BLAST results

[Archaea] [Bacteria] [Eukaryota] [Viruses] [Metazoa] [green plants] [higher plants] [Others]
Query= JMCP020B04 454 bp,:Filtered

Length=428
                                                                      Score     E
Sequences producing significant alignments:                          (Bits)  Value

gb|KHN33357.1|  hypothetical protein glysoja_005399                   92.4    8e-20   Glycine soja [wild soybean]
ref|XP_003547006.1|  PREDICTED: transcription initiation factor I...  92.4    2e-19   Glycine max [soybeans]
gb|KHN30144.1|  Transcription initiation factor IIA large subunit     90.1    1e-18   Glycine soja [wild soybean]
ref|XP_003543527.1|  PREDICTED: transcription initiation factor I...  90.1    1e-18   Glycine max [soybeans]
gb|KDP42211.1|  hypothetical protein JCGZ_02941                       90.5    1e-18   Jatropha curcas
ref|XP_006595034.1|  PREDICTED: transcription initiation factor I...  89.7    2e-18   Glycine max [soybeans]
ref|XP_010262591.1|  PREDICTED: transcription initiation factor I...  89.0    3e-18   Nelumbo nucifera [Indian lotus]
ref|XP_003537974.1|  PREDICTED: transcription initiation factor I...  88.2    7e-18   Glycine max [soybeans]
ref|XP_002520518.1|  protein with unknown function                    88.2    8e-18   
ref|XP_003539601.1|  PREDICTED: transcription initiation factor I...  87.4    1e-17   Glycine max [soybeans]
emb|CDP09102.1|  unnamed protein product                              87.8    1e-17   Coffea canephora [robusta coffee]
gb|KHN32152.1|  Transcription initiation factor IIA large subunit     87.4    1e-17   Glycine soja [wild soybean]
ref|XP_008464086.1|  PREDICTED: transcription initiation factor I...  86.7    2e-17   
ref|XP_004143132.1|  PREDICTED: transcription initiation factor I...  86.3    4e-17   Cucumis sativus [cucumbers]
ref|XP_008464085.1|  PREDICTED: transcription initiation factor I...  86.3    4e-17   Cucumis melo [Oriental melon]
gb|KGN47124.1|  hypothetical protein Csa_6G188660                     86.3    1e-16   Cucumis sativus [cucumbers]
ref|XP_010256835.1|  PREDICTED: transcription initiation factor I...  84.7    1e-16   Nelumbo nucifera [Indian lotus]
gb|KHG07146.1|  Transcription initiation factor IIA subunit 1         83.6    2e-16   Gossypium arboreum [tree cotton]
gb|KHG15205.1|  Transcription initiation factor IIA subunit 1         83.2    2e-16   Gossypium arboreum [tree cotton]
ref|XP_007016334.1|  Transcription initiation factor IIA subunit 1    84.0    3e-16   
ref|XP_006350788.1|  PREDICTED: transcription initiation factor I...  84.0    3e-16   Solanum tuberosum [potatoes]
gb|KJB55819.1|  hypothetical protein B456_009G096500                  83.6    3e-16   Gossypium raimondii
ref|XP_004241212.1|  PREDICTED: transcription initiation factor I...  83.6    3e-16   Solanum lycopersicum
ref|XP_006584213.1|  PREDICTED: TFIIA-alpha and beta-like factor-...  80.9    4e-16   
gb|KJB08914.1|  hypothetical protein B456_001G112500                  83.6    4e-16   Gossypium raimondii
gb|KHN12254.1|  Transcription initiation factor IIA subunit 1         81.3    7e-16   Glycine soja [wild soybean]
ref|XP_004486980.1|  PREDICTED: transcription initiation factor I...  82.4    1e-15   Cicer arietinum [garbanzo]
gb|ABD33143.2|  Transcription factor IIA, helical                     81.3    1e-15   Medicago truncatula
ref|XP_006379027.1|  hypothetical protein POPTR_0009s04150g           80.9    1e-15   
gb|EPS67672.1|  hypothetical protein M569_07102                       80.5    1e-15   Genlisea aurea
gb|KEH39459.1|  transcription factor IIA, alpha/beta subunit          80.9    1e-15   Medicago truncatula
ref|XP_003597404.1|  Transcription factor/ transcription initiati...  81.3    3e-15   Medicago truncatula
ref|XP_011032249.1|  PREDICTED: transcription initiation factor I...  80.5    3e-15   Populus euphratica
ref|XP_011032247.1|  PREDICTED: transcription initiation factor I...  80.9    4e-15   Populus euphratica
ref|XP_010685693.1|  PREDICTED: transcription initiation factor I...  80.5    5e-15   Beta vulgaris subsp. vulgaris [field beet]
ref|XP_009787287.1|  PREDICTED: transcription initiation factor I...  80.1    8e-15   Nicotiana sylvestris
ref|XP_010535450.1|  PREDICTED: transcription initiation factor I...  79.3    8e-15   Tarenaya hassleriana [spider flower]
ref|XP_006846335.1|  hypothetical protein AMTR_s00012p00256620        78.2    1e-14   
ref|XP_010106542.1|  Transcription initiation factor IIA large su...  79.3    1e-14   
ref|XP_010521880.1|  PREDICTED: transcription initiation factor I...  78.2    3e-14   Tarenaya hassleriana [spider flower]
gb|ABW81076.1|  TF1                                                   77.8    4e-14   Tarenaya spinosa
ref|XP_007150356.1|  hypothetical protein PHAVU_005G146700g           77.0    8e-14   Phaseolus vulgaris [French bean]
ref|XP_002282322.1|  PREDICTED: transcription initiation factor I...  76.3    2e-13   Vitis vinifera
gb|KDO66629.1|  hypothetical protein CISIN_1g015442mg                 74.7    2e-13   Citrus sinensis [apfelsine]
ref|XP_006305104.1|  hypothetical protein CARUB_v10009471mg           75.1    4e-13   Capsella rubella
gb|KJB55820.1|  hypothetical protein B456_009G096500                  74.7    4e-13   Gossypium raimondii
gb|KDO66626.1|  hypothetical protein CISIN_1g015442mg                 75.1    4e-13   Citrus sinensis [apfelsine]
ref|XP_006305101.1|  hypothetical protein CARUB_v10009468mg           74.7    4e-13   Capsella rubella
ref|XP_006417799.1|  hypothetical protein EUTSA_v10007947mg           74.7    5e-13   Eutrema salsugineum [saltwater cress]
ref|XP_008222094.1|  PREDICTED: transcription initiation factor I...  74.7    5e-13   Prunus mume [ume]
ref|XP_006417801.1|  hypothetical protein EUTSA_v10007946mg           74.7    5e-13   Eutrema salsugineum [saltwater cress]
gb|KDO66627.1|  hypothetical protein CISIN_1g015442mg                 74.7    6e-13   Citrus sinensis [apfelsine]
ref|XP_006424899.1|  hypothetical protein CICLE_v10028561mg           74.7    6e-13   Citrus clementina [clementine]
ref|XP_010520257.1|  PREDICTED: transcription initiation factor I...  74.3    8e-13   Tarenaya hassleriana [spider flower]
ref|XP_007205331.1|  hypothetical protein PRUPE_ppa006992mg           73.9    1e-12   Prunus persica
ref|XP_009118436.1|  PREDICTED: transcription initiation factor I...  73.6    1e-12   Brassica rapa
emb|CDY06262.1|  BnaA09g49410D                                        73.6    1e-12   
emb|CDY09915.1|  BnaC08g45360D                                        73.6    1e-12   Brassica napus [oilseed rape]
ref|XP_002298340.1|  transcription factor IIA large subunit famil...  73.6    2e-12   
ref|XP_010542635.1|  PREDICTED: transcription initiation factor I...  73.2    2e-12   Tarenaya hassleriana [spider flower]
ref|XP_011080825.1|  PREDICTED: transcription initiation factor I...  73.6    2e-12   
emb|CAN83895.1|  hypothetical protein VITISV_039114                   73.9    2e-12   Vitis vinifera
ref|XP_006369542.1|  hypothetical protein POPTR_0001s25120g           73.2    2e-12   
ref|XP_009622244.1|  PREDICTED: transcription initiation factor I...  73.2    2e-12   Nicotiana tomentosiformis
ref|XP_010262270.1|  PREDICTED: transcription initiation factor I...  72.8    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010262269.1|  PREDICTED: transcription initiation factor I...  72.8    3e-12   Nelumbo nucifera [Indian lotus]
ref|XP_010475508.1|  PREDICTED: transcription initiation factor I...  72.4    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010475506.1|  PREDICTED: transcription initiation factor I...  72.4    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_002889649.1|  hypothetical protein ARALYDRAFT_470771           72.4    4e-12   
ref|XP_002892402.1|  transcription factor IIA large subunit           72.4    4e-12   
ref|XP_010457931.1|  PREDICTED: transcription initiation factor I...  72.0    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010487493.1|  PREDICTED: transcription initiation factor I...  72.0    4e-12   Camelina sativa [gold-of-pleasure]
ref|NP_850937.1|  transcription factor IIA, alpha/beta subunit        72.0    4e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_010487504.1|  PREDICTED: transcription initiation factor I...  72.0    4e-12   Camelina sativa [gold-of-pleasure]
ref|XP_010457928.1|  PREDICTED: transcription initiation factor I...  72.0    4e-12   
ref|XP_007150517.1|  hypothetical protein PHAVU_005G159000g           72.0    5e-12   Phaseolus vulgaris [French bean]
ref|NP_563790.1|  transcription factor IIA, alpha/beta subunit        72.0    5e-12   Arabidopsis thaliana [mouse-ear cress]
emb|CAA67368.1|  TFIIA                                                71.6    5e-12   Arabidopsis thaliana [mouse-ear cress]
gb|AAF79573.1|AC022464_31  F22G5.18                                   72.4    6e-12   Arabidopsis thaliana [mouse-ear cress]
ref|XP_009118437.1|  PREDICTED: transcription initiation factor I...  71.6    7e-12   Brassica rapa
gb|EYU45954.1|  hypothetical protein MIMGU_mgv1a007767mg              70.9    1e-11   Erythranthe guttata [common monkey flower]
gb|AAF79551.1|AC022464_9  F22G5.14                                    71.2    1e-11   Arabidopsis thaliana [mouse-ear cress]
emb|CDX86480.1|  BnaC08g02230D                                        70.5    2e-11   
ref|XP_008384920.1|  PREDICTED: transcription initiation factor I...  70.5    2e-11   
ref|XP_008803109.1|  PREDICTED: transcription initiation factor I...  69.7    4e-11   
ref|XP_008803108.1|  PREDICTED: transcription initiation factor I...  69.7    4e-11   Phoenix dactylifera
ref|XP_009387333.1|  PREDICTED: transcription initiation factor I...  69.7    4e-11   
ref|XP_008803107.1|  PREDICTED: transcription initiation factor I...  69.3    4e-11   Phoenix dactylifera
ref|XP_009387325.1|  PREDICTED: transcription initiation factor I...  69.3    4e-11   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_006369541.1|  hypothetical protein POPTR_0001s25120g           69.7    4e-11   
ref|XP_009375942.1|  PREDICTED: transcription initiation factor I...  68.6    8e-11   Pyrus x bretschneideri [bai li]
ref|XP_008344834.1|  PREDICTED: transcription initiation factor I...  67.4    2e-10   Malus domestica [apple tree]
ref|XP_009364351.1|  PREDICTED: transcription initiation factor I...  67.4    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_008344833.1|  PREDICTED: transcription initiation factor I...  67.4    2e-10   Malus domestica [apple tree]
ref|XP_009364352.1|  PREDICTED: transcription initiation factor I...  67.4    2e-10   Pyrus x bretschneideri [bai li]
ref|XP_004294662.1|  PREDICTED: transcription initiation factor I...  67.4    2e-10   Fragaria vesca subsp. vesca
dbj|BAJ34634.1|  unnamed protein product                              66.6    2e-10   Eutrema halophilum
ref|XP_009110942.1|  PREDICTED: transcription initiation factor I...  67.0    2e-10   Brassica rapa
emb|CDY15611.1|  BnaA08g28950D                                        67.0    3e-10   Brassica napus [oilseed rape]
gb|KDO66628.1|  hypothetical protein CISIN_1g015442mg                 67.0    3e-10   Citrus sinensis [apfelsine]
ref|XP_008801612.1|  PREDICTED: transcription initiation factor I...  67.0    3e-10   
ref|XP_010920519.1|  PREDICTED: transcription initiation factor I...  67.0    3e-10   Elaeis guineensis
ref|XP_010920520.1|  PREDICTED: transcription initiation factor I...  66.6    4e-10   Elaeis guineensis
ref|XP_010033104.1|  PREDICTED: transcription initiation factor I...  65.9    7e-10   Eucalyptus grandis [rose gum]
ref|XP_011035265.1|  PREDICTED: transcription initiation factor I...  65.9    7e-10   Populus euphratica
ref|XP_006827510.1|  hypothetical protein AMTR_s00009p00181330        63.2    2e-09   
emb|CDY06709.1|  BnaA10g04880D                                        62.0    5e-09   
ref|XP_010487510.1|  PREDICTED: transcription initiation factor I...  62.4    9e-09   Camelina sativa [gold-of-pleasure]
emb|CDY10278.1|  BnaC05g05210D                                        62.4    1e-08   Brassica napus [oilseed rape]
gb|ABK25179.1|  unknown                                               62.4    1e-08   Picea sitchensis
ref|XP_009409507.1|  PREDICTED: transcription initiation factor I...  62.0    1e-08   Musa acuminata subsp. malaccensis [pisang utan]
gb|EMS50757.1|  Transcription initiation factor IIA subunit 1         57.4    3e-07   Triticum urartu
ref|NP_001148644.1|  transcription factor/ transcription initiati...  58.2    3e-07   
ref|XP_009399862.1|  PREDICTED: transcription initiation factor I...  57.8    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_009399861.1|  PREDICTED: transcription initiation factor I...  57.8    4e-07   Musa acuminata subsp. malaccensis [pisang utan]
ref|XP_002452619.1|  hypothetical protein SORBIDRAFT_04g029230        56.2    5e-07   
gb|ACN31103.1|  unknown                                               57.4    6e-07   Zea mays [maize]
ref|XP_004962494.1|  PREDICTED: LOW QUALITY PROTEIN: transcriptio...  57.4    7e-07   
gb|AFW81480.1|  hypothetical protein ZEAMMB73_123227                  55.8    7e-07   
gb|AFW81478.1|  transcription factor/ transcription initiation fa...  57.0    8e-07   
ref|XP_006654234.1|  PREDICTED: transcription initiation factor I...  56.6    1e-06   Oryza brachyantha
ref|XP_008654956.1|  PREDICTED: transcription factor/ transcripti...  56.6    1e-06   Zea mays [maize]
ref|NP_001055101.1|  Os05g0292200                                     55.5    3e-06   
gb|AFW77525.1|  hypothetical protein ZEAMMB73_875019                  51.2    5e-05   
gb|AFW77526.1|  transcription factor/ transcription initiation fa...  51.2    7e-05   
ref|NP_001148522.1|  LOC100282138                                     50.8    8e-05   
gb|EMT17178.1|  Transcription initiation factor IIA subunit 1         50.1    1e-04   
gb|EMS53336.1|  Transcription initiation factor IIA subunit 1         48.9    3e-04   Triticum urartu



