbjct  211  LTVAVDSFFWRRLLWPEAEVFWFNTILNKSSEWGTS  246



>ref|XP_006557963.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X3 [Apis mellifera]
Length=873

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT  +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ + 
Sbjct  80   LTTAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPLG  139

Query  47   M  45
            M
Sbjct  140  M  140



>gb|EFX74600.1| hypothetical protein DAPPUDRAFT_307223 [Daphnia pulex]
Length=320

 Score = 65.9 bits (159),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 36/83 (43%), Positives = 48/83 (58%), Gaps = 3/83 (4%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS--  111
            TR +SL K  I    + L  + LT++VDS  W+RLLWPE EV WFN VLN+S +WG S  
Sbjct  189  TRRLSLVKTGIFAVPSGLIWLSLTVLVDSFYWQRLLWPEGEVLWFNVVLNKSGDWGTSPF  248

Query  110  -WRHHILICACISLNYVLVDIYM  45
             W  +  I   +  +  LV + M
Sbjct  249  LWYFYSAIPRAMGTSLALVPVGM  271



>ref|XP_006557961.1| PREDICTED: probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Apis mellifera]
Length=1004

 Score = 67.8 bits (164),  Expect = 4e-10, Method: Composition-based stats.
 Identities = 28/61 (46%), Positives = 42/61 (69%), Gaps = 3/61 (5%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACISLNYVLVDIY  48
            LT  +DS+ W+RLLWPE EVF+FN++LN+SSEWG S   W  +  +   ++ +Y L+ + 
Sbjct  211  LTTAIDSIFWKRLLWPEGEVFYFNTILNKSSEWGTSPFLWYFYSALPRGLAFSYFLIPLG  270

Query  47   M  45
            M
Sbjct  271  M  271



>gb|EJW79963.1| plasmid Maintenance protein containing protein [Wuchereria bancrofti]
Length=403

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 26/50 (52%), Positives = 38/50 (76%), Gaps = 0/50 (0%)
 Frame = -3

Query  260  AVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            A++ C  TA+  +G+++ +DS +WRR LWPE EVFWFN +LNRS E+G+ 
Sbjct  141  AIVHCLSTAMLTLGISVPLDSFLWRRWLWPEGEVFWFNVILNRSHEYGIQ  190



>ref|XP_004063719.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Gorilla gorilla gorilla]
Length=488

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_004409739.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Odobenus rosmarus divergens]
Length=491

 Score = 67.0 bits (162),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ KA+         C+GLT+ VDS  WR L+WPE +V W+N++LN+SS WG+S
Sbjct  203  TRRLSVAKALRCAVPAGALCLGLTVAVDSYFWRYLVWPEGKVLWYNTILNKSSNWGIS  260



>gb|KDR17512.1| putative dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 
6-mannosyltransferase [Zootermopsis nevadensis]
Length=1138

 Score = 67.4 bits (163),  Expect = 5e-10, Method: Composition-based stats.
 Identities = 32/64 (50%), Positives = 40/64 (63%), Gaps = 3/64 (5%)
 Frame = -3

Query  302  DFL*LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSE  123
            D +  Q   + L K  I      L  + LTI+VDS+ WRRLLWPE EV +FN+VLNRS +
Sbjct  198  DLVNQQIHPLKLLKLTIP---AGLVFLSLTIIVDSIFWRRLLWPEGEVLFFNTVLNRSHQ  254

Query  122  WGVS  111
            WG S
Sbjct  255  WGTS  258



>gb|EHH65944.1| hypothetical protein EGM_02821 [Macaca fascicularis]
Length=488

 Score = 66.6 bits (161),  Expect = 5e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R IS+ +A+       + C+GLT+ VDS  W++L WPE +VFW+N+VLN+S+ WG S
Sbjct  201  NRKISVVRALRHAIPAGILCLGLTVAVDSYFWQQLTWPEGKVFWYNTVLNKSANWGTS  258



>emb|CAC83681.1| putative dolichyl-p-man: Man7GlcNAc2-PP-dolichyl mannosyltransferase 
[Homo sapiens]
Length=488

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>gb|AAH98562.1| Asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase 
homolog (S. cerevisiae) [Homo sapiens]
Length=488