>gb|KHN33357.1| hypothetical protein glysoja_005399 [Glycine soja]
Length=254

 Score = 92.4 bits (228),  Expect = 8e-20, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER++A K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  42   MWESKMMQAGAVLGPIERSSAAKATPGGPITPVHDLNVPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>ref|XP_003547006.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Glycine max]
Length=390

 Score = 92.4 bits (228),  Expect = 2e-19, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER++A K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  42   MWESKMMQAGAVLGPIERSSAAKATPGGPITPVHDLNVPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>gb|KHN30144.1| Transcription initiation factor IIA large subunit [Glycine soja]
Length=390

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER+TA K  PGGPITPVHDLNVPYEG++EYE             
Sbjct  42   MWESKMMQAGAVLGPIERSTAAKPTPGGPITPVHDLNVPYEGTDEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>ref|XP_003543527.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoformX1 [Glycine max]
Length=391

 Score = 90.1 bits (222),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER+TA K  PGGPITPVHDLNVPYEG++EYE             
Sbjct  42   MWESKMMQAGAVLGPIERSTAAKPTPGGPITPVHDLNVPYEGTDEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>gb|KDP42211.1| hypothetical protein JCGZ_02941 [Jatropha curcas]
Length=407

 Score = 90.5 bits (223),  Expect = 1e-18, Method: Compositional matrix adjust.
 Identities = 51/94 (54%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWEMKMMQAG ILGPIER++A K VPGGPITPVHDLNVPYEG EEYE             
Sbjct  43   IWEMKMMQAGVILGPIERSSAAKPVPGGPITPVHDLNVPYEGPEEYE-------------  89

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  90   ---------------------TPTAEILFPPTPL  102



>ref|XP_006595034.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Glycine max]
Length=409

 Score = 89.7 bits (221),  Expect = 2e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER+TA K  PGGPITPVHDLNVPYEG++EYE             
Sbjct  42   MWESKMMQAGAVLGPIERSTAAKPTPGGPITPVHDLNVPYEGTDEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>ref|XP_010262591.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Nelumbo nucifera]
Length=370

 Score = 89.0 bits (219),  Expect = 3e-18, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 53/94 (56%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WEMKMMQ GAI GPIER++ PK V GG ITPVHDLNVPYEG+EEYE             
Sbjct  40   LWEMKMMQCGAICGPIERSSVPKTVAGGAITPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  87   ---------------------TPTADMLFPPTPL  99



>ref|XP_003537974.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Glycine max]
 gb|KHN21924.1| Transcription initiation factor IIA large subunit [Glycine soja]
Length=392

 Score = 88.2 bits (217),  Expect = 7e-18, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAGAI+GPIER+ APK  PGGPITPVHDLN+PYEG+EEYE             
Sbjct  42   IWESKMMQAGAIVGPIERSGAPKPTPGGPITPVHDLNMPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  89   ---------------------TPTAEMLFPPTPL  101



>ref|XP_002520518.1| protein with unknown function [Ricinus communis]
 gb|EEF41931.1| protein with unknown function [Ricinus communis]
Length=383

 Score = 88.2 bits (217),  Expect = 8e-18, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 54/95 (57%), Gaps = 34/95 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE+KMMQAG I GPIER++  K VPGG ITPVHDLNVPYEG+EEYE             
Sbjct  43   IWELKMMQAGVICGPIERSSGAKTVPGGVITPVHDLNVPYEGTEEYE-------------  89

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPLP  3
                                 TPT ++LFPPTPLP
Sbjct  90   ---------------------TPTAEILFPPTPLP  103



>ref|XP_003539601.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoformX2 [Glycine max]
Length=389

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KM+QAGAI+GPIER+ APK  PGGPITPVHDLN+PYEG+EEYE             
Sbjct  42   IWESKMLQAGAIVGPIERSGAPKPTPGGPITPVHDLNMPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  89   ---------------------TPTAEMLFPPTPL  101



>emb|CDP09102.1| unnamed protein product [Coffea canephora]
Length=411

 Score = 87.8 bits (216),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 49/94 (52%), Positives = 55/94 (59%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WEMKMMQAGAILGPIER++APK  PG  +TPVHDLNVPYEG+EEYE             
Sbjct  42   LWEMKMMQAGAILGPIERSSAPKATPG--VTPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  87   ---------------------TPTADMLFPPTPL  99



>gb|KHN32152.1| Transcription initiation factor IIA large subunit [Glycine soja]
Length=384

 Score = 87.4 bits (215),  Expect = 1e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 55/94 (59%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KM+QAGAI+GPIER+ APK  PGGPITPVHDLN+PYEG+EEYE             
Sbjct  42   IWESKMLQAGAIVGPIERSGAPKPTPGGPITPVHDLNMPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  89   ---------------------TPTAEMLFPPTPL  101



>ref|XP_008464086.1| PREDICTED: transcription initiation factor IIA large subunit 
isoform X2 [Cucumis melo]
Length=366

 Score = 86.7 bits (213),  Expect = 2e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+ GPIER+   K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  40   MWEAKMMQAGAVTGPIERSAPSKPTPGGPITPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT DLLFPPTPL
Sbjct  87   ---------------------TPTADLLFPPTPL  99



>ref|XP_004143132.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Cucumis sativus]
 ref|XP_004160191.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Cucumis sativus]
Length=402

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+ GPIER+   K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  40   MWEAKMMQAGAVTGPIERSAPSKPTPGGPITPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT DLLFPPTPL
Sbjct  87   ---------------------TPTADLLFPPTPL  99



>ref|XP_008464085.1| PREDICTED: transcription initiation factor IIA subunit 1 isoform 
X1 [Cucumis melo]
Length=401

 Score = 86.3 bits (212),  Expect = 4e-17, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+ GPIER+   K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  40   MWEAKMMQAGAVTGPIERSAPSKPTPGGPITPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT DLLFPPTPL
Sbjct  87   ---------------------TPTADLLFPPTPL  99



>gb|KGN47124.1| hypothetical protein Csa_6G188660 [Cucumis sativus]
Length=536

 Score = 86.3 bits (212),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 48/94 (51%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+ GPIER+   K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  174  MWEAKMMQAGAVTGPIERSAPSKPTPGGPITPVHDLNVPYEGTEEYE-------------  220

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT DLLFPPTPL
Sbjct  221  ---------------------TPTADLLFPPTPL  233



>ref|XP_010256835.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Nelumbo nucifera]
Length=386

 Score = 84.7 bits (208),  Expect = 1e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WEMKMMQ GAI GPIER++ PK   GG ITPVHDLN+PYEG+EEYE             
Sbjct  40   LWEMKMMQFGAICGPIERSSLPKAATGGAITPVHDLNMPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  87   ---------------------TPTADMLFPPTPL  99



>gb|KHG07146.1| Transcription initiation factor IIA subunit 1 [Gossypium arboreum]
Length=317

 Score = 83.6 bits (205),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 52/95 (55%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE KMMQAGAI GPIER+T  K    GGPITPVHDLNVPYEG+EEYE            
Sbjct  42   LWETKMMQAGAICGPIERSTGQKQPTAGGPITPVHDLNVPYEGTEEYE------------  89

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT D+LFPPTPL
Sbjct  90   ----------------------TPTADMLFPPTPL  102



>gb|KHG15205.1| Transcription initiation factor IIA subunit 1 [Gossypium arboreum]
Length=315

 Score = 83.2 bits (204),  Expect = 2e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 51/94 (54%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG ILGPIER++  +  PG  ITPVHDLNVPYEG+EEYE             
Sbjct  42   IWEAKMMQAGVILGPIERSSQKQPTPGSAITPVHDLNVPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>ref|XP_007016334.1| Transcription initiation factor IIA subunit 1 [Theobroma cacao]
 gb|EOY33953.1| Transcription initiation factor IIA subunit 1 [Theobroma cacao]
Length=393

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 52/95 (55%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWEMKMMQAG + GPIER++  K   PGGPITPVHDLNVPYEG EEYE            
Sbjct  42   IWEMKMMQAGVVCGPIERSSGQKQPTPGGPITPVHDLNVPYEGPEEYE------------  89

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT D+LFPPTPL
Sbjct  90   ----------------------TPTADMLFPPTPL  102



>ref|XP_006350788.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Solanum tuberosum]
Length=403

 Score = 84.0 bits (206),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            +WE+KMM AGAILG IERN+A K  PGGPITPVHDLN+PYEG+EEYE
Sbjct  42   LWEVKMMNAGAILGTIERNSAAKATPGGPITPVHDLNMPYEGNEEYE  88



>gb|KJB55819.1| hypothetical protein B456_009G096500 [Gossypium raimondii]
Length=391

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 52/95 (55%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE KMMQAGAI GPIER+T  K    GGPITPVHDLNVPYEG+EEYE            
Sbjct  42   LWETKMMQAGAICGPIERSTGQKQPTAGGPITPVHDLNVPYEGTEEYE------------  89

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT D+LFPPTPL
Sbjct  90   ----------------------TPTADMLFPPTPL  102



>ref|XP_004241212.1| PREDICTED: transcription initiation factor IIA large subunit 
[Solanum lycopersicum]
Length=401

 Score = 83.6 bits (205),  Expect = 3e-16, Method: Compositional matrix adjust.
 Identities = 37/47 (79%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            +WE+KMM AGAILG IERN+A K  PGGPITPVHDLN+PYEG+EEYE
Sbjct  42   LWEVKMMNAGAILGTIERNSAAKATPGGPITPVHDLNMPYEGNEEYE  88



>ref|XP_006584213.1| PREDICTED: TFIIA-alpha and beta-like factor-like [Glycine max]
Length=154

 Score = 80.9 bits (198),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAGAI+G IER+ APK  PGGPITPVHDLN+PYEG+EEYE
Sbjct  42   IWESKMMQAGAIVGLIERSGAPKPTPGGPITPVHDLNMPYEGTEEYE  88



>gb|KJB08914.1| hypothetical protein B456_001G112500 [Gossypium raimondii]
Length=391

 Score = 83.6 bits (205),  Expect = 4e-16, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 51/94 (54%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG ILGPIER++  +  PG  ITPVHDLNVPYEG+EEYE             
Sbjct  42   IWEAKMMQAGVILGPIERSSQKQPTPGSAITPVHDLNVPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  89   ---------------------TPTADMLFPPTPL  101



>gb|KHN12254.1| Transcription initiation factor IIA subunit 1 [Glycine soja]
Length=222

 Score = 81.3 bits (199),  Expect = 7e-16, Method: Compositional matrix adjust.
 Identities = 38/47 (81%), Positives = 42/47 (89%), Gaps = 0/47 (0%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAGAI+G IER+ APK  PGGPITPVHDLN+PYEG+EEYE
Sbjct  42   IWESKMMQAGAIVGLIERSGAPKPTPGGPITPVHDLNMPYEGTEEYE  88



>ref|XP_004486980.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Cicer arietinum]
Length=389

 Score = 82.4 bits (202),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/95 (51%), Positives = 55/95 (58%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNT-APKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWE KM+QAGA+LGPIER++ A K  PGGPITPVHDLNVPYEG+EEYE            
Sbjct  42   IWESKMIQAGAVLGPIERSSGANKPTPGGPITPVHDLNVPYEGTEEYE------------  89

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  90   ----------------------TPTAEILFPPTPL  102



>gb|ABD33143.2| Transcription factor IIA, helical [Medicago truncatula]
Length=317

 Score = 81.3 bits (199),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 54/95 (57%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTA-PKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWE K +QAGA+LGPIERNT   + +PGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   IWESKCIQAGAVLGPIERNTGVNRPMPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  91   ----------------------TPTAEILFPPTPL  103