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|NP_077010.1| dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Homo sapiens]
 sp|Q9BV10.1|ALG12_HUMAN RecName: Full=Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; 
AltName: Full=Asparagine-linked glycosylation 
protein 12 homolog; Short=hALG12; AltName: Full=Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; 
AltName: Full=Mannosyltransferase ALG12 homolog; AltName: 
Full=Membrane protein SB87 [Homo sapiens]
 gb|AAL55850.1|AF318343_1 unknown [Homo sapiens]
 gb|AAH01729.1| Asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase 
homolog (S. cerevisiae) [Homo sapiens]
 emb|CAC67488.1| putative alpha mannosyltransferase [Homo sapiens]
 emb|CAG30255.1| ALG12 [Homo sapiens]
 emb|CAK54650.1| ALG12 [synthetic construct]
 emb|CAK54949.1| ALG12 [synthetic construct]
 gb|EAW73480.1| asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase), 
isoform CRA_a [Homo sapiens]
 gb|EAW73481.1| asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase), 
isoform CRA_a [Homo sapiens]
 gb|EAW73482.1| asparagine-linked glycosylation 12 homolog (yeast, alpha-1,6-mannosyltransferase), 
isoform CRA_a [Homo sapiens]
 gb|ABM83756.1| asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase) 
[synthetic construct]
 gb|ABM87075.1| asparagine-linked glycosylation 12 homolog (S. cerevisiae, alpha-1,6-mannosyltransferase) 
[synthetic construct]
 dbj|BAI45267.1| asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase 
homolog [synthetic construct]
 gb|AIC52232.1| ALG12, partial [synthetic construct]
Length=488

 Score = 66.6 bits (161),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_007889176.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Callorhinchus milii]
Length=305

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L    IS++K++      A   +GL++ VDSV W RLLWPE EV W+N+V+N+SSEWG S
Sbjct  6    LVNHRISIFKSLYHAVPAAFVWLGLSVCVDSVFWGRLLWPEGEVLWYNTVMNKSSEWGTS  65



>ref|XP_002831330.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
isoform X1 [Pongo abelii]
Length=331

 Score = 65.5 bits (158),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_001489274.3| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Equus caballus]
Length=336

 Score = 65.9 bits (159),  Expect = 6e-10, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 41/60 (68%), Gaps = 0/60 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWR  105
            T  +S+ KA+         C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WGVS+R
Sbjct  203  TGRLSVGKALRCAVPAGGLCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGVSFR  262



>gb|EHJ73778.1| putative glycosyltransferase [Danaus plexippus]
Length=728

 Score = 66.6 bits (161),  Expect = 7e-10, Method: Composition-based stats.
 Identities = 27/36 (75%), Positives = 31/36 (86%), Gaps = 0/36 (0%)
 Frame = -3

Query  218  LTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +T+ VDS+ W RLLWPE EVFWFNSVLN+SSEWG S
Sbjct  185  ITVSVDSLFWGRLLWPEAEVFWFNSVLNKSSEWGTS  220



>ref|XP_001850969.1| glycosyltransferase [Culex quinquefasciatus]
 gb|EDS32860.1| glycosyltransferase [Culex quinquefasciatus]
Length=679

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 33/92 (36%), Positives = 47/92 (51%), Gaps = 22/92 (24%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            + + L   +       +  + LT+ VDS +WRRLLWPE EVFWFN++LN+SSE+G S   
Sbjct  190  KRVKLETVLKVAIPAGILLVALTVTVDSFLWRRLLWPEAEVFWFNTILNKSSEYGTS---  246

Query  101  HILICACISLNYVLVDIYMPVHWHIYSVVSFA  6
                               P+ W+IYS +  A
Sbjct  247  -------------------PILWYIYSALPRA  259



>ref|XP_002104066.1| GD18643 [Drosophila simulans]
 gb|EDX13569.1| GD18643 [Drosophila simulans]
Length=631

 Score = 66.6 bits (161),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 34/92 (37%), Positives = 52/92 (57%), Gaps = 3/92 (3%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            R +S+   +       +C +  T++VDS  WRRLLWPE EV W+N++LN+SS WG S   
Sbjct  190  RKVSIDGLLKVALPAGVCILAATVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFL  249

Query  110  WRHHILICACISLNYVLVDIYMPVHWHIYSVV  15
            W  +  +   +  + VLV I + +   I S+V
Sbjct  250  WYFYSALPRAMGASLVLVPIGVALEPRIRSLV  281



>ref|XP_007889175.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Callorhinchus milii]
Length=344

 Score = 65.5 bits (158),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 29/55 (53%), Positives = 40/55 (73%), Gaps = 0/55 (0%)
 Frame = -3

Query  275  ISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            IS++K++      A   +GL++ VDSV W RLLWPE EV W+N+V+N+SSEWG S
Sbjct  50   ISIFKSLYHAVPAAFVWLGLSVCVDSVFWGRLLWPEGEVLWYNTVMNKSSEWGTS  104



>ref|XP_003932812.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Saimiri boliviensis boliviensis]
Length=488