>ref|XP_006379027.1| hypothetical protein POPTR_0009s04150g [Populus trichocarpa]
 gb|ERP56824.1| hypothetical protein POPTR_0009s04150g [Populus trichocarpa]
Length=303

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 55/95 (58%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE KMMQAGAI G I+R++A K+ VPGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   LWETKMMQAGAICGTIDRSSANKLPVPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTP+
Sbjct  91   ----------------------TPTAEILFPPTPM  103



>gb|EPS67672.1| hypothetical protein M569_07102, partial [Genlisea aurea]
Length=240

 Score = 80.5 bits (197),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 48/97 (49%), Positives = 55/97 (57%), Gaps = 36/97 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT--PVHDLNVPYEGSEEYEtptadllfppt  114
            +WE+KMMQAGAILGPI+R++  K   GGPIT  P+HDLNVPY+GSEEYE           
Sbjct  40   LWELKMMQAGAILGPIDRSSMQKGPAGGPITPNPLHDLNVPYDGSEEYE-----------  88

Query  113  plptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPLP  3
                                   TPT DLLFPPTPLP
Sbjct  89   -----------------------TPTADLLFPPTPLP  102



>gb|KEH39459.1| transcription factor IIA, alpha/beta subunit [Medicago truncatula]
Length=304

 Score = 80.9 bits (198),  Expect = 1e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 54/95 (57%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTA-PKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWE K +QAGA+LGPIERNT   + +PGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   IWESKCIQAGAVLGPIERNTGVNRPMPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  91   ----------------------TPTAEILFPPTPL  103



>ref|XP_003597404.1| Transcription factor/ transcription initiation factor [Medicago 
truncatula]
 gb|AES67655.1| transcription factor IIA, alpha/beta subunit [Medicago truncatula]
 gb|AFK49588.1| unknown [Medicago truncatula]
Length=388

 Score = 81.3 bits (199),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 47/95 (49%), Positives = 54/95 (57%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTA-PKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWE K +QAGA+LGPIERNT   + +PGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   IWESKCIQAGAVLGPIERNTGVNRPMPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  91   ----------------------TPTAEILFPPTPL  103



>ref|XP_011032249.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X2 [Populus euphratica]
Length=369

 Score = 80.5 bits (197),  Expect = 3e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 54/95 (57%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE KMMQAGAI G  ER++A K+ VPGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   LWEAKMMQAGAICGTAERSSANKLPVPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTP+
Sbjct  91   ----------------------TPTAEMLFPPTPM  103



>ref|XP_011032247.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X1 [Populus euphratica]
Length=408

 Score = 80.9 bits (198),  Expect = 4e-15, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 54/95 (57%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE KMMQAGAI G  ER++A K+ VPGGPITPVHDLNVPYEG+EEYE            
Sbjct  43   LWEAKMMQAGAICGTAERSSANKLPVPGGPITPVHDLNVPYEGTEEYE------------  90

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTP+
Sbjct  91   ----------------------TPTAEMLFPPTPM  103



>ref|XP_010685693.1| PREDICTED: transcription initiation factor IIA large subunit 
[Beta vulgaris subsp. vulgaris]
Length=389

 Score = 80.5 bits (197),  Expect = 5e-15, Method: Compositional matrix adjust.
 Identities = 46/94 (49%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE+KMMQAGA+L P ER T PK VPG  ITPVHDLNVPYEG+EEYE             
Sbjct  42   LWELKMMQAGAVLQPSERPTVPKPVPGAAITPVHDLNVPYEGTEEYE-------------  88

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  89   ---------------------TPTAEMLFPPTPL  101



>ref|XP_009787287.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Nicotiana sylvestris]
Length=403

 Score = 80.1 bits (196),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 39/48 (81%), Positives = 41/48 (85%), Gaps = 1/48 (2%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPI-TPVHDLNVPYEGSEEYE  147
            +WEMKMM AGAILG  ERN APK  PGGPI TPVHDLNVPYEG+EEYE
Sbjct  42   LWEMKMMHAGAILGTTERNPAPKGTPGGPITTPVHDLNVPYEGTEEYE  89



>ref|XP_010535450.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Tarenaya hassleriana]
Length=361

 Score = 79.3 bits (194),  Expect = 8e-15, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 52/94 (55%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG I GPI+R++A K  PGG +TP+HDLNVPYEG+EEYE             
Sbjct  43   IWEDKMMQAGVISGPIDRSSAQKPTPGGALTPMHDLNVPYEGNEEYE-------------  89

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  90   ---------------------TPTAEMLFPPTPL  102



>ref|XP_006846335.1| hypothetical protein AMTR_s00012p00256620 [Amborella trichopoda]
 gb|ERN08010.1| hypothetical protein AMTR_s00012p00256620 [Amborella trichopoda]
Length=232

 Score = 78.2 bits (191),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 44/94 (47%), Positives = 53/94 (56%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE+KMMQ GAI GP++RN AP++   GPITPVHDLNVPYEGSEEY+             
Sbjct  41   LWELKMMQCGAIQGPLDRNCAPRMP--GPITPVHDLNVPYEGSEEYQ-------------  85

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  86   ---------------------TPTAEMLFPPTPL  98



>ref|XP_010106542.1| Transcription initiation factor IIA large subunit [Morus notabilis]
 gb|EXC10718.1| Transcription initiation factor IIA large subunit [Morus notabilis]
Length=404

 Score = 79.3 bits (194),  Expect = 1e-14, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 50/94 (53%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMM AG +  PIER+ A K  PGGPITPVHDLNVPYEG+EEYE             
Sbjct  40   MWEAKMMHAGVVNSPIERSGAAKPTPGGPITPVHDLNVPYEGTEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  87   ---------------------TPTADMLFPPTPL  99



>ref|XP_010521880.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Tarenaya hassleriana]
Length=366

 Score = 78.2 bits (191),  Expect = 3e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWEMKMM AG I GPIER++APK +PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWEMKMMHAGVICGPIERSSAPKPIPGGPLT--HDLNVPYEGAEEYE  87



>gb|ABW81076.1| TF1 [Cleome spinosa]
Length=385

 Score = 77.8 bits (190),  Expect = 4e-14, Method: Compositional matrix adjust.
 Identities = 36/47 (77%), Positives = 41/47 (87%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWEMKMM AG I GPIER++APK +PGGP+T  HDLNVPYEG+EEYE
Sbjct  62   IWEMKMMHAGVICGPIERSSAPKPIPGGPLT--HDLNVPYEGAEEYE  106



>ref|XP_007150356.1| hypothetical protein PHAVU_005G146700g [Phaseolus vulgaris]
 gb|ESW22350.1| hypothetical protein PHAVU_005G146700g [Phaseolus vulgaris]
Length=386

 Score = 77.0 bits (188),  Expect = 8e-14, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 52/94 (55%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER+ A K  PGGPITPVHDLN+PY  +EEYE             
Sbjct  42   MWESKMMQAGAVLGPIERSAAAKPTPGGPITPVHDLNMPY--TEEYE-------------  86

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  87   ---------------------TPTAEMLFPPTPL  99



>ref|XP_002282322.1| PREDICTED: transcription initiation factor IIA subunit 1 [Vitis 
vinifera]
 emb|CBI16085.3| unnamed protein product [Vitis vinifera]
Length=393

 Score = 76.3 bits (186),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 45/96 (47%), Positives = 51/96 (53%), Gaps = 36/96 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPG--GPITPVHDLNVPYEGSEEYEtptadllfppt  114
            IWEMKM+QAG + GPIER+TAPK   G   P  PVHDLNVPYEG+EEYE           
Sbjct  43   IWEMKMVQAGVVTGPIERSTAPKQTSGAPAPTPPVHDLNVPYEGTEEYE-----------  91

Query  113  plptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                   TPT ++LFPPTPL
Sbjct  92   -----------------------TPTAEILFPPTPL  104



>gb|KDO66629.1| hypothetical protein CISIN_1g015442mg [Citrus sinensis]
Length=281

 Score = 74.7 bits (182),  Expect = 2e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 52/95 (55%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWEMKM+QAG I   I+R +APK   PGGPITPVHDLNVPYEG+EEYE            
Sbjct  41   IWEMKMIQAGVI---IDRTSAPKQPAPGGPITPVHDLNVPYEGTEEYE------------  85

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  86   ----------------------TPTAEILFPPTPL  98



>ref|XP_006305104.1| hypothetical protein CARUB_v10009471mg [Capsella rubella]
 gb|EOA38002.1| hypothetical protein CARUB_v10009471mg [Capsella rubella]
Length=375

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 51/94 (54%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMQAGVLSGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE-------------  87

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTP+
Sbjct  88   ---------------------TPTAEMLFPPTPM  100



>gb|KJB55820.1| hypothetical protein B456_009G096500 [Gossypium raimondii]
Length=345

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 45/90 (50%), Positives = 48/90 (53%), Gaps = 35/90 (39%)
 Frame = -1

Query  272  MMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptplptpa  96
            MMQAGAI GPIER+T  K    GGPITPVHDLNVPYEG+EEYE                 
Sbjct  1    MMQAGAICGPIERSTGQKQPTAGGPITPVHDLNVPYEGTEEYE-----------------  43

Query  95   ptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                             TPT D+LFPPTPL
Sbjct  44   -----------------TPTADMLFPPTPL  56



>gb|KDO66626.1| hypothetical protein CISIN_1g015442mg [Citrus sinensis]
Length=386

 Score = 75.1 bits (183),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 52/95 (55%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWEMKM+QAG I   I+R +APK   PGGPITPVHDLNVPYEG+EEYE            
Sbjct  21   IWEMKMIQAGVI---IDRTSAPKQPAPGGPITPVHDLNVPYEGTEEYE------------  65

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  66   ----------------------TPTAEILFPPTPL  78



>ref|XP_006305101.1| hypothetical protein CARUB_v10009468mg [Capsella rubella]
 gb|EOA37999.1| hypothetical protein CARUB_v10009468mg [Capsella rubella]
Length=375

 Score = 74.7 bits (182),  Expect = 4e-13, Method: Compositional matrix adjust.
 Identities = 43/94 (46%), Positives = 51/94 (54%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMQAGVLSGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE-------------  87

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTP+
Sbjct  88   ---------------------TPTAEMLFPPTPM  100



>ref|XP_006417799.1| hypothetical protein EUTSA_v10007947mg [Eutrema salsugineum]
 gb|ESQ36152.1| hypothetical protein EUTSA_v10007947mg [Eutrema salsugineum]
Length=375

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWEMKMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWEMKMMQAGVLSGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_008222094.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Prunus mume]
Length=386

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 47/93 (51%), Gaps = 34/93 (37%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE KMMQAG +  PIER  A K  PG  ITPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKMMQAGVVNAPIERAVASKPTPGSAITPVHDLNVPYEGTEEYE--------------  86

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  87   --------------------TPTAEILFPPTPL  99



>ref|XP_006417801.1| hypothetical protein EUTSA_v10007946mg [Eutrema salsugineum]
 dbj|BAJ33917.1| unnamed protein product [Thellungiella halophila]
 gb|ESQ36154.1| hypothetical protein EUTSA_v10007946mg [Eutrema salsugineum]
Length=375

 Score = 74.7 bits (182),  Expect = 5e-13, Method: Compositional matrix adjust.
 Identities = 35/47 (74%), Positives = 40/47 (85%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWEMKMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWEMKMMQAGVLSGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>gb|KDO66627.1| hypothetical protein CISIN_1g015442mg [Citrus sinensis]
Length=406

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 52/95 (55%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWEMKM+QAG I   I+R +APK   PGGPITPVHDLNVPYEG+EEYE            
Sbjct  41   IWEMKMIQAGVI---IDRTSAPKQPAPGGPITPVHDLNVPYEGTEEYE------------  85

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  86   ----------------------TPTAEILFPPTPL  98



>ref|XP_006424899.1| hypothetical protein CICLE_v10028561mg [Citrus clementina]
 ref|XP_006488381.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Citrus sinensis]
 gb|ESR38139.1| hypothetical protein CICLE_v10028561mg [Citrus clementina]
Length=406

 Score = 74.7 bits (182),  Expect = 6e-13, Method: Compositional matrix adjust.
 Identities = 46/95 (48%), Positives = 52/95 (55%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            IWEMKM+QAG I   I+R +APK   PGGPITPVHDLNVPYEG+EEYE            
Sbjct  41   IWEMKMIQAGVI---IDRTSAPKQPAPGGPITPVHDLNVPYEGTEEYE------------  85

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  86   ----------------------TPTAEILFPPTPL  98



>ref|XP_010520257.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Tarenaya hassleriana]
Length=379

 Score = 74.3 bits (181),  Expect = 8e-13, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 49/94 (52%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMM AG + GPI R+ A K  PGG +TP+HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMHAGVLSGPIGRSFAQKPTPGGSLTPMHDLNVPYEGNEEYE-------------  89

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  90   ---------------------TPTAEMLFPPTPL  102



>ref|XP_007205331.1| hypothetical protein PRUPE_ppa006992mg [Prunus persica]
 gb|EMJ06530.1| hypothetical protein PRUPE_ppa006992mg [Prunus persica]
Length=386

 Score = 73.9 bits (180),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 43/93 (46%), Positives = 47/93 (51%), Gaps = 34/93 (37%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE KMMQAG +  PIER  A K  PG  ITPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKMMQAGVVNTPIERAVASKPTPGSAITPVHDLNVPYEGTEEYE--------------  86

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  87   --------------------TPTAEILFPPTPL  99



>ref|XP_009118436.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Brassica rapa]
Length=375

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG + GPIER++A +  PGGP+T  HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMQAGVLSGPIERSSAQRPTPGGPLT--HDLNVPYEGTEEYE-------------  87

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTP+
Sbjct  88   ---------------------TPTAEMLFPPTPM  100



>emb|CDY06262.1| BnaA09g49410D [Brassica napus]
Length=375

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG + GPIER++A +  PGGP+T  HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMQAGVLSGPIERSSAQRPTPGGPLT--HDLNVPYEGTEEYE-------------  87

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTP+
Sbjct  88   ---------------------TPTAEMLFPPTPM  100



>emb|CDY09915.1| BnaC08g45360D [Brassica napus]
Length=375

 Score = 73.6 bits (179),  Expect = 1e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 51/94 (54%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE KMMQAG + GPIER++A +  PGGP+T  HDLNVPYEG+EEYE             
Sbjct  43   IWETKMMQAGVLSGPIERSSAQRPTPGGPLT--HDLNVPYEGTEEYE-------------  87

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTP+
Sbjct  88   ---------------------TPTAEMLFPPTPM  100



>ref|XP_002298340.1| transcription factor IIA large subunit family protein [Populus 
trichocarpa]
 gb|EEE83145.1| transcription factor IIA large subunit family protein [Populus 
trichocarpa]
Length=409

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 36/96 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPK-VVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE K+MQAG + GPI R++A K +VPGG +TPVHDLNVPYEG+EEYE            
Sbjct  42   LWEKKLMQAGVLSGPIVRSSANKQLVPGG-LTPVHDLNVPYEGTEEYE------------  88

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPLP  3
                                  TPT ++LFPPTPLP
Sbjct  89   ----------------------TPTAEILFPPTPLP  102



>ref|XP_010542635.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Tarenaya hassleriana]
Length=376

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG I GPIER++A K  PGGP+T  HDLNVPY+G+EEYE
Sbjct  44   IWERKMMQAGVICGPIERSSAQKPTPGGPLT--HDLNVPYDGTEEYE  88



>ref|XP_011080825.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Sesamum indicum]
Length=410

 Score = 73.6 bits (179),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 35/48 (73%), Positives = 40/48 (83%), Gaps = 2/48 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT--PVHDLNVPYEGSEEY  150
            +WE+KMMQAGAILGPI+R+   K   GGPIT  PVHDLNVPYEG+EEY
Sbjct  42   LWELKMMQAGAILGPIDRSATQKSGAGGPITPNPVHDLNVPYEGTEEY  89



>emb|CAN83895.1| hypothetical protein VITISV_039114 [Vitis vinifera]
Length=630

 Score = 73.9 bits (180),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 50/96 (52%), Gaps = 36/96 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPG--GPITPVHDLNVPYEGSEEYEtptadllfppt  114
            IWEMKM+QAG + GPIER+ APK   G   P  PVHDLNVPYEG+EEYE           
Sbjct  43   IWEMKMVQAGVVTGPIERSXAPKQTSGAPAPTPPVHDLNVPYEGTEEYE-----------  91

Query  113  plptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                   TPT ++LFPPTPL
Sbjct  92   -----------------------TPTAEILFPPTPL  104



>ref|XP_006369542.1| hypothetical protein POPTR_0001s25120g [Populus trichocarpa]
 gb|ERP66111.1| hypothetical protein POPTR_0001s25120g [Populus trichocarpa]
Length=405

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 36/96 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPK-VVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE K+MQAG + GPI R++A K +VPGG +TPVHDLNVPYEG+EEYE            
Sbjct  42   LWEKKLMQAGVLSGPIVRSSANKQLVPGG-LTPVHDLNVPYEGTEEYE------------  88

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPLP  3
                                  TPT ++LFPPTPLP
Sbjct  89   ----------------------TPTAEILFPPTPLP  102



>ref|XP_009622244.1| PREDICTED: transcription initiation factor IIA large subunit 
{ECO:0000250|UniProtKB:P32773, ECO:0000312|EMBL:CAB57938.1}-like 
[Nicotiana tomentosiformis]
Length=401

 Score = 73.2 bits (178),  Expect = 2e-12, Method: Compositional matrix adjust.
 Identities = 37/48 (77%), Positives = 40/48 (83%), Gaps = 3/48 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPI-TPVHDLNVPYEGSEEYE  147
            +WEMKMM AGAILG  ERN+APK    GPI TPVHDLNVPYEG+EEYE
Sbjct  42   LWEMKMMHAGAILGTTERNSAPKGT--GPITTPVHDLNVPYEGTEEYE  87