 Score = 66.2 bits (160),  Expect = 8e-10, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            +R +S+ +A        + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  SRKVSVVRAFRHAIPAGVLCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|NP_001016120.1| ALG12, alpha-1,6-mannosyltransferase precursor [Xenopus (Silurana) 
tropicalis]
Length=489

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            ++IS+ K ++         +G+T+VVDS  W+RLLWPE EV W+N++LN+SS+WG S
Sbjct  202  KNISVLKILLHAVPAGFLWLGITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTS  258



>gb|AAM94900.1|AF311904_1 membrane protein SB87 precursor [Homo sapiens]
Length=683

 Score = 66.6 bits (161),  Expect = 9e-10, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +A+       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  202  RKVSVVRALRHAVPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>gb|AAI55513.1| asparagine-linked glycosylation 12, alpha-1,6-mannosyltransferase 
homolog [Xenopus (Silurana) tropicalis]
Length=489

 Score = 66.2 bits (160),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 41/57 (72%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            ++IS+ K ++         +G+T+VVDS  W+RLLWPE EV W+N++LN+SS+WG S
Sbjct  202  KNISVLKILLHAVPAGFLWLGITVVVDSYFWKRLLWPEGEVLWYNTILNKSSDWGTS  258



>ref|XP_005207555.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Bos taurus]
Length=433

 Score = 65.9 bits (159),  Expect = 9e-10, Method: Compositional matrix adjust.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +SL +A+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  146  RKLSLTRALRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  202



>ref|XP_008701210.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Ursus maritimus]
Length=504

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 29/58 (50%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ KA+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  203  TRRLSVAKAMRCAVPAGVLCLGLTVTVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  260



>gb|ENN80093.1| hypothetical protein YQE_03452, partial [Dendroctonus ponderosae]
Length=735

 Score = 66.2 bits (160),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 26/39 (67%), Positives = 31/39 (79%), Gaps = 0/39 (0%)
 Frame = -3

Query  227  CIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            C+ LTIVVDS+ W R LWPE EV W+N++LNRSS WG S
Sbjct  208  CLLLTIVVDSIFWNRALWPEGEVLWYNTILNRSSNWGTS  246



>ref|XP_004007716.1| PREDICTED: LOW QUALITY PROTEIN: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol 
alpha-1,6-mannosyltransferase [Ovis aries]
Length=592

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +SL +A+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  209  RKLSLTRALRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  265



>ref|NP_649939.1| CG8412 [Drosophila melanogaster]
 sp|Q9VH78.1|ALG12_DROME RecName: Full=Probable Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase; 
AltName: Full=Asparagine-linked glycosylation 
protein 12 homolog; AltName: Full=Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1,6-mannosyltransferase; 
AltName: Full=Mannosyltransferase ALG12 homolog [Drosophila 
melanogaster]
 gb|AAF54441.1| CG8412 [Drosophila melanogaster]
 gb|AAL48754.1| RE17513p [Drosophila melanogaster]
 gb|ACL86552.1| CG8412-PA, partial [synthetic construct]
Length=678

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  R +S+   +       +C +  T++VDS  WRRLLWPE EV W+N+VLN+SS WG S
Sbjct  187  LLRRKVSIDGLLKVALPAGVCILAATVLVDSFFWRRLLWPEGEVLWYNTVLNKSSNWGTS  246

Query  110  ---WRHHILICACISLNYVLVDI  51
               W  +  +   +  + VLV I
Sbjct  247  PFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_002054547.1| GJ22748 [Drosophila virilis]
 gb|EDW68067.1| GJ22748 [Drosophila virilis]
Length=690

 Score = 65.9 bits (159),  Expect = 1e-09, Method: Composition-based stats.
 Identities = 33/83 (40%), Positives = 48/83 (58%), Gaps = 5/83 (6%)
 Frame = -3

Query  236  ALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---WRHHILICACI--SL  72
             LC +  T++VDS  WRRLLWPE EV W+N++LN+SS WG S   W  +  +   +  SL
Sbjct  205  GLCILASTVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTSPFLWYFYSALPRAMGASL  264

Query  71   NYVLVDIYMPVHWHIYSVVSFAF  3
             +V + IY        ++ + AF
Sbjct  265  AFVPIGIYFERRLRPLALCAVAF  287



>ref|XP_007519500.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Erinaceus europaeus]
Length=739

 Score = 65.9 bits (159),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/58 (47%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            TR +S+ + +       + C+GLT+ VDS  WR L+WPE +V W+N VLN+SS WG S
Sbjct  451  TRKVSVTRTLRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNIVLNKSSSWGTS  508



>gb|EJK52362.1| hypothetical protein THAOC_28372, partial [Thalassiosira oceanica]
Length=361

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            R +S+ +AV++   T +  + +T+ +DSVMW R +WPEFEV++FN+V NRSSEWG    H
Sbjct  255  RDLSVPEAVLTGTITGVVSLAVTVPLDSVMWGRPIWPEFEVWYFNTVDNRSSEWGEQPVH  314



>ref|XP_002031835.1| GM23833 [Drosophila sechellia]
 gb|EDW42821.1| GM23833 [Drosophila sechellia]
Length=678

 Score = 65.5 bits (158),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 32/83 (39%), Positives = 47/83 (57%), Gaps = 3/83 (4%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L  R +S+   +       +C +  T++VDS  WRRLLWPE EV W+N++LN+SS WG S
Sbjct  187  LLRRKVSIDGLLKVALPAGVCILAATVLVDSFFWRRLLWPEGEVLWYNTILNKSSNWGTS  246

Query  110  ---WRHHILICACISLNYVLVDI  51
               W  +  +   +  + VLV I
Sbjct  247  PFLWYFYSALPRAMGASLVLVPI  269



>ref|XP_010830422.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Bison bison bison]
Length=502

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 28/57 (49%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +SL +A+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  233  RKLSLTRALRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  289



>ref|XP_003280777.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Nomascus leucogenys]
Length=488

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ +A+       + C+GLT+ VDS  W++L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRALRHAIPAGILCLGLTVAVDSYFWQQLTWPEGKVLWYNTVLNKSSNWGTS  258



>gb|KFP30903.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Colius striatus]
Length=490

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       L  +GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRISIFKVLSHAVPAGLFWLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_010198175.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Colius striatus]
Length=512

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       L  +GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  224  TKRISIFKVLSHAVPAGLFWLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  281



>ref|XP_007054631.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Chelonia mydas]
Length=489

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 40/58 (69%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            ++ IS+ K +       +  +GLT+ VDSV WR+LLWPE +V W+N+VLN+SS WG S
Sbjct  201  SKRISILKMLSHAVAAGVVWLGLTVAVDSVFWRQLLWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_007651110.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Cricetulus griseus]
 ref|XP_007626601.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X4 [Cricetulus griseus]
Length=492

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +         + C+GLT+ VDS  WR L+WPE EV W+N+VLN+SS WG S
Sbjct  205  RRLSVARLFQHAIPAGILCLGLTVAVDSYFWRYLVWPEGEVLWYNTVLNKSSNWGTS  261



>gb|EGW09352.1| Dolichyl-P-Man:Man(7)GlcNAc(2)-PP-dolichyl-alpha-1, 6-mannosyltransferase 
[Cricetulus griseus]
Length=361

 Score = 64.3 bits (155),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 27/57 (47%), Positives = 37/57 (65%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +         + C+GLT+ VDS  WR L+WPE EV W+N+VLN+SS WG S
Sbjct  74   RRLSVARLFQHAIPAGILCLGLTVAVDSYFWRYLVWPEGEVLWYNTVLNKSSNWGTS  130



>gb|EJK72529.1| hypothetical protein THAOC_05935 [Thalassiosira oceanica]
Length=403

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 29/60 (48%), Positives = 43/60 (72%), Gaps = 0/60 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVSWRH  102
            R +S+ +AV++   T +  + +T+ +DSVMW R +WPEFEV++FN+V NRSSEWG    H
Sbjct  260  RDLSVPEAVLTGAITGVVSLAVTVPLDSVMWGRPIWPEFEVWYFNTVDNRSSEWGEQPVH  319



>ref|XP_001140006.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pan troglodytes]
 ref|XP_003811088.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Pan paniscus]
Length=488

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ + +       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRTLHHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>ref|XP_006735449.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Leptonychotes weddellii]
Length=491

 Score = 65.1 bits (157),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 29/60 (48%), Positives = 40/60 (67%), Gaps = 0/60 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L TR +S+ KA+         C+GLT+ VDS  WR L+WPE +V W+N++LN+SS WG S
Sbjct  201  LCTRRLSVAKALRCALPAGALCLGLTVAVDSYFWRCLVWPEGKVLWYNTILNKSSNWGTS  260



>ref|XP_005519263.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X1 [Pseudopodoces humilis]
 ref|XP_005519264.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pseudopodoces humilis]
Length=490

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 28/58 (48%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       +  +GLTI VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  202  TKRISIFKVLSHAVPAGMFWLGLTIAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  259



>ref|XP_004320671.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Tursiops truncatus]
Length=491