>ref|XP_010262270.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Nelumbo nucifera]
Length=382

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 50/94 (53%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE+KMMQ G + GPIERN+AP+    G  TPVHDLNVPYEG+EEYE             
Sbjct  40   LWELKMMQCGVVQGPIERNSAPR--GSGVPTPVHDLNVPYEGTEEYE-------------  84

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  85   ---------------------TPTAEMLFPPTPL  97



>ref|XP_010262269.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Nelumbo nucifera]
Length=404

 Score = 72.8 bits (177),  Expect = 3e-12, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 50/94 (53%), Gaps = 36/94 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE+KMMQ G + GPIERN+AP+    G  TPVHDLNVPYEG+EEYE             
Sbjct  40   LWELKMMQCGVVQGPIERNSAPR--GSGVPTPVHDLNVPYEGTEEYE-------------  84

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  85   ---------------------TPTAEMLFPPTPL  97



>ref|XP_010475508.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Camelina sativa]
Length=375

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_010475506.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Camelina sativa]
Length=375

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_002889649.1| hypothetical protein ARALYDRAFT_470771 [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH65908.1| hypothetical protein ARALYDRAFT_470771 [Arabidopsis lyrata subsp. 
lyrata]
Length=373

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_002892402.1| transcription factor IIA large subunit [Arabidopsis lyrata subsp. 
lyrata]
 gb|EFH68661.1| transcription factor IIA large subunit [Arabidopsis lyrata subsp. 
lyrata]
Length=375

 Score = 72.4 bits (176),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_010457931.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Camelina sativa]
Length=378

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_010487493.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Camelina sativa]
Length=375

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|NP_850937.1| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
 ref|NP_172228.3| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
 emb|CAA11525.1| transcription factor IIA large subunit [Arabidopsis thaliana]
 gb|AAR28029.1| TFIIA-L1 [Arabidopsis thaliana]
 dbj|BAH19617.1| AT1G07480 [Arabidopsis thaliana]
 dbj|BAH30277.1| hypothetical protein [Arabidopsis thaliana]
 gb|AEE28132.1| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
 gb|AEE28133.1| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
Length=375

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_010487504.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Camelina sativa]
Length=376

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_010457928.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Camelina sativa]
Length=378

 Score = 72.0 bits (175),  Expect = 4e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_007150517.1| hypothetical protein PHAVU_005G159000g [Phaseolus vulgaris]
 gb|ESW22511.1| hypothetical protein PHAVU_005G159000g [Phaseolus vulgaris]
Length=385

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 45/94 (48%), Positives = 52/94 (55%), Gaps = 37/94 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGPIER+TA K  P GPITPVHDLN+PY  +EEYE             
Sbjct  42   MWESKMMQAGAVLGPIERSTAAKPTP-GPITPVHDLNMPY--TEEYE-------------  85

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  86   ---------------------TPTAEMLFPPTPL  98



>ref|NP_563790.1| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
 gb|AAL11553.1|AF424559_1 At1g07470/F22G5_13 [Arabidopsis thaliana]
 gb|AAK64164.1| putative transcription factor IIA large subunit [Arabidopsis 
thaliana]
 gb|AAK83596.1| At1g07470/F22G5_13 [Arabidopsis thaliana]
 gb|AAM63114.1| transcription factor IIA large subunit [Arabidopsis thaliana]
 gb|AAM91736.1| putative transcription factor IIA large subunit [Arabidopsis 
thaliana]
 gb|AAR27999.1| TFIIA-L2 [Arabidopsis thaliana]
 gb|AEE28129.1| transcription factor IIA, alpha/beta subunit [Arabidopsis thaliana]
Length=375

 Score = 72.0 bits (175),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>emb|CAA67368.1| TFIIA [Arabidopsis thaliana]
Length=375

 Score = 71.6 bits (174),  Expect = 5e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>gb|AAF79573.1|AC022464_31 F22G5.18 [Arabidopsis thaliana]
Length=475

 Score = 72.4 bits (176),  Expect = 6e-12, Method: Compositional matrix adjust.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_009118437.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Brassica rapa]
Length=371

 Score = 71.6 bits (174),  Expect = 7e-12, Method: Compositional matrix adjust.
 Identities = 33/47 (70%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A +  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLSGPIERSSAQRPTPGGPLT--HDLNVPYEGTEEYE  87



>gb|EYU45954.1| hypothetical protein MIMGU_mgv1a007767mg [Erythranthe guttata]
Length=396

 Score = 70.9 bits (172),  Expect = 1e-11, Method: Compositional matrix adjust.
 Identities = 35/49 (71%), Positives = 42/49 (86%), Gaps = 3/49 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT--PVHDLNVPYEGSEEYE  147
            +WE+KMM+AGAILGPI+R+ + K   GGPIT  PVHDLNVPYEG+EEYE
Sbjct  42   LWELKMMEAGAILGPIDRSASQKGA-GGPITPNPVHDLNVPYEGTEEYE  89



>gb|AAF79551.1|AC022464_9 F22G5.14 [Arabidopsis thaliana]
Length=488

 Score = 71.2 bits (173),  Expect = 1e-11, Method: Composition-based stats.
 Identities = 34/47 (72%), Positives = 39/47 (83%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  87



>emb|CDX86480.1| BnaC08g02230D [Brassica napus]
Length=371

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 32/47 (68%), Positives = 38/47 (81%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG   GPI+R++A +  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVSSGPIDRSSAQRSTPGGPLT--HDLNVPYEGTEEYE  87



>ref|XP_008384920.1| PREDICTED: transcription initiation factor IIA large subunit 
[Malus domestica]
Length=387

 Score = 70.5 bits (171),  Expect = 2e-11, Method: Compositional matrix adjust.
 Identities = 42/94 (45%), Positives = 48/94 (51%), Gaps = 35/94 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            IWE K MQAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE             
Sbjct  40   IWEAKTMQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE-------------  85

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT ++LFPPTPL
Sbjct  86   ---------------------TPTAEILFPPTPL  98



>ref|XP_008803109.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X3 [Phoenix dactylifera]
Length=379

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 49/95 (52%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKMMQ GAI G IER   P   P GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMMQCGAISGAIER-PPPAQKPSGPITPVHDLNVPYEGPAEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_008803108.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X2 [Phoenix dactylifera]
Length=381

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 49/95 (52%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKMMQ GAI G IER   P   P GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMMQCGAISGAIER-PPPAQKPSGPITPVHDLNVPYEGPAEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_009387333.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=391

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 49/95 (52%), Gaps = 37/95 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI G IER+T PK     PITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMRQCGAISGNIERSTLPK--NAAPITPVHDLNVPYEGPAEEYE------------  85

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  86   ----------------------TPTAEMLFPPTPL  98



>ref|XP_008803107.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X1 [Phoenix dactylifera]
Length=383

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 45/95 (47%), Positives = 49/95 (52%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKMMQ GAI G IER   P   P GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMMQCGAISGAIER-PPPAQKPSGPITPVHDLNVPYEGPAEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_009387325.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=392

 Score = 69.3 bits (168),  Expect = 4e-11, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 49/95 (52%), Gaps = 37/95 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI G IER+T PK     PITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMRQCGAISGNIERSTLPK--NAAPITPVHDLNVPYEGPAEEYE------------  85

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  86   ----------------------TPTAEMLFPPTPL  98



>ref|XP_006369541.1| hypothetical protein POPTR_0001s25120g [Populus trichocarpa]
 gb|ERP66110.1| hypothetical protein POPTR_0001s25120g [Populus trichocarpa]
Length=455

 Score = 69.7 bits (169),  Expect = 4e-11, Method: Composition-based stats.
 Identities = 44/96 (46%), Positives = 54/96 (56%), Gaps = 36/96 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPK-VVPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE K+MQAG + GPI R++A K +VPGG +TPVHDLNVPYEG+EEYE            
Sbjct  42   LWEKKLMQAGVLSGPIVRSSANKQLVPGG-LTPVHDLNVPYEGTEEYE------------  88

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPLP  3
                                  TPT ++LFPPTPLP
Sbjct  89   ----------------------TPTAEILFPPTPLP  102



>ref|XP_009375942.1| PREDICTED: transcription initiation factor IIA large subunit 
[Pyrus x bretschneideri]
Length=387

 Score = 68.6 bits (166),  Expect = 8e-11, Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 47/93 (51%), Gaps = 35/93 (38%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE K MQAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKTMQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE--------------  85

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  86   --------------------TPTAEILFPPTPL  98



>ref|XP_008344834.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Malus domestica]
Length=369

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 47/93 (51%), Gaps = 35/93 (38%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE K +QAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKTVQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE--------------  85

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  86   --------------------TPTAEMLFPPTPL  98



>ref|XP_009364351.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Pyrus x bretschneideri]
Length=387

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 47/93 (51%), Gaps = 35/93 (38%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE K +QAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKTVQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE--------------  85

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  86   --------------------TPTAEMLFPPTPL  98



>ref|XP_008344833.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X1 [Malus domestica]
Length=387

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 47/93 (51%), Gaps = 35/93 (38%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE K +QAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKTVQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE--------------  85

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  86   --------------------TPTAEMLFPPTPL  98



>ref|XP_009364352.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Pyrus x bretschneideri]
Length=383

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 40/93 (43%), Positives = 47/93 (51%), Gaps = 35/93 (38%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptplp  105
            WE K +QAG +  PIER +A K  PG  +TPVHDLNVPYEG+EEYE              
Sbjct  41   WEAKTVQAGVVNNPIER-SAAKGTPGSGVTPVHDLNVPYEGTEEYE--------------  85

Query  104  tpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                TPT ++LFPPTPL
Sbjct  86   --------------------TPTAEMLFPPTPL  98



>ref|XP_004294662.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Fragaria vesca subsp. vesca]
Length=377

 Score = 67.4 bits (163),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/46 (70%), Positives = 36/46 (78%), Gaps = 2/46 (4%)
 Frame = -1

Query  284  WEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            WE KMMQAG +  PIER+ A K  PG  +TPVHDLNVPYEG+EEYE
Sbjct  39   WEAKMMQAGVVNAPIERSAAAKPTPG--VTPVHDLNVPYEGTEEYE  82



>dbj|BAJ34634.1| unnamed protein product [Thellungiella halophila]
Length=330

 Score = 66.6 bits (161),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/44 (73%), Positives = 37/44 (84%), Gaps = 2/44 (5%)
 Frame = -1

Query  278  MKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            MKMMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  1    MKMMQAGVLSGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  42



>ref|XP_009110942.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Brassica rapa]
Length=376

 Score = 67.0 bits (162),  Expect = 2e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAP-KVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPI+R++A  +  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLSGPIDRSSAAQRSTPGGPLT--HDLNVPYEGTEEYE  88



>emb|CDY15611.1| BnaA08g28950D [Brassica napus]
Length=376

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 32/48 (67%), Positives = 39/48 (81%), Gaps = 3/48 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNT-APKVVPGGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPI+R++ A +  PGGP+T  HDLNVPYEG+EEYE
Sbjct  43   IWETKMMQAGVLSGPIDRSSVAQRSTPGGPLT--HDLNVPYEGTEEYE  88



>gb|KDO66628.1| hypothetical protein CISIN_1g015442mg [Citrus sinensis]
Length=363

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 43/92 (47%), Positives = 49/92 (53%), Gaps = 38/92 (41%)
 Frame = -1

Query  278  MKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptplpt  102
            MKM+QAG I   I+R +APK   PGGPITPVHDLNVPYEG+EEYE               
Sbjct  1    MKMIQAGVI---IDRTSAPKQPAPGGPITPVHDLNVPYEGTEEYE---------------  42

Query  101  paptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                               TPT ++LFPPTPL
Sbjct  43   -------------------TPTAEILFPPTPL  55



>ref|XP_008801612.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Phoenix dactylifera]
Length=374

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKMMQ GAI G IER   P     GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMMQCGAISGTIER-PPPAQKAAGPITPVHDLNVPYEGPTEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_010920519.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X1 [Elaeis guineensis]
Length=383

 Score = 67.0 bits (162),  Expect = 3e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI G IER   P   P GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMKQCGAISGTIER-PPPAQKPAGPITPVHDLNVPYEGPTEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_010920520.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X2 [Elaeis guineensis]
Length=381

 Score = 66.6 bits (161),  Expect = 4e-10, Method: Compositional matrix adjust.
 Identities = 44/95 (46%), Positives = 48/95 (51%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI G IER   P   P GPITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMKQCGAISGTIER-PPPAQKPAGPITPVHDLNVPYEGPTEEYE------------  86

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  87   ----------------------TPTAEMLFPPTPL  99



>ref|XP_010033104.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Eucalyptus grandis]
 gb|KCW52648.1| hypothetical protein EUGRSUZ_J02029 [Eucalyptus grandis]
Length=393

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/94 (44%), Positives = 49/94 (52%), Gaps = 34/94 (36%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYEtptadllfpptpl  108
            +WE KMMQAGA+LGP++R+   K   GG   PVHDLNVPYEG+EE+E             
Sbjct  43   MWETKMMQAGAVLGPVDRSATAKAPAGGAAAPVHDLNVPYEGTEEFE-------------  89

Query  107  ptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                 TPT D+LFPPTPL
Sbjct  90   ---------------------TPTADMLFPPTPL  102



>ref|XP_011035265.1| PREDICTED: transcription initiation factor IIA large subunit-like 
[Populus euphratica]
Length=405

 Score = 65.9 bits (159),  Expect = 7e-10, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 50/95 (53%), Gaps = 36/95 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV-VPGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE K+ QAG + G I R++A K  VPGG +TPVHDLNVPYEG+EEYE            
Sbjct  42   LWEKKLKQAGVLSGSIVRSSANKQPVPGG-LTPVHDLNVPYEGTEEYE------------  88

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  89   ----------------------TPTAEILFPPTPL  101



>ref|XP_006827510.1| hypothetical protein AMTR_s00009p00181330 [Amborella trichopoda]
 gb|ERM94926.1| hypothetical protein AMTR_s00009p00181330 [Amborella trichopoda]
Length=228

 Score = 63.2 bits (152),  Expect = 2e-09, Method: Compositional matrix adjust.
 Identities = 31/47 (66%), Positives = 36/47 (77%), Gaps = 2/47 (4%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            +WE+K+MQ GAI G IER+ AP     G +TPVHDLNVPYEG EEYE
Sbjct  40   LWELKLMQRGAIKGVIERSPAPG--GAGSVTPVHDLNVPYEGLEEYE  84



>emb|CDY06709.1| BnaA10g04880D [Brassica napus]
Length=234

 Score = 62.0 bits (149),  Expect = 5e-09, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVP-GGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPI+R+   +  P GGP+T  HDLNVPYEG+EEYE
Sbjct  41   IWETKMMQAGVLSGPIDRSLLQRPTPGGGPLT--HDLNVPYEGTEEYE  86



>ref|XP_010487510.1| PREDICTED: transcription initiation factor IIA large subunit-like 
isoform X2 [Camelina sativa]
Length=329

 Score = 62.4 bits (150),  Expect = 9e-09, Method: Compositional matrix adjust.
 Identities = 30/42 (71%), Positives = 35/42 (83%), Gaps = 2/42 (5%)
 Frame = -1

Query  272  MMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEGSEEYE  147
            MMQAG + GPIER++A K  PGGP+T  HDLNVPYEG+EEYE
Sbjct  1    MMQAGVLNGPIERSSAQKPTPGGPLT--HDLNVPYEGTEEYE  40



>emb|CDY10278.1| BnaC05g05210D [Brassica napus]
Length=368

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 31/48 (65%), Positives = 37/48 (77%), Gaps = 3/48 (6%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVP-GGPITPVHDLNVPYEGSEEYE  147
            IWE KMMQAG + GPI+R+   +  P GGP+T  HDLNVPYEG+EEYE
Sbjct  41   IWETKMMQAGVLSGPIDRSLVQRPTPGGGPLT--HDLNVPYEGTEEYE  86



>gb|ABK25179.1| unknown [Picea sitchensis]
Length=398

 Score = 62.4 bits (150),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 38/95 (40%), Positives = 47/95 (49%), Gaps = 35/95 (37%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVV-PGGPITPVHDLNVPYEGSEEYEtptadllfpptp  111
            +WE+KMMQ GAI GPI+  +   +     PITPVHDLNVPYE +EEYE            
Sbjct  58   LWELKMMQNGAIQGPIDHASNSALRGANAPITPVHDLNVPYEPTEEYE------------  105

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTP+
Sbjct  106  ----------------------TPTAEMLFPPTPV  118



>ref|XP_009409507.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Musa acuminata subsp. malaccensis]
Length=382

 Score = 62.0 bits (149),  Expect = 1e-08, Method: Compositional matrix adjust.
 Identities = 41/95 (43%), Positives = 48/95 (51%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKMMQ GA L  +ER++  K     PITPVHDLNVPYEG +EEYE            
Sbjct  40   LWEMKMMQCGA-LSDVERSSLRK--NAAPITPVHDLNVPYEGPAEEYE------------  84

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  85   ----------------------TPTAEMLFPPTPL  97



>gb|EMS50757.1| Transcription initiation factor IIA subunit 1 [Triticum urartu]
Length=288

 Score = 57.4 bits (137),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 38/97 (39%), Positives = 44/97 (45%), Gaps = 37/97 (38%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAP--KVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpp  117
            +WE K++  GAI G I+RN AP      GG   PVHDLNVPYE  SEEY           
Sbjct  38   LWETKLLHCGAISGNIDRNRAPPAGASAGGATPPVHDLNVPYEATSEEYA----------  87

Query  116  tplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                    TPT D+LFPPTP+
Sbjct  88   ------------------------TPTADMLFPPTPV  100



>ref|NP_001148644.1| transcription factor/ transcription initiation factor [Zea mays]
 gb|ACG32369.1| transcription factor/ transcription initiation factor [Zea mays]
Length=390