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +A+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  204  RKVSVARALRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  260



>ref|XP_004279649.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Orcinus orca]
Length=491

 Score = 64.7 bits (156),  Expect = 2e-09, Method: Composition-based stats.
 Identities = 27/57 (47%), Positives = 39/57 (68%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +A+       + C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WG S
Sbjct  204  RKVSVARALRCAVPAGILCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGTS  260



>ref|XP_004650701.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Jaculus jaculus]
Length=490

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/57 (46%), Positives = 38/57 (67%), Gaps = 0/57 (0%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            R +S+ +         + C+GLT+ VDS  WR L+WPE EV W+N++LN+SS+WG S
Sbjct  203  RRVSVARLFQHAIPAGILCLGLTVAVDSYFWRYLVWPEGEVLWYNTILNKSSDWGTS  259



>ref|XP_004987604.1| hypothetical protein PTSG_11395 [Salpingoeca rosetta]
 gb|EGD81856.1| hypothetical protein PTSG_11395 [Salpingoeca rosetta]
Length=490

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 31/80 (39%), Positives = 50/80 (63%), Gaps = 3/80 (4%)
 Frame = -3

Query  281  RSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS---  111
            R+ISL + +++     L  I +++ VDS  W+RLLWPE EV WFN++LN+SS +G     
Sbjct  200  RNISLSRLLLTGIPAGLLSIAVSVGVDSFFWQRLLWPEGEVLWFNTILNKSSNYGTEPFL  259

Query  110  WRHHILICACISLNYVLVDI  51
            W  +  +  C+S + +LV +
Sbjct  260  WYFYSALPRCLSASLLLVPV  279



>gb|EJD76603.1| glycosyltransferase family 22 protein [Loa loa]
Length=353

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 30/60 (50%), Positives = 43/60 (72%), Gaps = 3/60 (5%)
 Frame = -3

Query  284  TRSISLWK---AVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGV  114
            TR + L+    AV+ C  TAL  +G+++ +DS +WRR +WPE EV+WFN VLNRS E+G+
Sbjct  196  TRQLPLFGWNGAVVHCLSTALLALGVSVPIDSFLWRRWVWPEGEVWWFNVVLNRSHEYGI  255



>ref|XP_009927917.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus albicilla]
 ref|XP_010579150.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus leucocephalus]
 gb|KFP93072.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Haliaeetus albicilla]
Length=490

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 27/58 (47%), Positives = 41/58 (71%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T+ IS++K +       +  +GLT+ VDS+ WR+L+WPE +V W+N++LNRSS WG S
Sbjct  202  TKRISIFKVLSHAVPAGIFWLGLTVAVDSLFWRQLVWPEGKVLWYNTILNRSSNWGTS  259



>ref|XP_001914875.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase-like 
[Equus caballus]
Length=332

 Score = 63.9 bits (154),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 29/58 (50%), Positives = 39/58 (67%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            T  +S+ KA+         C+GLT+ VDS  WR L+WPE +V W+N+VLN+SS WGVS
Sbjct  202  TGRLSVGKALRCAVPAGGLCLGLTVAVDSYFWRYLVWPEGKVLWYNTVLNKSSNWGVS  259



>ref|XP_009436925.1| PREDICTED: dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
isoform X2 [Pan troglodytes]
Length=423

 Score = 64.3 bits (155),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 26/58 (45%), Positives = 38/58 (66%), Gaps = 0/58 (0%)
 Frame = -3

Query  284  TRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
             R +S+ + +       + C+GLT+ VDS  WR+L WPE +V W+N+VLN+SS WG S
Sbjct  201  NRKVSVVRTLHHAIPAGILCLGLTVAVDSYFWRQLTWPEGKVLWYNTVLNKSSNWGTS  258



>gb|KFP76651.1| Dol-P-Man:Man(7)GlcNAc(2)-PP-Dol alpha-1,6-mannosyltransferase 
[Acanthisitta chloris]
Length=482

 Score = 64.7 bits (156),  Expect = 3e-09, Method: Compositional matrix adjust.
 Identities = 28/60 (47%), Positives = 42/60 (70%), Gaps = 0/60 (0%)
 Frame = -3

Query  290  LQTRSISLWKAVISCFGTALCCIGLTIVVDSVMWRRLLWPEFEVFWFNSVLNRSSEWGVS  111
            L T+ IS++K +       +  +GLT+ VDS+ WR+L+WPE +V W+N+VLN+SS WG S
Sbjct  192  LLTKRISIFKVLSHAVPAGIFWLGLTVAVDSLFWRQLVWPEGKVLWYNTVLNKSSNWGTS  251



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 562388334840