 Score = 58.2 bits (139),  Expect = 3e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPG---GPITPVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     G   G   PVHDLNVPYE  SEEY          
Sbjct  41   LWEMKMLHCGAISGNIDRTKAAAASVGGTTGTTAPVHDLNVPYEATSEEYA---------  91

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  92   -------------------------TPTADMLFPPTPL  104



>ref|XP_009399862.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X2 [Musa acuminata subsp. malaccensis]
Length=372

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI   IER++ PK+      TPV DLNVPYEG +EEYE            
Sbjct  40   LWEMKMKQCGAIGDSIERSSLPKIAAP---TPVRDLNVPYEGPTEEYE------------  84

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  85   ----------------------TPTAEMLFPPTPL  97



>ref|XP_009399861.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
isoform X1 [Musa acuminata subsp. malaccensis]
Length=377

 Score = 57.8 bits (138),  Expect = 4e-07, Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 46/95 (48%), Gaps = 38/95 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WEMKM Q GAI   IER++ PK+      TPV DLNVPYEG +EEYE            
Sbjct  40   LWEMKMKQCGAIGDSIERSSLPKIAAP---TPVRDLNVPYEGPTEEYE------------  84

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT ++LFPPTPL
Sbjct  85   ----------------------TPTAEMLFPPTPL  97



>ref|XP_002452619.1| hypothetical protein SORBIDRAFT_04g029230 [Sorghum bicolor]
 gb|EES05595.1| hypothetical protein SORBIDRAFT_04g029230 [Sorghum bicolor]
Length=229

 Score = 56.2 bits (134),  Expect = 5e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  41   LWEMKMLHCGAISGNIDRTKAAAPSAGGTTGTTPPVHDLNVPYEATSEEYA---------  91

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  92   -------------------------TPTADMLFPPTPL  104



>gb|ACN31103.1| unknown [Zea mays]
Length=390

 Score = 57.4 bits (137),  Expect = 6e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  41   LWEMKMLHCGAISGNIDRTKAAAASVGGTTGTTPPVHDLNVPYEATSEEYA---------  91

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  92   -------------------------TPTADMLFPPTPL  104



>ref|XP_004962494.1| PREDICTED: LOW QUALITY PROTEIN: transcription initiation factor 
IIA subunit 1-like [Setaria italica]
Length=436

 Score = 57.4 bits (137),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  90   LWEMKMLHCGAISGNIDRTKAVGASTGGTAGATPPVHDLNVPYEATSEEYA---------  140

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  141  -------------------------TPTADMLFPPTPL  153



>gb|AFW81480.1| hypothetical protein ZEAMMB73_123227 [Zea mays]
Length=246

 Score = 55.8 bits (133),  Expect = 7e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  85   LWEMKMLHCGAISGNIDRTKAAAASVGGTTGTTPPVHDLNVPYEATSEEYA---------  135

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  136  -------------------------TPTADMLFPPTPL  148



>gb|AFW81478.1| transcription factor/ transcription initiation factor [Zea mays]
Length=434

 Score = 57.0 bits (136),  Expect = 8e-07, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  85   LWEMKMLHCGAISGNIDRTKAAAASVGGTTGTTPPVHDLNVPYEATSEEYA---------  135

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  136  -------------------------TPTADMLFPPTPL  148



>ref|XP_006654234.1| PREDICTED: transcription initiation factor IIA subunit 1-like 
[Oryza brachyantha]
Length=394

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 45/100 (45%), Gaps = 40/100 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERN-TAPKVVPGGPIT----PVHDLNVPYEG-SEEYEtptadll  126
            +WEMKM+  GAI G I+R+  AP    G P      PVHDLNVPYE  SEEY        
Sbjct  41   LWEMKMLHCGAISGNIDRSKAAPAASAGTPAAGGTPPVHDLNVPYEATSEEYA-------  93

Query  125  fpptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                       TPT D+LFPPTPL
Sbjct  94   ---------------------------TPTADMLFPPTPL  106



>ref|XP_008654956.1| PREDICTED: transcription factor/ transcription initiation factor 
isoform X1 [Zea mays]
 gb|AFW81479.1| hypothetical protein ZEAMMB73_123227 [Zea mays]
Length=437

 Score = 56.6 bits (135),  Expect = 1e-06, Method: Compositional matrix adjust.
 Identities = 39/98 (40%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G I+R  A     GG      PVHDLNVPYE  SEEY          
Sbjct  85   LWEMKMLHCGAISGNIDRTKAAAASVGGTTGTTPPVHDLNVPYEATSEEYA---------  135

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  136  -------------------------TPTADMLFPPTPL  148



>ref|NP_001055101.1| Os05g0292200 [Oryza sativa Japonica Group]
 dbj|BAF17015.1| Os05g0292200 [Oryza sativa Japonica Group]
 gb|EAY97386.1| hypothetical protein OsI_19309 [Oryza sativa Indica Group]
 dbj|BAG89493.1| unnamed protein product [Oryza sativa Japonica Group]
Length=394

 Score = 55.5 bits (132),  Expect = 3e-06, Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 45/100 (45%), Gaps = 40/100 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKV----VPGGPIT-PVHDLNVPYEG-SEEYEtptadll  126
            +WEMKM+  GAI G I+R+ A        PG   T PVHDLNVPYE  SEEY        
Sbjct  41   LWEMKMLHCGAISGTIDRSKAAPAPSAGTPGAGTTPPVHDLNVPYEATSEEYA-------  93

Query  125  fpptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                       TPT D+LFPPTPL
Sbjct  94   ---------------------------TPTADMLFPPTPL  106



>gb|AFW77525.1| hypothetical protein ZEAMMB73_875019 [Zea mays]
Length=322

 Score = 51.2 bits (121),  Expect = 5e-05, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G IER  A     GG      PVHDLNVPYE  SEEY          
Sbjct  86   LWEMKMLHCGAISGNIERTKAAAASAGGTSGTTPPVHDLNVPYEATSEEYA---------  136

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  137  -------------------------TPTADMLFPPTPL  149



>gb|AFW77526.1| transcription factor/ transcription initiation factor [Zea mays]
Length=438

 Score = 51.2 bits (121),  Expect = 7e-05, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G IER  A     GG      PVHDLNVPYE  SEEY          
Sbjct  86   LWEMKMLHCGAISGNIERTKAAAASAGGTSGTTPPVHDLNVPYEATSEEYA---------  136

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  137  -------------------------TPTADMLFPPTPL  149



>ref|NP_001148522.1| LOC100282138 [Zea mays]
 gb|ACG31826.1| transcription factor/ transcription initiation factor [Zea mays]
Length=393

 Score = 50.8 bits (120),  Expect = 8e-05, Method: Compositional matrix adjust.
 Identities = 40/98 (41%), Positives = 43/98 (44%), Gaps = 38/98 (39%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPIT---PVHDLNVPYEG-SEEYEtptadllfp  120
            +WEMKM+  GAI G IER  A     GG      PVHDLNVPYE  SEEY          
Sbjct  41   LWEMKMLHCGAISGNIERTKAAAASAGGTSGTTPPVHDLNVPYEATSEEYA---------  91

Query  119  ptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                     TPT D+LFPPTPL
Sbjct  92   -------------------------TPTADMLFPPTPL  104



>gb|EMT17178.1| Transcription initiation factor IIA subunit 1 [Aegilops tauschii]
Length=277

 Score = 50.1 bits (118),  Expect = 1e-04, Method: Compositional matrix adjust.
 Identities = 34/95 (36%), Positives = 41/95 (43%), Gaps = 39/95 (41%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNTAPKVVPGGPITPVHDLNVPYEG-SEEYEtptadllfpptp  111
            +WE K++  GAI G  +RN AP        +PV DLNVPYE  SEEY             
Sbjct  38   LWETKLLHCGAISGNTDRNRAPPA----SASPVRDLNVPYEATSEEYA------------  81

Query  110  lptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                  TPT D+LFPPTP+
Sbjct  82   ----------------------TPTADMLFPPTPI  94



>gb|EMS53336.1| Transcription initiation factor IIA subunit 1 [Triticum urartu]
Length=402

 Score = 48.9 bits (115),  Expect = 3e-04, Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 43/100 (43%), Gaps = 40/100 (40%)
 Frame = -1

Query  287  IWEMKMMQAGAILGPIERNT-----APKVVPGGPITPVHDLNVPYEG-SEEYEtptadll  126
            +WEMKM+  GAI G I+RN      A      G   PVHDLNVPYE  SEEY        
Sbjct  41   LWEMKMLHCGAISGNIDRNRPPPASAGGAPGAGATPPVHDLNVPYEATSEEY--------  92

Query  125  fpptplptpaptpmpgtaqtPLPGTAHTPTVDLLFPPTPL  6
                                       TPT D+LFPPTPL
Sbjct  93   --------------------------ATPTADMLFPPTPL  106



Lambda      K        H        a         alpha
   0.318    0.134    0.401    0.792     4.96 

Gapped
Lambda      K        H        a         alpha    sigma
   0.267   0.0410    0.140     1.90     42.6     43.6 

Effective search space used: 553413336175